Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Interleukin-9 receptor

Gene

IL9R

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

This is a receptor for interleukin-9.

GO - Molecular functioni

  1. interleukin-9 receptor activity Source: ProtInc

GO - Biological processi

  1. cell proliferation Source: ProtInc
  2. positive regulation of cell growth Source: Ensembl
  3. positive regulation of protein targeting to mitochondrion Source: ParkinsonsUK-UCL
  4. signal transduction Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Enzyme and pathway databases

SignaLinkiQ01113.

Names & Taxonomyi

Protein namesi
Recommended name:
Interleukin-9 receptor
Short name:
IL-9 receptor
Short name:
IL-9R
Alternative name(s):
CD_antigen: CD129
Gene namesi
Name:IL9R
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome X

Organism-specific databases

HGNCiHGNC:6030. IL9R.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini41 – 270230ExtracellularSequence AnalysisAdd
BLAST
Transmembranei271 – 29121HelicalSequence AnalysisAdd
BLAST
Topological domaini292 – 521230CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. extracellular space Source: ProtInc
  2. integral component of plasma membrane Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA29846.

Polymorphism and mutation databases

BioMutaiIL9R.
DMDMi116242526.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 4040Sequence AnalysisAdd
BLAST
Chaini41 – 521481Interleukin-9 receptorPRO_0000010911Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi117 – 1171N-linked (GlcNAc...)Sequence Analysis
Glycosylationi156 – 1561N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ01113.
PRIDEiQ01113.

PTM databases

PhosphoSiteiQ01113.

Expressioni

Gene expression databases

BgeeiQ01113.
CleanExiHS_IL9R.
ExpressionAtlasiQ01113. baseline.
GenevestigatoriQ01113.

Organism-specific databases

HPAiCAB010497.

Interactioni

Protein-protein interaction databases

BioGridi109795. 15 interactions.
DIPiDIP-3156N.
IntActiQ01113. 2 interactions.
MINTiMINT-120360.
STRINGi9606.ENSP00000244174.

Structurei

3D structure databases

ProteinModelPortaliQ01113.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini149 – 259111Fibronectin type-IIIPROSITE-ProRule annotationAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi245 – 2495WSXWS motif
Motifi301 – 3099Box 1 motif

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi429 – 43810Poly-Ser
Compositional biasi439 – 4424Poly-Asn

Domaini

The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
The box 1 motif is required for JAK interaction and/or activation.

Sequence similaritiesi

Contains 1 fibronectin type-III domain.PROSITE-ProRule annotation

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG45141.
GeneTreeiENSGT00510000049125.
HOGENOMiHOG000095165.
HOVERGENiHBG005032.
InParanoidiQ01113.
KOiK05073.
OMAiHEDLQGM.
OrthoDBiEOG7TQV0Z.
PhylomeDBiQ01113.
TreeFamiTF337874.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR003961. FN3_dom.
IPR003531. Hempt_rcpt_S_F1_CS.
IPR013783. Ig-like_fold.
[Graphical view]
SUPFAMiSSF49265. SSF49265. 1 hit.
PROSITEiPS50853. FN3. 1 hit.
PS01355. HEMATOPO_REC_S_F1. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q01113-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGLGRCIWEG WTLESEALRR DMGTWLLACI CICTCVCLGV SVTGEGQGPR
60 70 80 90 100
SRTFTCLTNN ILRIDCHWSA PELGQGSSPW LLFTSNQAPG GTHKCILRGS
110 120 130 140 150
ECTVVLPPEA VLVPSDNFTI TFHHCMSGRE QVSLVDPEYL PRRHVKLDPP
160 170 180 190 200
SDLQSNISSG HCILTWSISP ALEPMTTLLS YELAFKKQEE AWEQAQHRDH
210 220 230 240 250
IVGVTWLILE AFELDPGFIH EARLRVQMAT LEDDVVEEER YTGQWSEWSQ
260 270 280 290 300
PVCFQAPQRQ GPLIPPWGWP GNTLVAVSIF LLLTGPTYLL FKLSPRVKRI
310 320 330 340 350
FYQNVPSPAM FFQPLYSVHN GNFQTWMGAH GAGVLLSQDC AGTPQGALEP
360 370 380 390 400
CVQEATALLT CGPARPWKSV ALEEEQEGPG TRLPGNLSSE DVLPAGCTEW
410 420 430 440 450
RVQTLAYLPQ EDWAPTSLTR PAPPDSEGSR SSSSSSSSNN NNYCALGCYG
460 470 480 490 500
GWHLSALPGN TQSSGPIPAL ACGLSCDHQG LETQQGVAWV LAGHCQRPGL
510 520
HEDLQGMLLP SVLSKARSWT F
Length:521
Mass (Da):57,147
Last modified:October 17, 2006 - v3
Checksum:i07C40436466173F3
GO
Isoform 2 (identifier: Q01113-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-21: Missing.

Show »
Length:500
Mass (Da):54,686
Checksum:iC79D0C8C1D330D8F
GO
Isoform 3 (identifier: Q01113-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-9: MGLGRCIWE → MPQTCDGTGQMHLGSNCCKNGQTLLQRTCHGVSCCGWWFQAARSILGKGPSAQSLA
     85-154: SNQAPGGTHK...VKLDPPSDLQ → RLLAAHISAS...WTRSTCPGDT
     297-307: VKRIFYQNVPS → LGWGPTGPVCC
     308-521: Missing.

