Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Thyrotropin-releasing hormone receptor

Gene

Trhr

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Receptor for thyrotropin-releasing hormone. This receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system.

GO - Molecular functioni

  • protein homodimerization activity Source: RGD
  • thyrotropin-releasing hormone receptor activity Source: RGD

GO - Biological processi

  • positive regulation of cytosolic calcium ion concentration Source: RGD
  • positive regulation of protein homodimerization activity Source: RGD

Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer

Names & Taxonomyi

Protein namesi
Recommended name:
Thyrotropin-releasing hormone receptor
Short name:
TRH-R
Alternative name(s):
Thyroliberin receptor
Gene namesi
Name:Trhr
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi3904. Trhr.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 28ExtracellularSequence analysisAdd BLAST28
Transmembranei29 – 51Helical; Name=1Sequence analysisAdd BLAST23
Topological domaini52 – 61CytoplasmicSequence analysis10
Transmembranei62 – 83Helical; Name=2Sequence analysisAdd BLAST22
Topological domaini84 – 99ExtracellularSequence analysisAdd BLAST16
Transmembranei100 – 121Helical; Name=3Sequence analysisAdd BLAST22
Topological domaini122 – 144CytoplasmicSequence analysisAdd BLAST23
Transmembranei145 – 168Helical; Name=4Sequence analysisAdd BLAST24
Topological domaini169 – 193ExtracellularSequence analysisAdd BLAST25
Transmembranei194 – 215Helical; Name=5Sequence analysisAdd BLAST22
Topological domaini216 – 266CytoplasmicSequence analysisAdd BLAST51
Transmembranei267 – 288Helical; Name=6Sequence analysisAdd BLAST22
Topological domaini289 – 296ExtracellularSequence analysis8
Transmembranei297 – 319Helical; Name=7Sequence analysisAdd BLAST23
Topological domaini320 – 412CytoplasmicSequence analysisAdd BLAST93

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Chemistry databases

ChEMBLiCHEMBL4553.
GuidetoPHARMACOLOGYi363.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000701891 – 412Thyrotropin-releasing hormone receptorAdd BLAST412

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi3N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi10N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi98 ↔ 179PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ01717.

PTM databases

iPTMnetiQ01717.
PhosphoSitePlusiQ01717.

Interactioni

GO - Molecular functioni

  • protein homodimerization activity Source: RGD

Protein-protein interaction databases

BioGridi247601. 5 interactors.
DIPiDIP-41967N.
MINTiMINT-194128.
STRINGi10116.ENSRNOP00000006783.

Chemistry databases

BindingDBiQ01717.

Structurei

3D structure databases

ProteinModelPortaliQ01717.
SMRiQ01717.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3656. Eukaryota.
ENOG410XRW9. LUCA.
HOGENOMiHOG000017249.
HOVERGENiHBG007549.
InParanoidiQ01717.
KOiK04282.
PhylomeDBiQ01717.

Family and domain databases

CDDicd14995. 7tmA_TRH-R. 1 hit.
InterProiView protein in InterPro
IPR000276. GPCR_Rhodpsn.
IPR017452. GPCR_Rhodpsn_7TM.
IPR002120. TRH_rcpt_1.
PANTHERiPTHR24243:SF115. PTHR24243:SF115. 1 hit.
PfamiView protein in Pfam
PF00001. 7tm_1. 1 hit.
PRINTSiPR00237. GPCRRHODOPSN.
PR00751. THYROLIBRINR.
PR01846. TRHRFAMILY.
SMARTiView protein in SMART
SM01381. 7TM_GPCR_Srsx. 1 hit.
PROSITEiView protein in PROSITE
PS00237. G_PROTEIN_RECEP_F1_1. 1 hit.
PS50262. G_PROTEIN_RECEP_F1_2. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform TRH-R(412) (identifier: Q01717-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MENETVSELN QTELPPQVAV ALEYQVVTIL LVVVICGLGI VGNIMVVLVV
60 70 80 90 100
MRTKHMRTAT NCYLVSLAVA DLMVLVAAGL PNITDSIYGS WVYGYVGCLC
110 120 130 140 150
ITYLQYLGIN ASSCSITAFT IERYIAICHP IKAQFLCTFS RAKKIIIFVW
160 170 180 190 200
AFTSIYCMLW FFLLDLNIST YKDAIVISCG YKISRNYYSP IYLMDFGVFY
210 220 230 240 250
VMPMILATVL YGFIARILFL NPIPSDPKEN SKTWKNDSTH QNKNMNLNTT
260 270 280 290 300
NRCFNSTVSS RKQVTKMLAV VVILFALLWM PYRTLVVVNS FLSSPFQENW
310 320 330 340 350
FLLFCRICIY LNSAINPVIY NLMSQKFRAA FRKLCNCKQK PTEKAANYSV
360 370 380 390 400
ALNYSVIKES DRFSTELDDI TVTDTYVSTT KVSFDDTCLA SEKNGPSSCT
410
YGYSLTAKQE KI
Length:412
Mass (Da):46,609
Last modified:April 1, 1993 - v1
Checksum:i52B35C9849D48A72
GO
Isoform TRH-R(387) (identifier: Q01717-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     376-412: YVSTTKVSFDDTCLASEKNGPSSCTYGYSLTAKQEKI → RMDPVLVHMDIL

Show »
Length:387
Mass (Da):44,024
Checksum:i9AA0F1C26AAE8221
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti59A → P (PubMed:7509436).Curated1
Sequence conflicti59A → P (PubMed:1373613).Curated1
Sequence conflicti223I → T (PubMed:7509436).Curated1
Sequence conflicti223I → T (PubMed:1373613).Curated1
Sequence conflicti321N → T in AAB29945 (PubMed:7509436).Curated1
Sequence conflicti321N → T in AAB29946 (PubMed:7509436).Curated1
Sequence conflicti393Missing (PubMed:8387312).Curated1
Sequence conflicti393Missing (PubMed:1338727).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_001952376 – 412YVSTT…KQEKI → RMDPVLVHMDIL in isoform TRH-R(387). CuratedAdd BLAST37

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M90308 mRNA. Translation: AAA42277.1.
X64630 mRNA. Translation: CAA45913.1.
X66726 mRNA. Translation: CAA47263.1.
D17469 mRNA. Translation: BAA04289.1.
S60053 mRNA. Translation: AAB26491.1.
S69160 mRNA. Translation: AAB29945.2.
S69161 mRNA. Translation: AAB29946.2.
S51512 mRNA. Translation: AAB24549.1.
PIRiI56444.
S23436.
RefSeqiNP_037179.1. NM_013047.3. [Q01717-1]
UniGeneiRn.9962.

Genome annotation databases

GeneIDi25570.
KEGGirno:25570.
UCSCiRGD:3904. rat. [Q01717-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiTRFR_RAT
AccessioniPrimary (citable) accession number: Q01717
Secondary accession number(s): Q63948, Q63949
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 1, 1993
Last sequence update: April 1, 1993
Last modified: October 25, 2017
This is version 135 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. SIMILARITY comments
    Index of protein domains and families