Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Interleukin-5 receptor subunit alpha

Gene

IL5RA

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

This is the receptor for interleukin-5. The alpha chain binds to IL5.

GO - Molecular functioni

GO - Biological processi

  • cell proliferation Source: ProtInc
  • inflammatory response to antigenic stimulus Source: Ensembl
  • MAPK cascade Source: Reactome
  • regulation of interleukin-5 production Source: Ensembl
  • signal transduction Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Enzyme and pathway databases

BioCyciZFISH:ENSG00000091181-MONOMER.
ReactomeiR-HSA-114604. GPVI-mediated activation cascade.
R-HSA-392451. G beta:gamma signalling through PI3Kgamma.
R-HSA-512988. Interleukin-3, 5 and GM-CSF signaling.
R-HSA-5673001. RAF/MAP kinase cascade.
R-HSA-912526. Interleukin receptor SHC signaling.
SignaLinkiQ01344.
SIGNORiQ01344.

Names & Taxonomyi

Protein namesi
Recommended name:
Interleukin-5 receptor subunit alpha
Short name:
IL-5 receptor subunit alpha
Short name:
IL-5R subunit alpha
Short name:
IL-5R-alpha
Short name:
IL-5RA
Alternative name(s):
CDw125
CD_antigen: CD125
Gene namesi
Name:IL5RA
Synonyms:IL5R
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:6017. IL5RA.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini21 – 342ExtracellularSequence analysisAdd BLAST322
Transmembranei343 – 362HelicalSequence analysisAdd BLAST20
Topological domaini363 – 420CytoplasmicSequence analysisAdd BLAST58

GO - Cellular componenti

  • extracellular space Source: ProtInc
  • integral component of membrane Source: ProtInc
  • intracellular Source: GOC
  • plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi3568.
OpenTargetsiENSG00000091181.
PharmGKBiPA29834.

Chemistry databases

ChEMBLiCHEMBL3580483.
GuidetoPHARMACOLOGYi1706.

Polymorphism and mutation databases

BioMutaiIL5RA.
DMDMi116242525.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 20Add BLAST20
ChainiPRO_000001089321 – 420Interleukin-5 receptor subunit alphaAdd BLAST400

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi35N-linked (GlcNAc...)Sequence analysis1
Glycosylationi131N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi134 ↔ 1551 Publication
Disulfide bondi182 ↔ 1961 Publication
Glycosylationi216N-linked (GlcNAc...)Sequence analysis1
Glycosylationi244N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi269 ↔ 3161 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiQ01344.
PaxDbiQ01344.
PeptideAtlasiQ01344.
PRIDEiQ01344.

PTM databases

iPTMnetiQ01344.
PhosphoSitePlusiQ01344.

Expressioni

Tissue specificityi

Expressed on eosinophils and basophils.

Gene expression databases

BgeeiENSG00000091181.
CleanExiHS_IL5RA.
ExpressionAtlasiQ01344. baseline and differential.
GenevisibleiQ01344. HS.

Interactioni

Subunit structurei

Heterodimer of an alpha and a beta subunit. The beta subunit is common to the IL3, IL5 and GM-CSF receptors. Interacts with SDCBP.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
CSF2RBP329273EBI-1759442,EBI-1809771
IL5P051132EBI-1759442,EBI-2435811
JAK2O606742EBI-1759442,EBI-518647

Protein-protein interaction databases

BioGridi109782. 6 interactors.
DIPiDIP-3510N.
IntActiQ01344. 5 interactors.
STRINGi9606.ENSP00000256452.

