Q01196 (RUNX1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 169.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Runt-related transcription factor 1 Alternative name(s): Acute myeloid leukemia 1 protein Core-binding factor subunit alpha-2 Short name=CBF-alpha-2 Oncogene AML-1 Polyomavirus enhancer-binding protein 2 alpha B subunit Short name=PEA2-alpha B Short name=PEBP2-alpha B SL3-3 enhancer factor 1 alpha B subunit SL3/AKV core-binding factor alpha B subunit | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 453 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | CBF binds to the core site, 5'-PYGPYGGT-3', of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, LCK, IL-3 and GM-CSF promoters. The alpha subunit binds DNA and appears to have a role in the development of normal hematopoiesis. Isoform AML-1L interferes with the transactivation activity of RUNX1. Acts synergistically with ELF4 to transactivate the IL-3 promoter and with ELF2 to transactivate the mouse BLK promoter. Inhibits KAT6B-dependent transcriptional activation. Ref.21 Ref.23 Ref.25 Ref.27 |
| Subunit structure | Heterodimer with CBFB. RUNX1 binds DNA as a monomer and through the Runt domain. DNA-binding is increased by heterodimerization. Isoform AML-1L can neither bind DNA nor heterodimerize. Interacts with TLE1 and ALYREF/THOC4. Interacts with ELF1, ELF2 and SPI1. Interacts via its Runt domain with the ELF4 N-terminal region. Interaction with ELF2 isoform 2 (NERF-1a) may act to repress RUNX1-mediated transactivation. Interacts with KAT6A and KAT6B. Interacts with SUV39H1, leading to abrogation of transactivating and DNA-binding properties of RUNX1. Interacts with YAP1. Interacts with HIPK2 By similarity. Interaction with CDK6 prevents myeloid differentiation, reducing its transcription transactivation activity. Found in a complex with PRMT5, RUNX1 AND CBFB. Ref.18 Ref.20 Ref.21 Ref.22 Ref.23 Ref.24 Ref.25 Ref.26 Ref.27 Ref.30 |
| Subcellular location | |
| Tissue specificity | Expressed in all tissues examined except brain and heart. Highest levels in thymus, bone marrow and peripheral blood. |
| Domain | A proline/serine/threonine rich region at the C-terminus is necessary for transcriptional activation of target genes. |
| Post-translational modification | Phosphorylated in its C-terminus upon IL-6 treatment. Phosphorylation enhances interaction with KAT6A. Ref.22 Ref.29 Methylated. Ref.24 Phosphorylated in Ser-249 Thr-273 and Ser-276 by HIPK2 when associated with CBFB and DNA. This phosphorylation promotes subsequent EP300 phosphorylation. Ref.22 Ref.29 |
| Involvement in disease | A chromosomal aberration involving RUNX1/AML1 is a cause of M2 type acute myeloid leukemia (AML-M2). Translocation t(8;21)(q22;q22) with RUNX1T1. Ref.41 Ref.42 Ref.43 Ref.45 Ref.47 A chromosomal aberration involving RUNX1/AML1 is a cause of therapy-related myelodysplastic syndrome (T-MDS). Translocation t(3;21)(q26;q22) with EAP or MECOM. A chromosomal aberration involving RUNX1/AML1 is a cause of chronic myelogenous leukemia (CML). Translocation t(3;21)(q26;q22) with EAP or MECOM. A chromosomal aberration involving RUNX1/AML1 is found in childhood acute lymphoblastic leukemia (ALL). Translocation t(12;21)(p13;q22) with TEL. The translocation fuses the 3'-end of TEL to the alternate 5'-exon of AML-1H. A chromosomal aberration involving RUNX1 is found in acute leukemia. Translocation t(11,21)(q13;q22) that forms a MACROD1-RUNX1 fusion protein. Familial platelet disorder with associated myeloid malignancy (FPDMM) [MIM:601399]: Autosomal dominant disease characterized by qualitative and quantitative platelet defects, and propensity to develop acute myelogenous leukemia. A chromosomal aberration involving RUNX1/AML1 is found in therapy-related myeloid malignancies. Translocation t(16;21)(q24;q22) that forms a RUNX1-CBFA2T3 fusion protein. A chromosomal aberration involving RUNX1/AML1 is a cause of chronic myelomonocytic leukemia. Inversion inv21(q21;q22) with USP16. |
| Sequence similarities | Contains 1 Runt domain. |
| Caution | The fusion of AML1 with EAP in T-MDS induces a change of reading frame in the latter resulting in 17 AA unrelated to those of EAP. |
| Sequence caution | The sequence AAC05246.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. The sequence AAC05247.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| ELF2 | Q15723 | 2 | EBI-925904,EBI-956941 | |
| gro | P16371 | 4 | EBI-925940,EBI-153866 | From a different organism. |
| TLE1 | Q04724 | 4 | EBI-925940,EBI-711424 |
Alternative products
