Reviewed,
UniProtKB/Swiss-Prot Q01196 (RUNX1_HUMAN)
Last modified
November 25, 2008.
Version 115.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Runt-related transcription factor 1 Alternative name(s): Core-binding factor subunit alpha-2 Short name=CBF-alpha-2 Acute myeloid leukemia 1 protein Oncogene AML-1 Polyomavirus enhancer-binding protein 2 alpha B subunit Short name=PEBP2-alpha B Short name=PEA2-alpha B SL3-3 enhancer factor 1 alpha B subunit SL3/AKV core-binding factor alpha B subunit | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 453 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | CBF binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, LCK, IL-3 and GM-CSF promoters. The alpha subunit binds DNA and appears to have a role in the development of normal hematopoiesis. Isoform AML-1L interferes with the transactivation activity of RUNX1. Acts synergistically with ELF4 to transactivate the IL-3 promoter and with ELF2 to transactivate the mouse BLK promoter. Inhibits MYST4-dependent transcriptional activation. |
| Subunit structure | Heterodimer with CBFB. RUNX1 binds DNA as a monomer and through the Runt domain. DNA-binding is increased by heterodimerization. Isoform AML-1L can neither bind DNA nor heterodimerize. Interacts with TLE1 and THOC4. Interacts with ELF1, ELF2 and SPI1. Interacts via its Runt domain with the ELF4 N-terminal region. Interaction with ELF2 isoform 2 (NERF-1a) may act to repress RUNX1-mediated transactivation. Interacts with MYST3 and MYST4. Interacts with SUV39H1, leading to abrogate the transactivating and DNA-binding properties of RUNX1. |
| Subcellular location | |
| Tissue specificity | Expressed in all tissues examined except brain and heart. Highest levels in thymus, bone marrow and peripheral blood. |
| Domain | A proline/serine/threonine rich region at the C-terminus is necessary for transcriptional activation of target genes. |
| Post-translational modification | Phosphorylated in its C-terminus upon IL-6 treatment. Phosphorylation enhances interaction with MYST3. Methylated. |
| Involvement in disease | A chromosomal aberration involving RUNX1/AML1 is a cause of M2 type acute myeloid leukemia (AML-M2). Translocation t(8;21)(q22;q22) with RUNX1T1/MTG8/ETO. A chromosomal aberration involving RUNX1/AML1 is a cause of therapy-related myelodysplastic syndrome (T-MDS). Translocation t(3;21)(q26;q22) with EAP, MSD1 or EVI1. A chromosomal aberration involving RUNX1/AML1 is a cause of chronic myelogenous leukemia (CML). Translocation t(3;21)(q26;q22) with EAP, MSD1 or EVI1. A chromosomal aberration involving RUNX1/AML1 is found in childhood acute lymphoblastic leukemia (ALL). Translocation t(12;21)(p13;q22) with TEL. The translocation fuses the 3'-end of TEL to the alternate 5'-exon of AML-1H. Defects in RUNX1 are the cause of familial platelet disorder with associated myeloid malignancy (FPDMM) [MIM:601399]. FPDMM is an autosomal dominant disease characterized by qualitative and quantitative platelet defects, and propensity to develop acute myelogenous leukemia. A chromosomal aberration involving RUNX1/AML1 is found in therapy-related myeloid malignancies. Translocation t(16;21)(q24;q22) that forms a RUNX1-CBFA2T3 fusion protein. |
| Sequence similarities | Contains 1 Runt domain. |
| Caution | The fusion of AML1 with EAP in T-MDS induces a change of reading frame in the latter resulting in 17 AA unrelated to those of EAP. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| ELF2 | Q15723 | 2 | EBI-925904,EBI-956941 | |
| ELF4 | Q99607 | 1 | EBI-925904,EBI-957009 | |
| TLE1 | Q04724 | 2 | EBI-925940,EBI-711424 | |
| TLE1 | Q04724 | 1 | EBI-925944,EBI-711424 |
Alternative products
| This entry describes 11 isoforms produced by alternative splicing. [Align] [Select] Notes: Additional isoforms seem to exist. | ||||||