Structurei

Secondary structure

1420
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi34 – 42Combined sources9
Beta strandi45 – 51Combined sources7
Beta strandi59 – 61Combined sources3
Beta strandi64 – 73Combined sources10
Beta strandi75 – 87Combined sources13
Beta strandi94 – 103Combined sources10
Beta strandi108 – 110Combined sources3
Beta strandi114 – 118Combined sources5
Beta strandi122 – 124Combined sources3
Helixi125 – 127Combined sources3
Beta strandi130 – 140Combined sources11
Beta strandi144 – 146Combined sources3
Beta strandi149 – 158Combined sources10
Beta strandi168 – 175Combined sources8
Beta strandi178 – 181Combined sources4
Beta strandi185 – 187Combined sources3
Beta strandi193 – 200Combined sources8
Beta strandi209 – 218Combined sources10
Beta strandi227 – 232Combined sources6
Helixi233 – 236Combined sources4
Beta strandi243 – 250Combined sources8
Beta strandi253 – 259Combined sources7
Beta strandi262 – 265Combined sources4
Helixi267 – 269Combined sources3
Beta strandi270 – 278Combined sources9
Turni279 – 281Combined sources3
Beta strandi284 – 297Combined sources14
Beta strandi304 – 312Combined sources9
Turni314 – 316Combined sources3
Beta strandi329 – 331Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1OBXX-ray1.35B413-420[»]
1OBZX-ray1.69P413-420[»]
3QT2X-ray2.55A/B20-335[»]
3VA2X-ray2.70C21-335[»]
ProteinModelPortaliQ01344.
SMRiQ01344.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ01344.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini32 – 123Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST92
Domaini241 – 334Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST94

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi322 – 326WSXWS motif5
Motifi371 – 379Box 1 motif9

Domaini

The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
The box 1 motif is required for JAK interaction and/or activation.

Sequence similaritiesi

Contains 2 fibronectin type-III domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IJ36. Eukaryota.
ENOG4111ZG2. LUCA.
GeneTreeiENSGT00530000063295.
HOGENOMiHOG000070224.
HOVERGENiHBG052117.
InParanoidiQ01344.
KOiK05067.
OMAiQYFLYYR.
OrthoDBiEOG091G0B29.
PhylomeDBiQ01344.
TreeFamiTF331549.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
InterProiIPR003961. FN3_dom.
IPR013783. Ig-like_fold.
IPR003532. Short_hematopoietin_rcpt_2_CS.
IPR015321. TypeI_recpt_CBD.
[Graphical view]
PfamiPF09240. IL6Ra-bind. 1 hit.
[Graphical view]
SUPFAMiSSF49265. SSF49265. 2 hits.
PROSITEiPS50853. FN3. 2 hits.
PS01356. HEMATOPO_REC_S_F2. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q01344-1) [UniParc]FASTAAdd to basket
Also known as: Membrane-bound

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MIIVAHVLLI LLGATEILQA DLLPDEKISL LPPVNFTIKV TGLAQVLLQW
60 70 80 90 100
KPNPDQEQRN VNLEYQVKIN APKEDDYETR ITESKCVTIL HKGFSASVRT
110 120 130 140 150
ILQNDHSLLA SSWASAELHA PPGSPGTSIV NLTCTTNTTE DNYSRLRSYQ
160 170 180 190 200
VSLHCTWLVG TDAPEDTQYF LYYRYGSWTE ECQEYSKDTL GRNIACWFPR
210 220 230 240 250
TFILSKGRDW LAVLVNGSSK HSAIRPFDQL FALHAIDQIN PPLNVTAEIE
260 270 280 290 300
GTRLSIQWEK PVSAFPIHCF DYEVKIHNTR NGYLQIEKLM TNAFISIIDD
310 320 330 340 350
LSKYDVQVRA AVSSMCREAG LWSEWSQPIY VGNDEHKPLR EWFVIVIMAT
360 370 380 390 400
ICFILLILSL ICKICHLWIK LFPPIPAPKS NIKDLFVTTN YEKAGSSETE
410 420
IEVICYIEKP GVETLEDSVF
Length:420
Mass (Da):47,685
Last modified:October 17, 2006 - v2
Checksum:i4E0A5F2838B9C4FE
GO
Isoform 2 (identifier: Q01344-2) [UniParc]FASTAAdd to basket
Also known as: Soluble-S1

The sequence of this isoform differs from the canonical sequence as follows:
     333-335: NDE → FSR
     336-420: Missing.

Show »
Length:335
Mass (Da):37,984
Checksum:iBAED076239845E16
GO
Isoform 3 (identifier: Q01344-3) [UniParc]FASTAAdd to basket
Also known as: Soluble-S2

The sequence of this isoform differs from the canonical sequence as follows:
     333-333: N → K
     334-420: Missing.

Show »
Length:333
Mass (Da):37,722
Checksum:i8D9239845E16985B
GO
Isoform 4 (identifier: Q01344-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     365-420: CHLWIKLFPPIPAPKSNIKDLFVTTNYEKAGSSETEIEVICYIEKPGVETLEDSVF → KLGPVRRKLKSSVI

Show »
Length:378
Mass (Da):42,924
Checksum:i3044C8640A83F586
GO
Isoform 5 (identifier: Q01344-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     123-331: Missing.