| This entry describes 11 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform AML-1B (identifier: Q01196-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform AML-1A (identifier: Q01196-2) The sequence of this isoform differs from the canonical sequence as follows: 440-453: APSARLEEAVWRPY → GGASCSRQARRDPGPWARTPSWGRGRPTDRISL | ||||||
| Isoform AML-1C (identifier: Q01196-3) The sequence of this isoform differs from the canonical sequence as follows: 242-250: DTRQIQPSP → EEDTAPWRC 251-453: Missing. | ||||||
| Isoform AML-1E (identifier: Q01196-4) The sequence of this isoform differs from the canonical sequence as follows: 258-453: Missing. | ||||||
| Isoform AML-1FA (identifier: Q01196-5) The sequence of this isoform differs from the canonical sequence as follows: 178-224: RHRQKLDDQT...HPAPTPNPRA → SKCIHLGLVH...GWQAPVKPKS 225-453: Missing. | ||||||
| Isoform AML-1FB (identifier: Q01196-6) The sequence of this isoform differs from the canonical sequence as follows: 178-188: RHRQKLDDQTK → NSLTWPRYPHI 189-453: Missing. | ||||||
| Isoform AML-1FC (identifier: Q01196-7) The sequence of this isoform differs from the canonical sequence as follows: 137-242: VGRSGRGKSF...NPQPQSQMQD → VDGPREPRRH...SPSVHPATPI 243-453: Missing. | ||||||
| Isoform AML-1G (identifier: Q01196-8) The sequence of this isoform differs from the canonical sequence as follows: 1-5: MRIPV → MASDSIFESFPSYPQCFMRECILGMNPSRDVH | ||||||
| Isoform AML-1H (identifier: Q01196-9) The sequence of this isoform differs from the canonical sequence as follows: 1-5: MRIPV → MNPSRDVH | ||||||
| Isoform AML-1I (identifier: Q01196-10) The sequence of this isoform differs from the canonical sequence as follows: 1-5: MRIPV → MPAAPRGPAQGEAAARTRSR | ||||||
| Isoform AML-1L (identifier: Q01196-11) Also known as: AML1-delta N; The sequence of this isoform differs from the canonical sequence as follows: 1-105: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 453 | 453 | Runt-related transcription factor 1 | PRO_0000174655 | |||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||
| Domain | 50 – 178 | 129 | Runt | ||||||||||||||||||||||||||||||||||||||
| Region | 80 – 84 | 5 | Interaction with DNA | ||||||||||||||||||||||||||||||||||||||
| Region | 135 – 143 | 9 | Interaction with DNA | ||||||||||||||||||||||||||||||||||||||
| Region | 168 – 177 | 10 | Interaction with DNA | ||||||||||||||||||||||||||||||||||||||
| Region | 291 – 371 | 81 | Interaction with KAT6A | ||||||||||||||||||||||||||||||||||||||
| Region | 307 – 400 | 94 | Interaction with KAT6B By similarity | ||||||||||||||||||||||||||||||||||||||
| Compositional bias | 187 – 453 | 267 | Pro/Ser/Thr-rich | ||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||
| Binding site | 112 | 1 | Chloride 1 | ||||||||||||||||||||||||||||||||||||||
| Binding site | 116 | 1 | Chloride 1; via amide nitrogen | ||||||||||||||||||||||||||||||||||||||
| Binding site | 139 | 1 | Chloride 2 | ||||||||||||||||||||||||||||||||||||||
| Binding site | 170 | 1 | Chloride 2; via amide nitrogen | ||||||||||||||||||||||||||||||||||||||
| Site | 177 – 178 | 2 | Breakpoint for translocation to form AML1-EMV-1 (or AML1-EAP) in CML and T-MDS, to form AML1-MTG8 (ETO) in AML-M2, to form AML1-CBFA2T3 in therapy-related myeloid malignancies, to form AML1-MECOM in CML and to form type I MACROD1-RUNX1 fusion protein | ||||||||||||||||||||||||||||||||||||||
| Site | 241 – 242 | 2 | Breakpoint for translocation to form AML1-EAP in T-MDS and CML and to form type II MACROD1-RUNX1 fusion protein | ||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||
| Modified residue | 14 | 1 | Phosphothreonine Ref.31 Ref.32 | ||||||||||||||||||||||||||||||||||||||
| Modified residue | 21 | 1 | Phosphoserine Ref.31 | ||||||||||||||||||||||||||||||||||||||
| Modified residue | 24 | 1 | N6-acetyllysine Ref.33 | ||||||||||||||||||||||||||||||||||||||
| Modified residue | 43 | 1 | N6-acetyllysine Ref.33 | ||||||||||||||||||||||||||||||||||||||
| Modified residue | 249 | 1 | Phosphoserine; by HIPK2 Ref.29 Ref.32 | ||||||||||||||||||||||||||||||||||||||
| Modified residue | 266 | 1 | Phosphoserine Ref.32 | ||||||||||||||||||||||||||||||||||||||
| Modified residue | 268 | 1 | Phosphoserine Ref.32 | ||||||||||||||||||||||||||||||||||||||
| Modified residue | 273 | 1 | Phosphothreonine; by HIPK2 Ref.29 | ||||||||||||||||||||||||||||||||||||||
