Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Thyrotropin-releasing hormone receptor

Gene

Trhr

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Receptor for thyrotropin-releasing hormone. This receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system.

GO - Molecular functioni

  • protein homodimerization activity Source: RGD
  • thyrotropin-releasing hormone receptor activity Source: RGD

GO - Biological processi

  • positive regulation of cytosolic calcium ion concentration Source: RGD
  • positive regulation of protein homodimerization activity Source: RGD
Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Names & Taxonomyi

Protein namesi
Recommended name:
Thyrotropin-releasing hormone receptor
Short name:
TRH-R
Alternative name(s):
Thyroliberin receptor
Gene namesi
Name:Trhr
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi3904. Trhr.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 2828ExtracellularSequence analysisAdd
BLAST
Transmembranei29 – 5123Helical; Name=1Sequence analysisAdd
BLAST
Topological domaini52 – 6110CytoplasmicSequence analysis
Transmembranei62 – 8322Helical; Name=2Sequence analysisAdd
BLAST
Topological domaini84 – 9916ExtracellularSequence analysisAdd
BLAST
Transmembranei100 – 12122Helical; Name=3Sequence analysisAdd
BLAST
Topological domaini122 – 14423CytoplasmicSequence analysisAdd
BLAST
Transmembranei145 – 16824Helical; Name=4Sequence analysisAdd
BLAST
Topological domaini169 – 19325ExtracellularSequence analysisAdd
BLAST
Transmembranei194 – 21522Helical; Name=5Sequence analysisAdd
BLAST
Topological domaini216 – 26651CytoplasmicSequence analysisAdd
BLAST
Transmembranei267 – 28822Helical; Name=6Sequence analysisAdd
BLAST
Topological domaini289 – 2968ExtracellularSequence analysis
Transmembranei297 – 31923Helical; Name=7Sequence analysisAdd
BLAST
Topological domaini320 – 41293CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

  • cell surface Source: RGD
  • integral component of membrane Source: UniProtKB-KW
  • plasma membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Chemistry

ChEMBLiCHEMBL4553.
GuidetoPHARMACOLOGYi363.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 412412Thyrotropin-releasing hormone receptorPRO_0000070189Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi3 – 31N-linked (GlcNAc...)Sequence analysis
Glycosylationi10 – 101N-linked (GlcNAc...)Sequence analysis
Disulfide bondi98 ↔ 179PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ01717.

PTM databases

iPTMnetiQ01717.
PhosphoSiteiQ01717.

Interactioni

GO - Molecular functioni

  • protein homodimerization activity Source: RGD

Protein-protein interaction databases

BioGridi247601. 5 interactions.
DIPiDIP-41967N.
MINTiMINT-194128.
STRINGi10116.ENSRNOP00000006783.

Chemistry

BindingDBiQ01717.

Structurei

3D structure databases

ProteinModelPortaliQ01717.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3656. Eukaryota.
ENOG410XRW9. LUCA.
HOGENOMiHOG000017249.
HOVERGENiHBG007549.
InParanoidiQ01717.
KOiK04282.
PhylomeDBiQ01717.

Family and domain databases

InterProiIPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
IPR002120. TRH_rcpt_1.
[Graphical view]
PfamiPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSiPR00237. GPCRRHODOPSN.
PR00751. THYROLIBRINR.
PR01846. TRHRFAMILY.
SMARTiSM01381. 7TM_GPCR_Srsx. 1 hit.
[Graphical view]
PROSITEiPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform TRH-R(412) (identifier: Q01717-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MENETVSELN QTELPPQVAV ALEYQVVTIL LVVVICGLGI VGNIMVVLVV
60 70 80 90 100
MRTKHMRTAT NCYLVSLAVA DLMVLVAAGL PNITDSIYGS WVYGYVGCLC
110 120 130 140 150
ITYLQYLGIN ASSCSITAFT IERYIAICHP IKAQFLCTFS RAKKIIIFVW
160 170 180 190 200
AFTSIYCMLW FFLLDLNIST YKDAIVISCG YKISRNYYSP IYLMDFGVFY
210 220 230 240 250
VMPMILATVL YGFIARILFL NPIPSDPKEN SKTWKNDSTH QNKNMNLNTT
260 270 280 290 300
NRCFNSTVSS RKQVTKMLAV VVILFALLWM PYRTLVVVNS FLSSPFQENW
310 320 330 340 350
FLLFCRICIY LNSAINPVIY NLMSQKFRAA FRKLCNCKQK PTEKAANYSV
360 370 380 390 400
ALNYSVIKES DRFSTELDDI TVTDTYVSTT KVSFDDTCLA SEKNGPSSCT
410
YGYSLTAKQE KI
Length:412
Mass (Da):46,609
Last modified:April 1, 1993 - v1
Checksum:i52B35C9849D48A72
GO
Isoform TRH-R(387) (identifier: Q01717-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     376-412: YVSTTKVSFDDTCLASEKNGPSSCTYGYSLTAKQEKI → RMDPVLVHMDIL