Show »
Length:211
Mass (Da):23,737
Checksum:i475CB1AB3BF8D2B2
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti212A → S in AAA36110 (PubMed:1833065).Curated1
Sequence conflicti212A → S in AAA59151 (PubMed:1732409).Curated1
Sequence conflicti212A → S in AAA59152 (PubMed:1732409).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_020654129I → V.2 PublicationsCorresponds to variant rs2290610dbSNPEnsembl.1
Natural variantiVAR_020655262V → A.1 PublicationCorresponds to variant rs17879690dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_047762123 – 331Missing in isoform 5. 1 PublicationAdd BLAST209
Alternative sequenceiVSP_001678333 – 335NDE → FSR in isoform 2. 1 Publication3
Alternative sequenceiVSP_001680333N → K in isoform 3. 2 Publications1
Alternative sequenceiVSP_001681334 – 420Missing in isoform 3. 2 PublicationsAdd BLAST87
Alternative sequenceiVSP_001679336 – 420Missing in isoform 2. 1 PublicationAdd BLAST85
Alternative sequenceiVSP_046742365 – 420CHLWI…EDSVF → KLGPVRRKLKSSVI in isoform 4. 1 PublicationAdd BLAST56

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M75914 mRNA. Translation: AAA36110.1.
X61176 mRNA. Translation: CAA43483.1.
X62156 mRNA. Translation: CAA44081.1.
M96651 mRNA. Translation: AAA59151.1.
M96652 mRNA. Translation: AAA59152.1.
AB288090 mRNA. Translation: BAG49562.1.
AK304256 mRNA. Translation: BAG65122.1.
AY642135 Genomic DNA. Translation: AAT45457.1.
AC022002 Genomic DNA. No translation available.
AC024060 Genomic DNA. No translation available.
CCDSiCCDS2559.1. [Q01344-1]
CCDS2560.1. [Q01344-2]
CCDS46739.1. [Q01344-3]
CCDS58813.1. [Q01344-4]
PIRiA40267.
RefSeqiNP_000555.2. NM_000564.4. [Q01344-1]
NP_001230028.1. NM_001243099.1. [Q01344-4]
NP_783851.1. NM_175724.2. [Q01344-3]
NP_783852.1. NM_175725.2. [Q01344-2]
NP_783853.1. NM_175726.3. [Q01344-1]
NP_783854.1. NM_175727.2. [Q01344-3]
NP_783855.1. NM_175728.2. [Q01344-2]
UniGeneiHs.68876.

Genome annotation databases

EnsembliENST00000256452; ENSP00000256452; ENSG00000091181. [Q01344-1]
ENST00000311981; ENSP00000309196; ENSG00000091181. [Q01344-2]
ENST00000383846; ENSP00000373358; ENSG00000091181. [Q01344-2]
ENST00000430514; ENSP00000400400; ENSG00000091181. [Q01344-3]
ENST00000438560; ENSP00000390753; ENSG00000091181. [Q01344-4]
ENST00000446632; ENSP00000412209; ENSG00000091181. [Q01344-1]
ENST00000456302; ENSP00000392059; ENSG00000091181. [Q01344-3]
GeneIDi3568.
KEGGihsa:3568.
UCSCiuc010hbs.4. human. [Q01344-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

SeattleSNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M75914 mRNA. Translation: AAA36110.1.
X61176 mRNA. Translation: CAA43483.1.
X62156 mRNA. Translation: CAA44081.1.
M96651 mRNA. Translation: AAA59151.1.
M96652 mRNA. Translation: AAA59152.1.
AB288090 mRNA. Translation: BAG49562.1.
AK304256 mRNA. Translation: BAG65122.1.
AY642135 Genomic DNA. Translation: AAT45457.1.
AC022002 Genomic DNA. No translation available.
AC024060 Genomic DNA. No translation available.
CCDSiCCDS2559.1. [Q01344-1]
CCDS2560.1. [Q01344-2]
CCDS46739.1. [Q01344-3]
CCDS58813.1. [Q01344-4]
PIRiA40267.
RefSeqiNP_000555.2. NM_000564.4. [Q01344-1]
NP_001230028.1. NM_001243099.1. [Q01344-4]
NP_783851.1. NM_175724.2. [Q01344-3]
NP_783852.1. NM_175725.2. [Q01344-2]
NP_783853.1. NM_175726.3. [Q01344-1]
NP_783854.1. NM_175727.2. [Q01344-3]
NP_783855.1. NM_175728.2. [Q01344-2]
UniGeneiHs.68876.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1OBXX-ray1.35B413-420[»]
1OBZX-ray1.69P413-420[»]
3QT2X-ray2.55A/B20-335[»]
3VA2X-ray2.70C21-335[»]
ProteinModelPortaliQ01344.
SMRiQ01344.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109782. 6 interactors.
DIPiDIP-3510N.
IntActiQ01344. 5 interactors.
STRINGi9606.ENSP00000256452.