| Modified residue | 276 | 1 | Phosphoserine; by HIPK2 Ref.29 Ref.32 | ||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 105 | 105 | Missing in isoform AML-1L. | VSP_005919 | |||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 5 | 5 | MRIPV → MASDSIFESFPSYPQCFMRE CILGMNPSRDVH in isoform AML-1G. | VSP_005917 | |||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 5 | 5 | MRIPV → MNPSRDVH in isoform AML-1H. | VSP_005916 | |||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 5 | 5 | MRIPV → MPAAPRGPAQGEAAARTRSR in isoform AML-1I. | VSP_005918 | |||||||||||||||||||||||||||||||||||||
| Alternative sequence | 137 – 242 | 106 | VGRSG…SQMQD → VDGPREPRRHRQKLDDQTKP GSLSFSERLSELEQLRRTAM RVSPHHPAPTPNPRASLNHS TAFNPQPQSQMQDTRQIQPS PPWSYDQSYQYLGSIASPSV HPATPI in isoform AML-1FC. | VSP_005920 | |||||||||||||||||||||||||||||||||||||
| Alternative sequence | 178 – 224 | 47 | RHRQK…PNPRA → SKCIHLGLVHPPGWYTLQAG ILRDHVSDSLGSTFPPGGWQ APVKPKS in isoform AML-1FA. | VSP_005923 | |||||||||||||||||||||||||||||||||||||
| Alternative sequence | 178 – 188 | 11 | RHRQKLDDQTK → NSLTWPRYPHI in isoform AML-1FB. | VSP_005921 | |||||||||||||||||||||||||||||||||||||
| Alternative sequence | 189 – 453 | 265 | Missing in isoform AML-1FB. | VSP_005922 | |||||||||||||||||||||||||||||||||||||
| Alternative sequence | 225 – 453 | 229 | Missing in isoform AML-1FA. | VSP_005924 | |||||||||||||||||||||||||||||||||||||
| Alternative sequence | 242 – 250 | 9 | DTRQIQPSP → EEDTAPWRC in isoform AML-1C. | VSP_005926 | |||||||||||||||||||||||||||||||||||||
| Alternative sequence | 243 – 453 | 211 | Missing in isoform AML-1FC. | VSP_005925 | |||||||||||||||||||||||||||||||||||||
| Alternative sequence | 251 – 453 | 203 | Missing in isoform AML-1C. | VSP_005927 | |||||||||||||||||||||||||||||||||||||
| Alternative sequence | 258 – 453 | 196 | Missing in isoform AML-1E. | VSP_005928 | |||||||||||||||||||||||||||||||||||||
| Alternative sequence | 440 – 453 | 14 | APSAR…VWRPY → GGASCSRQARRDPGPWARTP SWGRGRPTDRISL in isoform AML-1A. | VSP_005929 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 139 | 1 | R → Q in FPDMM. Ref.49 | VAR_012128 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 174 | 1 | R → Q in FPDMM; impaired phosphorylation. Ref.29 Ref.49 | VAR_012129 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 431 | 1 | S → R. Corresponds to variant rs1055308 [ dbSNP | Ensembl ]. | VAR_013177 | |||||||||||||||||||||||||||||||||||||
| Natural variant | 433 | 1 | S → R. Corresponds to variant rs1055309 [ dbSNP | Ensembl ]. | VAR_013178 | |||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 67 | 1 | S → R: Loss of heterodimerization and reduced EP300 phosphorylation induction. Ref.29 | ||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 80 | 1 | R → A: Strongly reduces DNA-binding. Ref.35 | ||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 83 | 1 | K → A: Strongly reduces DNA-binding. Ref.29 Ref.35 | ||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 83 | 1 | K → E: Strongly reduces DNA-binding, impaired phosphorylation and reduced EP300 phosphorylation induction. Ref.29 Ref.35 | ||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 84 | 1 | T → A: No effect on DNA binding. Ref.35 | ||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 107 | 1 | A → T: Loss of heterodimerization. Ref.37 | ||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 108 | 1 | G → R: Loss of heterodimerization and impaired phosphorylation. Ref.29 Ref.37 | ||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 135 | 1 | R → A: Strongly reduces DNA-binding. Ref.35 | ||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 139 | 1 | R → A: Strongly reduces DNA-binding. Ref.35 | ||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 142 | 1 | R → A: Strongly reduces DNA-binding. Ref.35 | ||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 145 – 453 | 309 | Missing: No DNA-binding. | ||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 167 | 1 | K → A: Reduces DNA-binding. Ref.35 | ||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 169 | 1 | T → A: Strongly reduces DNA-binding. Ref.35 | ||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 171 | 1 | D → A: Strongly reduces DNA-binding. Ref.35 | ||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 174 | 1 | R → A: Strongly reduces DNA-binding. Ref.35 | ||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 177 | 1 | R → A: Strongly reduces DNA-binding. Ref.35 | ||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 249 | 1 | S → A: Reduced phosphorylation. Ref.29 | ||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 273 | 1 | T → A: Reduced phosphorylation; when associated with A-276. Ref.29 | ||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 276 | 1 | S → A: Reduced phosphorylation; when associated with A-273. Ref.29 | ||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 412 | 1 | S → F in AAA51720. Ref.1 | ||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||