Show »
Length:387
Mass (Da):44,024
Checksum:i9AA0F1C26AAE8221
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti59 – 591A → P (PubMed:7509436).Curated
Sequence conflicti59 – 591A → P (PubMed:1373613).Curated
Sequence conflicti223 – 2231I → T (PubMed:7509436).Curated
Sequence conflicti223 – 2231I → T (PubMed:1373613).Curated
Sequence conflicti321 – 3211N → T in AAB29945 (PubMed:7509436).Curated
Sequence conflicti321 – 3211N → T in AAB29946 (PubMed:7509436).Curated
Sequence conflicti393 – 3931Missing (PubMed:8387312).Curated
Sequence conflicti393 – 3931Missing (PubMed:1338727).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei376 – 41237YVSTT…KQEKI → RMDPVLVHMDIL in isoform TRH-R(387). CuratedVSP_001952Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M90308 mRNA. Translation: AAA42277.1.
X64630 mRNA. Translation: CAA45913.1.
X66726 mRNA. Translation: CAA47263.1.
D17469 mRNA. Translation: BAA04289.1.
S60053 mRNA. Translation: AAB26491.1.
S69160 mRNA. Translation: AAB29945.2.
S69161 mRNA. Translation: AAB29946.2.
S51512 mRNA. Translation: AAB24549.1.
PIRiI56444.
S23436.
RefSeqiNP_037179.1. NM_013047.3. [Q01717-1]
UniGeneiRn.9962.

Genome annotation databases

GeneIDi25570.
KEGGirno:25570.
UCSCiRGD:3904. rat. [Q01717-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M90308 mRNA. Translation: AAA42277.1.
X64630 mRNA. Translation: CAA45913.1.
X66726 mRNA. Translation: CAA47263.1.
D17469 mRNA. Translation: BAA04289.1.
S60053 mRNA. Translation: AAB26491.1.
S69160 mRNA. Translation: AAB29945.2.
S69161 mRNA. Translation: AAB29946.2.
S51512 mRNA. Translation: AAB24549.1.
PIRiI56444.
S23436.
RefSeqiNP_037179.1. NM_013047.3. [Q01717-1]
UniGeneiRn.9962.

3D structure databases

ProteinModelPortaliQ01717.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi247601. 5 interactions.
DIPiDIP-41967N.
MINTiMINT-194128.
STRINGi10116.ENSRNOP00000006783.

Chemistry

BindingDBiQ01717.
ChEMBLiCHEMBL4553.
GuidetoPHARMACOLOGYi363.

Protein family/group databases

GPCRDBiSearch...

PTM databases

iPTMnetiQ01717.
PhosphoSiteiQ01717.

Proteomic databases

PaxDbiQ01717.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi25570.
KEGGirno:25570.
UCSCiRGD:3904. rat. [Q01717-1]

Organism-specific databases

CTDi7201.
RGDi3904. Trhr.

Phylogenomic databases

eggNOGiKOG3656. Eukaryota.
ENOG410XRW9. LUCA.
HOGENOMiHOG000017249.
HOVERGENiHBG007549.
InParanoidiQ01717.
KOiK04282.
PhylomeDBiQ01717.

Miscellaneous databases

PROiQ01717.

Family and domain databases

InterProiIPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
IPR002120. TRH_rcpt_1.
[Graphical view]
PfamiPF00001. 7tm_1. 1 hit.
[Graphical view]
PRINTSiPR00237. GPCRRHODOPSN.
PR00751. THYROLIBRINR.
PR01846. TRHRFAMILY.
SMARTiSM01381. 7TM_GPCR_Srsx. 1 hit.
[Graphical view]
PROSITEiPS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTRFR_RAT
AccessioniPrimary (citable) accession number: Q01717
Secondary accession number(s): Q63948, Q63949
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 1, 1993
Last sequence update: April 1, 1993
Last modified: June 8, 2016
This is version 129 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.