| Isoform AML-1B (identifier: Q01196-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform AML-1A (identifier: Q01196-2) The sequence of this isoform differs from the canonical sequence as follows: 440-453: APSARLEEAVWRPY → GGASCSRQARRDPGPWARTPSWGRGRPTDRISL | ||||||
| Isoform AML-1C (identifier: Q01196-3) The sequence of this isoform differs from the canonical sequence as follows: 242-250: DTRQIQPSP → EEDTAPWRC 251-453: Missing. | ||||||
| Isoform AML-1E (identifier: Q01196-4) The sequence of this isoform differs from the canonical sequence as follows: 258-453: Missing. | ||||||
| Isoform AML-1FA (identifier: Q01196-5) The sequence of this isoform differs from the canonical sequence as follows: 178-224: RHRQKLDDQT...HPAPTPNPRA → SKCIHLGLVH...GWQAPVKPKS 225-453: Missing. | ||||||
| Isoform AML-1FB (identifier: Q01196-6) The sequence of this isoform differs from the canonical sequence as follows: 178-188: RHRQKLDDQTK → NSLTWPRYPHI 189-453: Missing. | ||||||
| Isoform AML-1FC (identifier: Q01196-7) The sequence of this isoform differs from the canonical sequence as follows: 137-242: VGRSGRGKSF...NPQPQSQMQD → VDGPREPRRH...SPSVHPATPI 243-453: Missing. | ||||||
| Isoform AML-1G (identifier: Q01196-8) The sequence of this isoform differs from the canonical sequence as follows: 1-5: MRIPV → MASDSIFESFPSYPQCFMRECILGMNPSRDVH | ||||||
| Isoform AML-1H (identifier: Q01196-9) The sequence of this isoform differs from the canonical sequence as follows: 1-5: MRIPV → MNPSRDVH | ||||||
| Isoform AML-1I (identifier: Q01196-10) The sequence of this isoform differs from the canonical sequence as follows: 1-5: MRIPV → MPAAPRGPAQGEAAARTRSR | ||||||
| Isoform AML-1L (identifier: Q01196-11) Also known as: AML1-delta N; The sequence of this isoform differs from the canonical sequence as follows: 1-105: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 453 | 453 | Runt-related transcription factor 1 | PRO_0000174655 | |||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||
| Domain | 50 – 178 | 129 | Runt | ||||||||||||||||||||||||||||
| Region | 80 – 84 | 5 | Interaction with DNA | ||||||||||||||||||||||||||||
| Region | 135 – 143 | 9 | Interaction with DNA | ||||||||||||||||||||||||||||
| Region | 168 – 177 | 10 | Interaction with DNA | ||||||||||||||||||||||||||||
| Region | 291 – 371 | 81 | Interaction with MYST3 | ||||||||||||||||||||||||||||
| Region | 307 – 400 | 94 | Interaction with MYST4 By similarity | ||||||||||||||||||||||||||||
| Compositional bias | 187 – 453 | 267 | Pro/Ser/Thr-rich | ||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||
| Binding site | 112 | 1 | Chloride 1 | ||||||||||||||||||||||||||||
| Binding site | 116 | 1 | Chloride 1; via amide nitrogen | ||||||||||||||||||||||||||||
| Binding site | 139 | 1 | Chloride 2 | ||||||||||||||||||||||||||||
| Binding site | 170 | 1 | Chloride 2; via amide nitrogen | ||||||||||||||||||||||||||||
| Site | 177 – 178 | 2 | Breakpoint for translocation to form AML1-EMV-1 (or AML1-EAP) in CML and T-MDS, to form AML1-MTG8 (ETO) in AML-M2 and to form AML1-CBFA2T3 in therapy-related myeloid malignancies | ||||||||||||||||||||||||||||
| Site | 241 – 242 | 2 | Breakpoint for translocation to form AML1-EAP in T-MDS and in CML | ||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||
| Modified residue | 14 | 1 | Phosphothreonine | ||||||||||||||||||||||||||||
| Modified residue | 21 | 1 | Phosphoserine | ||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 105 | 105 | Missing in isoform AML-1L. | VSP_005919 | |||||||||||||||||||||||||||
| Alternative sequence | 1 – 5 | 5 | MRIPV → MASDSIFESFPSYPQCFMRE CILGMNPSRDVH in isoform AML-1G. | VSP_005917 | |||||||||||||||||||||||||||
| Alternative sequence | 1 – 5 | 5 | MRIPV → MNPSRDVH in isoform AML-1H. | VSP_005916 | |||||||||||||||||||||||||||
| Alternative sequence | 1 – 5 | 5 | MRIPV → MPAAPRGPAQGEAAARTRSR in isoform AML-1I. | VSP_005918 | |||||||||||||||||||||||||||