| Helix | 54 – 57 | 4 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 62 – 64 | 3 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 70 – 73 | 4 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 77 – 80 | 4 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 82 – 84 | 3 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 90 – 93 | 4 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 102 – 108 | 7 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 110 – 114 | 5 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 117 – 119 | 3 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 121 – 123 | 3 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 128 – 130 | 3 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 146 – 152 | 7 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 154 – 156 | 3 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 158 – 161 | 4 | |||||||||||||||||||||||||||||||||||||||
| Beta strand | 166 – 171 | 6 | |||||||||||||||||||||||||||||||||||||||
| Helix | 175 – 177 | 3 | |||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | Ahn M.-Y., Bae S.C., Zhang Y.W., Shigesada K., Ito Y. Submitted (SEP-1994) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA]. |
| [2] | "t(8;21) breakpoints on chromosome 21 in acute myeloid leukemia are clustered within a limited region of a single gene, AML1." Miyoshi H., Shimizu K., Kozu T., Maseki N., Kaneko Y., Ohki M. Proc. Natl. Acad. Sci. U.S.A. 88:10431-10434(1991) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM AML-1C). Tissue: Leukocyte. |
| [3] | "AML1 fusion transcripts in t(3;21) positive leukemia: evidence of molecular heterogeneity and usage of splicing sites frequently involved in the generation of normal AML1 transcripts." Sacchi N., Nisson P.E., Watkins P.C., Faustinella F., Wijsman J., Hagemeijer A. Genes Chromosomes Cancer 11:226-236(1994) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE FORMS, CHROMOSOMAL TRANSLOCATION WITH EAP. |
| [4] | "Involvement of the AML1 gene in the t(3;21) in therapy-related leukemia and in chronic myeloid leukemia in blast crisis." Nucifora G., Birn D.J., Espinosa R. III, Erickson P., Lebeau M.M., Roulston D., McKeithan T.W., Drabkin H., Rowley J.D. Blood 81:2728-2734(1993) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM AML-1E), CHROMOSOMAL TRANSLOCATION WITH ETO. |
| [5] | "AML1, AML2, and AML3, the human members of the runt domain gene-family: cDNA structure, expression, and chromosomal localization." Levanon D., Negreanu V., Bernstein Y., Bar-Am I., Avivi L., Groner Y. Genomics 23:425-432(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM AML-1A). Tissue: Monocyte. |
| [6] | "Alternative splicing and genomic structure of the AML1 gene involved in acute myeloid leukemia." Miyoshi H., Ohira M., Shimizu K., Mitani K., Hirai H., Imai T., Yokoyama K., Soeda E., Ohki M. Nucleic Acids Res. 23:2762-2769(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS AML-1B; AML-1A; AML-1G AND AML-1L). |
| [7] | "The t(8;21) fusion protein interferes with AML-1B-dependent transcriptional activation." Meyers S., Lenny N., Hiebert S.W. Mol. Cell. Biol. 15:1974-1982(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM AML-1G). Tissue: B-cell. |
| [8] | "A novel transcript encoding an N-terminally truncated AML1/PEBP2 alphaB protein interferes with transactivation and blocks granulocytic differentiation of 32Dcl3 myeloid cells." Zhang Y.-W., Bae S.-C., Huang G., Fu Y.-X., Lu J., Ahn M.-Y., Kanno Y., Kanno T., Ito Y. Mol. Cell. Biol. 17:4133-4145(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM AML-1L). |
| [9] | "The DNA sequence of human chromosome 21." Hattori M., Fujiyama A., Taylor T.D., Watanabe H., Yada T., Park H.-S., Toyoda A., Ishii K., Totoki Y., Choi D.-K., Groner Y., Soeda E., Ohki M., Takagi T., Sakaki Y., Taudien S., Blechschmidt K., Polley A. Yaspo M.-L.Nature 405:311-319(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [10] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [11] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM AML-1G). |
| [12] | "Generation of the AML1-EVI-1 fusion gene in the t(3;21)(q26;q22) causes blastic crisis in chronic myelocytic leukemia." Mitani K., Ogawa S., Tanaka T., Miyoshi H., Kurokawa M., Mano H., Yazaki Y., Ohki M., Hirai H. EMBO J. 13:504-510(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-177, CHROMOSOMAL TRANSLOCATION WITH MECOM IN CHRONIC MYELOCYTIC LEUKEMIA. |