Chemistry databases

ChEMBLiCHEMBL3580483.
GuidetoPHARMACOLOGYi1706.

PTM databases

iPTMnetiQ01344.
PhosphoSitePlusiQ01344.

Polymorphism and mutation databases

BioMutaiIL5RA.
DMDMi116242525.

Proteomic databases

MaxQBiQ01344.
PaxDbiQ01344.
PeptideAtlasiQ01344.
PRIDEiQ01344.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000256452; ENSP00000256452; ENSG00000091181. [Q01344-1]
ENST00000311981; ENSP00000309196; ENSG00000091181. [Q01344-2]
ENST00000383846; ENSP00000373358; ENSG00000091181. [Q01344-2]
ENST00000430514; ENSP00000400400; ENSG00000091181. [Q01344-3]
ENST00000438560; ENSP00000390753; ENSG00000091181. [Q01344-4]
ENST00000446632; ENSP00000412209; ENSG00000091181. [Q01344-1]
ENST00000456302; ENSP00000392059; ENSG00000091181. [Q01344-3]
GeneIDi3568.
KEGGihsa:3568.
UCSCiuc010hbs.4. human. [Q01344-1]

Organism-specific databases

CTDi3568.
DisGeNETi3568.
GeneCardsiIL5RA.
HGNCiHGNC:6017. IL5RA.
MIMi147851. gene.
neXtProtiNX_Q01344.
OpenTargetsiENSG00000091181.
PharmGKBiPA29834.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IJ36. Eukaryota.
ENOG4111ZG2. LUCA.
GeneTreeiENSGT00530000063295.
HOGENOMiHOG000070224.
HOVERGENiHBG052117.
InParanoidiQ01344.
KOiK05067.
OMAiQYFLYYR.
OrthoDBiEOG091G0B29.
PhylomeDBiQ01344.
TreeFamiTF331549.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000091181-MONOMER.
ReactomeiR-HSA-114604. GPVI-mediated activation cascade.
R-HSA-392451. G beta:gamma signalling through PI3Kgamma.
R-HSA-512988. Interleukin-3, 5 and GM-CSF signaling.
R-HSA-5673001. RAF/MAP kinase cascade.
R-HSA-912526. Interleukin receptor SHC signaling.
SignaLinkiQ01344.
SIGNORiQ01344.

Miscellaneous databases

ChiTaRSiIL5RA. human.
EvolutionaryTraceiQ01344.
GeneWikiiInterleukin_5_receptor_alpha_subunit.
GenomeRNAii3568.
PROiQ01344.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000091181.
CleanExiHS_IL5RA.
ExpressionAtlasiQ01344. baseline and differential.
GenevisibleiQ01344. HS.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
InterProiIPR003961. FN3_dom.
IPR013783. Ig-like_fold.
IPR003532. Short_hematopoietin_rcpt_2_CS.
IPR015321. TypeI_recpt_CBD.
[Graphical view]
PfamiPF09240. IL6Ra-bind. 1 hit.
[Graphical view]
SUPFAMiSSF49265. SSF49265. 2 hits.
PROSITEiPS50853. FN3. 2 hits.
PS01356. HEMATOPO_REC_S_F2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiIL5RA_HUMAN
AccessioniPrimary (citable) accession number: Q01344
Secondary accession number(s): B3IU77
, B4E2G0, Q14633, Q15469, Q6ISX9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 1, 1993
Last sequence update: October 17, 2006
Last modified: November 30, 2016
This is version 169 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.