| Alternative sequence | 137 – 242 | 106 | VGRSG…SQMQD → VDGPREPRRHRQKLDDQTKP GSLSFSERLSELEQLRRTAM RVSPHHPAPTPNPRASLNHS TAFNPQPQSQMQDTRQIQPS PPWSYDQSYQYLGSIASPSV HPATPI in isoform AML-1FC. | VSP_005920 | |||||||||||||||||||||||||||
| Alternative sequence | 178 – 224 | 47 | RHRQK…PNPRA → SKCIHLGLVHPPGWYTLQAG ILRDHVSDSLGSTFPPGGWQ APVKPKS in isoform AML-1FA. | VSP_005923 | |||||||||||||||||||||||||||
| Alternative sequence | 178 – 188 | 11 | RHRQKLDDQTK → NSLTWPRYPHI in isoform AML-1FB. | VSP_005921 | |||||||||||||||||||||||||||
| Alternative sequence | 189 – 453 | 265 | Missing in isoform AML-1FB. | VSP_005922 | |||||||||||||||||||||||||||
| Alternative sequence | 225 – 453 | 229 | Missing in isoform AML-1FA. | VSP_005924 | |||||||||||||||||||||||||||
| Alternative sequence | 242 – 250 | 9 | DTRQIQPSP → EEDTAPWRC in isoform AML-1C. | VSP_005926 | |||||||||||||||||||||||||||
| Alternative sequence | 243 – 453 | 211 | Missing in isoform AML-1FC. | VSP_005925 | |||||||||||||||||||||||||||
| Alternative sequence | 251 – 453 | 203 | Missing in isoform AML-1C. | VSP_005927 | |||||||||||||||||||||||||||
| Alternative sequence | 258 – 453 | 196 | Missing in isoform AML-1E. | VSP_005928 | |||||||||||||||||||||||||||
| Alternative sequence | 440 – 453 | 14 | APSAR…VWRPY → GGASCSRQARRDPGPWARTP SWGRGRPTDRISL in isoform AML-1A. | VSP_005929 | |||||||||||||||||||||||||||
| Natural variant | 139 | 1 | R → Q in FPDMM. | VAR_012128 | |||||||||||||||||||||||||||
| Natural variant | 174 | 1 | R → Q in FPDMM. | VAR_012129 | |||||||||||||||||||||||||||
| Natural variant | 431 | 1 | S → R: dbSNP rs1055308. | VAR_013177 | |||||||||||||||||||||||||||
| Natural variant | 433 | 1 | S → R: dbSNP rs1055309. | VAR_013178 | |||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||
| Mutagenesis | 80 | 1 | R → A: Strongly reduces DNA-binding | ||||||||||||||||||||||||||||
| Mutagenesis | 83 | 1 | K → A: Strongly reduces DNA-binding | ||||||||||||||||||||||||||||
| Mutagenesis | 84 | 1 | T → A: No effect on DNA binding | ||||||||||||||||||||||||||||
| Mutagenesis | 107 | 1 | A → T: Loss of heterodimerization | ||||||||||||||||||||||||||||
| Mutagenesis | 108 | 1 | G → R: Loss of heterodimerization | ||||||||||||||||||||||||||||
| Mutagenesis | 135 | 1 | R → A: Strongly reduces DNA-binding | ||||||||||||||||||||||||||||
| Mutagenesis | 139 | 1 | R → A: Strongly reduces DNA-binding | ||||||||||||||||||||||||||||
| Mutagenesis | 142 | 1 | R → A: Strongly reduces DNA-binding | ||||||||||||||||||||||||||||
| Mutagenesis | 145 – 453 | 309 | Missing: No DNA-binding | ||||||||||||||||||||||||||||
| Mutagenesis | 167 | 1 | K → A: Reduces DNA-binding | ||||||||||||||||||||||||||||
| Mutagenesis | 169 | 1 | T → A: Strongly reduces DNA-binding | ||||||||||||||||||||||||||||
| Mutagenesis | 171 | 1 | D → A: Strongly reduces DNA-binding | ||||||||||||||||||||||||||||
| Mutagenesis | 174 | 1 | R → A: Strongly reduces DNA-binding | ||||||||||||||||||||||||||||
| Mutagenesis | 177 | 1 | R → A: Strongly reduces DNA-binding | ||||||||||||||||||||||||||||
| Sequence conflict | 412 | 1 | S → F in AAA51720. Ref.1 | ||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||
| Beta strand | 62 – 64 | 3 | |||||||||||||||||||||||||||||
| Beta strand | 70 – 73 | 4 | |||||||||||||||||||||||||||||
| Beta strand | 77 – 80 | 4 | |||||||||||||||||||||||||||||
| Beta strand | 90 – 93 | 4 | |||||||||||||||||||||||||||||
| Beta strand | 102 – 108 | 7 | |||||||||||||||||||||||||||||
| Beta strand | 117 – 119 | 3 | |||||||||||||||||||||||||||||
| Beta strand | 121 – 123 | 3 | |||||||||||||||||||||||||||||
| Beta strand | 128 – 130 | 3 | |||||||||||||||||||||||||||||
| Beta strand | 146 – 152 | 7 | |||||||||||||||||||||||||||||
| Beta strand | 158 – 161 | 4 | |||||||||||||||||||||||||||||
| Beta strand | 166 – 171 | 6 | |||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||

Clusters with