| [13] | "Expression of the human acute myeloid leukemia gene AML1 is regulated by two promoter regions." Ghozi M.C., Bernstein Y., Negreanu V., Levanon D., Groner Y. Proc. Natl. Acad. Sci. U.S.A. 93:1935-1940(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-90 (ISOFORMS AML-1H AND AML-1I). |
| [14] | "A large variety of alternatively spliced and differentially expressed mRNAs are encoded by the human acute myeloid leukemia gene AML1." Levanon D., Bernstein Y., Negreanu V., Ghozi M.C., Bar-Am I., Aloya R., Goldenberg D., Lotem J., Groner Y. DNA Cell Biol. 15:175-185(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] OF 440-453, ALTERNATIVE SPLICING. Tissue: Monocyte. |
| [15] | "Sequencing and analysis of 960 kb between AML1 and CBR1 on chromosome 21q22.2." Blechschmidt K., Rump A., Nordsiek G., Drescher B., Weber J., Rosenthal A. Submitted (MAY-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-19, ALTERNATIVE SPLICING (ISOFORM AML-1G). |
| [16] | "Leukaemia/Drosophila homology." Daga A., Tighe J.E., Calabi F. Nature 356:484-484(1992) [PubMed] [Europe PMC] [Abstract] Cited for: SIMILARITY TO RUNT. |
| [17] | "Identification of AML-1 and the (8;21) translocation protein (AML-1/ETO) as sequence-specific DNA-binding proteins: the runt homology domain is required for DNA binding and protein-protein interactions." Meyers S., Downing J.R., Hiebert S.W. Mol. Cell. Biol. 13:6336-6345(1993) [PubMed] [Europe PMC] [Abstract] Cited for: ENHANCER CORE BINDING SEQUENCE. |
| [18] | "ALY, a context-dependent coactivator of LEF-1 and AML-1, is required for TCRalpha enhancer function." Bruhn L., Munnerlyn A., Grosschedl R. Genes Dev. 11:640-653(1997) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ALYREF/THOC4. |
| [19] | "The partner gene of AML1 in t(16;21) myeloid malignancies is a novel member of the MTG8(ETO) family." Gamou T., Kitamura E., Hosoda F., Shimuzu K., Hayashi Y., Nagase T., Yokoyama Y., Ohki M. Blood 91:4028-4037(1998) [PubMed] [Europe PMC] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION WITH CBFA2T3. |
| [20] | "Transcriptional repression by AML1 and LEF-1 is mediated by the TLE/Groucho corepressors." Levanon D., Goldstein R.E., Bernstein Y., Tang H., Goldenberg D., Stifani S., Paroush Z., Groner Y. Proc. Natl. Acad. Sci. U.S.A. 95:11590-11595(1998) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH TLE1. |
| [21] | "Functional and physical interactions between AML1 proteins and an ETS protein, MEF: implications for the pathogenesis of t(8;21)-positive leukemias." Mao S., Frank R.C., Zhang J., Miyazaki Y., Nimer S.D. Mol. Cell. Biol. 19:3635-3644(1999) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH ELF1; ELF2; ELF4 AND SPI1. |
| [22] | "Activation of AML1-mediated transcription by MOZ and inhibition by the MOZ-CBP fusion protein." Kitabayashi I., Aikawa Y., Nguyen L.A., Yokoyama A., Ohki M. EMBO J. 20:7184-7196(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH KAT6A, PHOSPHORYLATION. |
| [23] | "MOZ and MORF histone acetyltransferases interact with the Runt-domain transcription factor Runx2." Pelletier N., Champagne N., Stifani S., Yang X.-J. Oncogene 21:2729-2740(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH KAT6B, FUNCTION. |
| [24] | "SUV39H1 interacts with AML1 and abrogates AML1 transactivity. AML1 is methylated in vivo." Chakraborty S., Sinha K.K., Senyuk V., Nucifora G. Oncogene 22:5229-5237(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SUV39H1, METHYLATION. |
| [25] | "Isoforms of the Ets transcription factor NERF/ELF-2 physically interact with AML1 and mediate opposing effects on AML1-mediated transcription of the B cell-specific blk gene." Cho J.-Y., Akbarali Y., Zerbini L.F., Gu X., Boltax J., Wang Y., Oettgen P., Zhang D.-E., Libermann T.A. J. Biol. Chem. 279:19512-19522(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH ELF2. |
| [26] | "RUNX1 associates with histone deacetylases and SUV39H1 to repress transcription." Reed-Inderbitzin E., Moreno-Miralles I., Vanden-Eynden S.K., Xie J., Lutterbach B., Durst-Goodwin K.L., Luce K.S., Irvin B.J., Cleary M.L., Brandt S.J., Hiebert S.W. Oncogene 25:5777-5786(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SUV39H1. |
| [27] | "Cdk6 blocks myeloid differentiation by interfering with Runx1 DNA binding and Runx1-C/EBPalpha interaction." Fujimoto T., Anderson K., Jacobsen S.E., Nishikawa S.I., Nerlov C. EMBO J. 26:2361-2370(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN MYELOID DIFFERENTIATION, INTERACTION WITH CDK6. |
