Q01113 (IL9R_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 131.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Interleukin-9 receptor Short name=IL-9 receptor Short name=IL-9R Alternative name(s): CD_antigen=CD129 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 521 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | This is a receptor for interleukin-9. |
| Subcellular location | Cell membrane; Single-pass type I membrane protein. Secreted. |
| Domain | The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding. The box 1 motif is required for JAK interaction and/or activation. |
| Miscellaneous | The gene encoding for this protein is located in the pseudoautosomal region 2 (PAR2) of X and Y chromosomes. |
| Sequence similarities | Belongs to the type I cytokine receptor family. Type 4 subfamily. Contains 1 fibronectin type-III domain. |
| Sequence caution | The sequence AAB30844.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Membrane Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Signal Transmembrane Transmembrane helix |
| Molecular function | Receptor |
| PTM | Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cell proliferation Traceable author statement Ref.1. Source: ProtInc |
| Cellular_component | extracellular space Traceable author statement Ref.1. Source: ProtInc integral to plasma membraneTraceable author statement Ref.1. Source: ProtInc |
| Molecular_function | interleukin-9 receptor activity Traceable author statement Ref.1. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q01113-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q01113-2) The sequence of this isoform differs from the canonical sequence as follows: 1-21: Missing. | ||||||
| Isoform 3 (identifier: Q01113-3) The sequence of this isoform differs from the canonical sequence as follows: 1-9: MGLGRCIWE → MPQTCDGTGQMHLGSNCCKNGQTLLQRTCHGVSCCGWWFQAARSILGKGPSAQSLA 85-154: SNQAPGGTHK...VKLDPPSDLQ → RLLAAHISAS...WTRSTCPGDT 297-307: VKRIFYQNVPS → LGWGPTGPVCC 308-521: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 40 | 40 | Potential | ||||||
| Chain | 41 – 521 | 481 | Interleukin-9 receptor | PRO_0000010911 | |||||
Regions | |||||||||
| Topological domain | 41 – 270 | 230 | Extracellular Potential | ||||||
| Transmembrane | 271 – 291 | 21 | Helical; Potential | ||||||
| Topological domain | 292 – 521 | 230 | Cytoplasmic Potential | ||||||
| Domain | 150 – 244 | 95 | Fibronectin type-III | ||||||
| Motif | 245 – 249 | 5 | WSXWS motif | ||||||
| Motif | 301 – 309 | 9 | Box 1 motif | ||||||
| Compositional bias | 429 – 438 | 10 | Poly-Ser | ||||||
| Compositional bias | 439 – 442 | 4 | Poly-Asn | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 117 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 156 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 21 | 21 | Missing in isoform 2. | VSP_039025 | |||||
| Alternative sequence | 1 – 9 | 9 | MGLGRCIWE → MPQTCDGTGQMHLGSNCCKN GQTLLQRTCHGVSCCGWWFQ AARSILGKGPSAQSLA in isoform 3. | VSP_046207 | |||||
| Alternative sequence | 85 – 154 | 70 | SNQAP…PSDLQ → RLLAAHISASCGAVSAPSCC HLRQCSCHLTISPSLSTTAC LGGSRSAWWTRSTCPGDT in isoform 3. | VSP_046208 | |||||
| Alternative sequence | 297 – 307 | 11 | VKRIFYQNVPS → LGWGPTGPVCC in isoform 3. | VSP_046209 | |||||
| Alternative sequence | 308 – 521 | 214 | Missing in isoform 3. | VSP_046210 | |||||
| Natural variant | 63 | 1 | R → K. Ref.4 Corresponds to variant rs3093495 [ dbSNP | Ensembl ]. | VAR_038784 | |||||
| Natural variant | 239 | 1 | E → Q. Ref.4 Corresponds to variant rs6522 [ dbSNP | Ensembl ]. | VAR_014804 | |||||
| Natural variant | 288 | 1 | Y → C. Ref.4 Corresponds to variant rs3093514 [ dbSNP | Ensembl ]. | VAR_033920 | |||||
| Natural variant | 331 | 1 | G → R. Ref.1 Ref.7 Corresponds to variant rs2230001 [ dbSNP | Ensembl ]. | VAR_055348 | |||||
| Natural variant | 365 | 1 | R → H. Corresponds to variant rs2228650 [ dbSNP | Ensembl ]. | VAR_055349 | |||||
Experimental info | |||||||||
| Sequence conflict | 438 | 1 | S → SS in AAA58679. Ref.1 | ||||||
| Sequence conflict | 438 | 1 | S → SS in AAL55435. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Expression cloning of the murine and human interleukin 9 receptor cDNAs." Renauld J.-C., Druez C., Kermouni A., Houssiau F., Uyttenhove C., van Roost E., van Snick J. Proc. Natl. Acad. Sci. U.S.A. 89:5690-5694(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ARG-331. |