| [28] | "LRP16 is fused to RUNX1 in monocytic leukemia cell line with t(11;21)(q13;q22)." Imagama S., Abe A., Suzuki M., Hayakawa F., Katsumi A., Emi N., Kiyoi H., Naoe T. Eur. J. Haematol. 79:25-31(2007) [PubMed] [Europe PMC] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION WITH MACROD1. |
| [29] | "PEBP2-beta/CBF-beta-dependent phosphorylation of RUNX1 and p300 by HIPK2: implications for leukemogenesis." Wee H.-J., Voon D.C.-C., Bae S.-C., Ito Y. Blood 112:3777-3787(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT SER-249; THR-273 AND SER-276 BY HIPK2, VARIANT GLN-174, MUTAGENESIS OF SER-67; LYS-83; GLY-108; SER-249; THR-273 AND SER-276. |
| [30] | "Yap1 phosphorylation by c-Abl is a critical step in selective activation of proapoptotic genes in response to DNA damage." Levy D., Adamovich Y., Reuven N., Shaul Y. Mol. Cell 29:350-361(2008) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH YAP1. |
| [31] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-14 AND SER-21, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [32] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-14; SER-249; SER-266; SER-268 AND SER-276, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [33] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-24 AND LYS-43, MASS SPECTROMETRY. |
| [34] | "Structural basis for the heterodimeric interaction between the acute leukaemia-associated transcription factors AML1 and CBFbeta." Warren A.J., Bravo J., Williams R.L., Rabbitts T.H. EMBO J. 19:3004-3015(2000) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS) OF 59-173 IN COMPLEX WITH CBFB. |
| [35] | "The leukemia-associated AML1 (Runx1) -- CBF beta complex functions as a DNA-induced molecular clamp." Bravo J., Li Z., Speck N.A., Warren A.J. Nat. Struct. Biol. 8:371-378(2001) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS) OF 54-243 IN COMPLEX WITH CBFB AND DNA, MUTAGENESIS OF ARG-80; LYS-83; THR-84; ARG-135; ARG-139; ARG-142; LYS-167; THR-169; ASP-171; ARG-174 AND ARG-177. |
| [36] | "DNA recognition by the RUNX1 transcription factor is mediated by an allosteric transition in the RUNT domain and by DNA bending." Bartfeld D., Shimon L., Couture G.C., Rabinovich D., Frolow F., Levanon D., Groner Y., Shakked Z. Structure 10:1395-1407(2002) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.5 ANGSTROMS) OF 61-174 IN COMPLEX WITH DNA. |
| [37] | "Immunoglobulin motif DNA recognition and heterodimerization of the PEBP2/CBF Runt domain." Nagata T., Gupta V., Sorce D., Kim W.-Y., Sali A., Chait B.T., Shigesada K., Ito Y., Werner M.H. Nat. Struct. Biol. 6:615-619(1999) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 53-178, MUTAGENESIS OF ALA-107 AND GLY-108. |
| [38] | "The Ig fold of the core binding factor alpha Runt domain is a member of a family of structurally and functionally related Ig-fold DNA-binding domains." Berardi M.J., Sun C., Zehr M., Abildgaard F., Peng J., Speck N.A., Bushweller J.H. Structure 7:1247-1256(1999) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 61-175 IN COMPLEX WITH DNA. |
| [39] | "The RUNX1 Runt domain at 1.25A resolution: a structural switch and specifically bound chloride ions modulate DNA binding." Baeckstroem S., Wolf-Watz M., Grundstroem C., Haerd T., Grundstroem T., Sauer U.H. J. Mol. Biol. 322:259-272(2002) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.25 ANGSTROMS) OF 46-185, CHLORIDE-BINDING. |
| [40] | "AML1 and the 8;21 and 3;21 translocations in acute and chronic myeloid leukemia." Nucifora G., Rowley J.D. Blood 86:1-14(1995) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW ON AML1 TRANSLOCATIONS. |
| [41] | "Transcriptionally active chimeric gene derived from the fusion of the AML1 gene and a novel gene on chromosome 8 in t(8;21) leukemic cells." Nisson P.E., Watkins P.C., Sacchi N. Cancer Genet. Cytogenet. 63:81-88(1992) [PubMed] [Europe PMC] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION WITH MTG8/ETO IN AML-M2. |
| [42] | "Junctions of the AML1/MTG8(ETO) fusion are constant in t(8;21) acute myeloid leukemia detected by reverse transcription polymerase chain reaction." Kozu T., Miyoshi H., Shimizu K., Maseki N., Kaneko Y., Asou H., Kamada N., Ohki M. Blood 82:1270-1276(1993) [PubMed] [Europe PMC] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION WITH MTG8/ETO IN AML-M2. |
| [43] | "The t(8;21) translocation in acute myeloid leukemia results in production of an AML1-MTG8 fusion transcript." Miyoshi H., Kozu T., Shimizu K., Enomoto K., Maseki N., Kaneko Y., Kamada N., Ohki M. EMBO J. 12:2715-2721(1993) [PubMed] [Europe PMC] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION WITH MTG8/ETO IN AML-M2. |
| [44] | "The 3;21 translocation in myelodysplasia results in a fusion transcript between the AML1 gene and the gene for EAP, a highly conserved protein associated with the Epstein-Barr virus small RNA EBER 1." Nucifora G., Begy C.R., Erickson P., Drabkin H.A., Rowley J.D. Proc. Natl. Acad. Sci. U.S.A. 90:7784-7788(1993) [PubMed] [Europe PMC] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION WITH EAP IN MYELODYSPLASIA. Tissue: Peripheral blood. |
| [45] | "Alternative, out-of-frame runt/MTG8 transcripts are encoded by the derivative (8) chromosome in the t(8;21) of acute myeloid leukemia M2." Tighe J.E., Calabi F. Blood 84:2115-2121(1994) [PubMed] [Europe PMC] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION WITH MTG8/ETO IN AML-M2. |
| [46] | "The t(12;21) of acute lymphoblastic leukemia results in a tel-AML1 gene fusion." Romana S.P., Mauchauffe M., le Coniat M., Chumakov I., le Paslier D., Berger R., Bernard O.A. Blood 85:3662-3670(1995) [PubMed] [Europe PMC] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION WITH TEL IN ACUTE LYMPHOBLASTIC LEUKEMIA (ALL). |
| [47] | "Identification of two transcripts of AML1/ETO-fused gene in t(8;21) leukemic cells and expression of wild-type ETO gene in hematopoietic cells." Era T., Asou N., Kunisada T., Yamasaki H., Asou H., Kamada N., Nishikawa S., Yamaguchi K., Takatsuki K. Genes Chromosomes Cancer 13:25-33(1995) [PubMed] [Europe PMC] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION WITH MTG8/ETO IN AML-M2. |
| [48] | "Fusion of the TEL gene on 12p13 to the AML1 gene on 21q22 in acute lymphoblastic leukemia." Golub T.R., Barker G.F., Bohlander S.K., Hiebert S.W., Ward D.C., Bray-Ward P., Morgan E., Raimondi S.C., Rowley J.D., Gilliland D.G. Proc. Natl. Acad. Sci. U.S.A. 92:4917-4921(1995) [PubMed] [Europe PMC] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION WITH TEL IN ACUTE LYMPHOBLASTIC LEUKEMIA (ALL). |
| [49] | "Haploinsufficiency of CBFA2 causes familial thrombocytopenia with propensity to develop acute myelogenous leukaemia." Song W.-J., Sullivan M.G., Legare R.D., Hutchings S., Tan X., Kufrin D., Ratajczak J., Resende I.C., Haworth C., Hock R., Loh M., Felix C., Roy D.-C., Busque L., Kurnit D., Willman C., Gewirtz A.M., Speck N.A. Gilliland D.G.Nat. Genet. 23:166-175(1999) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS FPDMM GLN-139 AND GLN-174. |
| [50] | "Genome profiling of chronic myelomonocytic leukemia: frequent alterations of RAS and RUNX1 genes." Gelsi-Boyer V., Trouplin V., Adelaide J., Aceto N., Remy V., Pinson S., Houdayer C., Arnoulet C., Sainty D., Bentires-Alj M., Olschwang S., Vey N., Mozziconacci M.-J., Birnbaum D., Chaffanet M. BMC Cancer 8:299-299(2008) [PubMed] [Europe PMC] [Abstract] Cited for: CHROMOSOMAL REARRANGEMENT. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | L34598 mRNA. Translation: AAA51720.1. D43967 mRNA. Translation: BAA07902.1. D10570 mRNA. Translation: BAA01426.1. S76345 mRNA. Translation: AAB33729.1. S76346 mRNA. Translation: AAB33730.1. S76350 mRNA. Translation: AAB33731.1. S60998 mRNA. No translation available. X79549 mRNA. Translation: CAA56092.1. D43968 mRNA. Translation: BAA07903.1. D43969 mRNA. Translation: BAA07904.1. U19601 mRNA. Translation: AAB51691.1. L21756 mRNA. Translation: AAA03086.1. Different termination. S69002 mRNA. Translation: AAB29907.1. Different termination. D13979 mRNA. Translation: BAA03089.1. D14822 mRNA. Translation: BAA03559.1. Different termination. D14823 mRNA. Translation: BAA03560.1. Different termination. S78158 mRNA. Translation: AAB34819.2. Different termination. S78159 mRNA. Translation: AAB34820.2. Different termination. S50186 Genomic DNA. No translation available. S78496 mRNA. No translation available. S74092 Genomic DNA. No translation available. X90979 mRNA. Translation: CAA62466.1. X90976 mRNA. Translation: CAA62464.1. D89790 mRNA. Translation: BAA14022.1. D89788 mRNA. Translation: BAA14020.1. D89789 mRNA. Translation: BAA14021.1. AP000330 Genomic DNA. No translation available. AP000331 Genomic DNA. No translation available. AP000332 Genomic DNA. No translation available. AP000333 Genomic DNA. No translation available. AP000334 Genomic DNA. No translation available. AF015262 Genomic DNA. No translation available. CH471079 Genomic DNA. Translation: EAX09769.1. CH471079 Genomic DNA. Translation: EAX09770.1. BC136380 mRNA. Translation: AAI36381.1. BC136381 mRNA. Translation: AAI36382.1. BC144053 mRNA. Translation: AAI44054.1. AF025841 Genomic DNA. Translation: AAC05246.1. Different initiation. AF025841 Genomic DNA. Translation: AAC05247.1. Different initiation. AJ229043 Genomic DNA. Translation: CAA13070.1. | ||||||||||||||||||||||||||||||||||||