| [2] | "The IL-9 receptor gene (IL9R): genomic structure, chromosomal localization in the pseudoautosomal region of the long arm of the sex chromosomes, and identification of IL9R pseudogenes at 9qter, 10pter, 16pter, and 18pter." Kermouni A., van Roost E., Arden K.C., Vermeesch J.R., Weiss S., Godelaine D., Flint J., Lurquin C., Szikora J.-P., Higgs D.R., Marynen P., Renauld J.-C. Genomics 29:371-382(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. Tissue: Melanoma. |
| [3] | "Differentially regulated and evolved genes in the fully sequenced Xq/Yq pseudoautosomal region." Ciccodicola A., D'Esposito M., Esposito T., Gianfrancesco F., Migliaccio C., Miano M.G., Matarazzo M.R., Vacca M., Franze A., Cuccurese M., Cocchia M., Curci A., Terracciano A., Torino A., Cocchia S., Mercadante G., Pannone E., Archidiacono N. D'Urso M.Hum. Mol. Genet. 9:395-401(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [4] | SeattleSNPs variation discovery resource Submitted (DEC-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS LYS-63; GLN-239 AND CYS-288. |
| [5] | "The DNA sequence of the human X chromosome." Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. Bentley D.R.Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "Isolation and characterization of the human interleukin-9 receptor gene." Chang M.S., Engel G., Benedict C., Basu R., McNinch J. Blood 83:3199-3205(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 22-33, PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANT ARG-331. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | M84747 mRNA. Translation: AAA58679.1. L39064 Genomic DNA. Translation: AAC29513.1. AJ271736 Genomic DNA. Translation: CAB96817.1. AY071830 Genomic DNA. Translation: AAL55435.1. CH471247 Genomic DNA. Translation: EAW55884.1. S71404 mRNA. Translation: AAB30844.2. Different initiation. S71420 Genomic DNA. Translation: AAD14081.1. |
| IPI | IPI00005954. IPI00328860. IPI00956244. |
| PIR | B45268. |
| RefSeq | NP_002177.2. NM_002186.2. NP_789743.2. NM_176786.1. |
| UniGene | Hs.406228. |
3D structure databases | |
| ProteinModelPortal | Q01113. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-3156N. |
| IntAct | Q01113. 1 interaction. |
| MINT | MINT-120360. |
| STRING | 9606.ENSP00000244174. |
PTM databases | |
| PhosphoSite | Q01113. |
Polymorphism databases | |
| DMDM | 116242526. |
Proteomic databases | |
| PaxDb | Q01113. |
| PRIDE | Q01113. |
Protocols and materials databases | |
| DNASU | 3581. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000244174; ENSP00000244174; ENSG00000124334. ENST00000369423; ENSP00000358431; ENSG00000124334. ENST00000424344; ENSP00000388918; ENSG00000124334. |
| GeneID | 3581. |
| KEGG | hsa:3581. |
| UCSC | uc004fnv.1. human. |
Organism-specific databases | |
| CTD | 3581. |
| GeneCards | GC0XP155227. |
| H-InvDB | HIX0176548. HIX0177609. |
| HGNC | HGNC:6030. IL9R. |
| HPA | CAB010497. |
| MIM | 300007. gene. |
| neXtProt | NX_Q01113. |
| PharmGKB | PA29846. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG45141. |
| HOGENOM | HOG000232001. |
| HOVERGEN | HBG005032. |
| InParanoid | Q01113. |
| KO | K05073. |
| OMA | WEGWTLE. |
| OrthoDB | EOG4B2SWW. |
| PhylomeDB | Q01113. |
Gene expression databases | |
| ArrayExpress | Q01113. |
| Bgee | Q01113. |
| CleanEx | HS_IL9R. |
| Genevestigator | Q01113. |
| GermOnline | ENSG00000124334. Homo sapiens. |
Family and domain databases | |
| Gene3D | 2.60.40.10. 1 hit. |
| InterPro | IPR003961. Fibronectin_type3. IPR003531. Hempt_rcpt_S_F1_CS. IPR013783. Ig-like_fold. [Graphical view] |
| SUPFAM | SSF49265. FN_III-like. 1 hit. |
| PROSITE | PS50853. FN3. False negative. PS01355. HEMATOPO_REC_S_F1. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 3581. |
| NextBio | 13997. |
| SOURCE | Search... |
Entry information
| Entry name | IL9R_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q01113 Secondary accession number(s): B9ZVT0 Q96TF0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human cell differentiation molecules CD nomenclature of surface proteins of human leucocytes and list of entries |
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