| IPI | IPI00218529. IPI00218530. IPI00218936. IPI00218942. IPI00218943. IPI00477787. IPI00797455. IPI00936936. IPI00939238. IPI00952824. IPI01018795. | ||||||||||||||||||||||||||||||||||||
| PIR | I39443. S57842. | ||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001001890.1. NM_001001890.2. NP_001116079.1. NM_001122607.1. NP_001745.2. NM_001754.4. | ||||||||||||||||||||||||||||||||||||
| UniGene | Hs.149261. Hs.612648. | ||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | Q01196. | ||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||
| DIP | DIP-36773N. | ||||||||||||||||||||||||||||||||||||
| IntAct | Q01196. 8 interactions. | ||||||||||||||||||||||||||||||||||||
| MINT | MINT-153610. | ||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||
| PhosphoSite | Q01196. | ||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||
| DMDM | 215274205. | ||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||
| PaxDb | Q01196. | ||||||||||||||||||||||||||||||||||||
| PRIDE | Q01196. | ||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000300305; ENSP00000300305; ENSG00000159216. ENST00000325074; ENSP00000319459; ENSG00000159216. ENST00000344691; ENSP00000340690; ENSG00000159216. ENST00000358356; ENSP00000351123; ENSG00000159216. ENST00000416754; ENSP00000405158; ENSG00000159216. ENST00000437180; ENSP00000409227; ENSG00000159216. | ||||||||||||||||||||||||||||||||||||
| GeneID | 861. | ||||||||||||||||||||||||||||||||||||
| KEGG | hsa:861. | ||||||||||||||||||||||||||||||||||||
| UCSC | uc002yuh.3. human. uc002yuk.4. human. uc002yuo.1. human. uc002yur.1. human. | ||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||
| CTD | 861. | ||||||||||||||||||||||||||||||||||||
| GeneCards | GC21M036160. | ||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:10471. RUNX1. | ||||||||||||||||||||||||||||||||||||
| HPA | HPA004176. | ||||||||||||||||||||||||||||||||||||
| MIM | 151385. gene. 601399. phenotype. | ||||||||||||||||||||||||||||||||||||
| neXtProt | NX_Q01196. | ||||||||||||||||||||||||||||||||||||
| Orphanet | 521. Chronic myeloid leukemia. 71290. Familial platelet syndrome with predisposition to acute myelogenous leukemia. 99860. Precursor B-cell acute lymphoblastic leukemia. | ||||||||||||||||||||||||||||||||||||
| PharmGKB | PA34884. | ||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||
| eggNOG | NOG123889. | ||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG060268. | ||||||||||||||||||||||||||||||||||||
| KO | K08367. | ||||||||||||||||||||||||||||||||||||
| OMA | FPTLPSI. | ||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG47M1XZ. | ||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | smad2_3nuclearpathway. Regulation of nuclear SMAD2/3 signaling. | ||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q01196. | ||||||||||||||||||||||||||||||||||||
| Bgee | Q01196. | ||||||||||||||||||||||||||||||||||||
| Genevestigator | Q01196. | ||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000159216. Homo sapiens. | ||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||
| Gene3D | 2.60.40.720. 1 hit. | ||||||||||||||||||||||||||||||||||||
| InterPro | IPR000040. AML1_Runt. IPR008967. p53-like_TF_DNA-bd. IPR012346. p53/RUNT-type_TF_DNA-bd. IPR013524. Runt_dom. IPR013711. RunxI_c_dom. IPR016554. TF_Runt-rel_RUNX. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| PANTHER | PTHR11950. PTHR11950. 1 hit. | ||||||||||||||||||||||||||||||||||||
| Pfam | PF00853. Runt. 1 hit. PF08504. RunxI. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| PIRSF | PIRSF009374. TF_Runt-rel_RUNX. 1 hit. | ||||||||||||||||||||||||||||||||||||
| PRINTS | PR00967. ONCOGENEAML1. | ||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF49417. P53_like_DNA_bnd. 1 hit. | ||||||||||||||||||||||||||||||||||||
| PROSITE | PS51062. RUNT. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||
| BindingDB | Q01196. | ||||||||||||||||||||||||||||||||||||
| ChEMBL | CHEMBL1615385. | ||||||||||||||||||||||||||||||||||||
| ChiTaRS | RUNX1. human. | ||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | Q01196. | ||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 861. | ||||||||||||||||||||||||||||||||||||
| NextBio | 3580. | ||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | RUNX1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q01196 Secondary accession number(s): A8MV94 Q92479 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 21 Human chromosome 21: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