Show »
Length:342
Mass (Da):37,389
Checksum:iBC2E46EF83989332
GO

Sequence cautioni

The sequence AAB30844.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti438 – 4381S → SS in AAA58679 (PubMed:1376929).Curated
Sequence conflicti438 – 4381S → SS in AAL55435 (Ref. 4) Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti63 – 631R → K.1 Publication
Corresponds to variant rs3093495 [ dbSNP | Ensembl ].
VAR_038784
Natural varianti239 – 2391E → Q.1 Publication
Corresponds to variant rs6522 [ dbSNP | Ensembl ].
VAR_014804
Natural varianti288 – 2881Y → C.1 Publication
Corresponds to variant rs3093514 [ dbSNP | Ensembl ].
VAR_033920
Natural varianti331 – 3311G → R.2 Publications
Corresponds to variant rs2230001 [ dbSNP | Ensembl ].
VAR_055348
Natural varianti365 – 3651R → H.
Corresponds to variant rs2228650 [ dbSNP | Ensembl ].
VAR_055349

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 2121Missing in isoform 2. CuratedVSP_039025Add
BLAST
Alternative sequencei1 – 99MGLGRCIWE → MPQTCDGTGQMHLGSNCCKN GQTLLQRTCHGVSCCGWWFQ AARSILGKGPSAQSLA in isoform 3. CuratedVSP_046207
Alternative sequencei85 – 15470SNQAP…PSDLQ → RLLAAHISASCGAVSAPSCC HLRQCSCHLTISPSLSTTAC LGGSRSAWWTRSTCPGDT in isoform 3. CuratedVSP_046208Add
BLAST
Alternative sequencei297 – 30711VKRIFYQNVPS → LGWGPTGPVCC in isoform 3. CuratedVSP_046209Add
BLAST
Alternative sequencei308 – 521214Missing in isoform 3. CuratedVSP_046210Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M84747 mRNA. Translation: AAA58679.1.
L39064 Genomic DNA. Translation: AAC29513.1.
AJ271736 Genomic DNA. Translation: CAB96817.1.
AY071830 Genomic DNA. Translation: AAL55435.1.
CH471247 Genomic DNA. Translation: EAW55884.1.
S71404 mRNA. Translation: AAB30844.2. Different initiation.
S71420 Genomic DNA. Translation: AAD14081.1.
CCDSiCCDS14771.4. [Q01113-1]
CCDS59180.1. [Q01113-3]
PIRiB45268.
RefSeqiNP_002177.2. NM_002186.2. [Q01113-1]
NP_789743.2. NM_176786.1. [Q01113-3]
UniGeneiHs.406228.

Genome annotation databases

EnsembliENST00000244174; ENSP00000244174; ENSG00000124334. [Q01113-1]
ENST00000369423; ENSP00000358431; ENSG00000124334. [Q01113-3]
GeneIDi3581.
KEGGihsa:3581.
UCSCiuc004fnu.1. human.
uc004fnv.1. human. [Q01113-1]

Polymorphism and mutation databases

BioMutaiIL9R.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

SeattleSNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M84747 mRNA. Translation: AAA58679.1.
L39064 Genomic DNA. Translation: AAC29513.1.
AJ271736 Genomic DNA. Translation: CAB96817.1.
AY071830 Genomic DNA. Translation: AAL55435.1.
CH471247 Genomic DNA. Translation: EAW55884.1.
S71404 mRNA. Translation: AAB30844.2. Different initiation.
S71420 Genomic DNA. Translation: AAD14081.1.
CCDSiCCDS14771.4. [Q01113-1]
CCDS59180.1. [Q01113-3]
PIRiB45268.
RefSeqiNP_002177.2. NM_002186.2. [Q01113-1]
NP_789743.2. NM_176786.1. [Q01113-3]
UniGeneiHs.406228.

3D structure databases

ProteinModelPortaliQ01113.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109795. 15 interactions.
DIPiDIP-3156N.
IntActiQ01113. 2 interactions.
MINTiMINT-120360.
STRINGi9606.ENSP00000244174.

PTM databases

PhosphoSiteiQ01113.

Polymorphism and mutation databases

BioMutaiIL9R.
DMDMi116242526.

Proteomic databases

PaxDbiQ01113.
PRIDEiQ01113.

Protocols and materials databases

DNASUi3581.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000244174; ENSP00000244174; ENSG00000124334. [Q01113-1]
ENST00000369423; ENSP00000358431; ENSG00000124334. [Q01113-3]
GeneIDi3581.
KEGGihsa:3581.
UCSCiuc004fnu.1. human.
uc004fnv.1. human. [Q01113-1]

Organism-specific databases

CTDi3581.
GeneCardsiGC0XP155227.
H-InvDBHIX0176548.
HIX0177609.
HGNCiHGNC:6030. IL9R.
HPAiCAB010497.
MIMi300007. gene.
neXtProtiNX_Q01113.
PharmGKBiPA29846.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG45141.
GeneTreeiENSGT00510000049125.
HOGENOMiHOG000095165.
HOVERGENiHBG005032.
InParanoidiQ01113.
KOiK05073.
OMAiHEDLQGM.
OrthoDBiEOG7TQV0Z.
PhylomeDBiQ01113.
TreeFamiTF337874.

Enzyme and pathway databases

SignaLinkiQ01113.

Miscellaneous databases

ChiTaRSiIL9R. human.
GeneWikiiInterleukin-9_receptor.
GenomeRNAii3581.
NextBioi13997.
PROiQ01113.
SOURCEiSearch...

Gene expression databases

BgeeiQ01113.
CleanExiHS_IL9R.
ExpressionAtlasiQ01113. baseline.
GenevestigatoriQ01113.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR003961. FN3_dom.
IPR003531. Hempt_rcpt_S_F1_CS.
IPR013783. Ig-like_fold.
[Graphical view]
SUPFAMiSSF49265. SSF49265. 1 hit.
PROSITEiPS50853. FN3. 1 hit.
PS01355. HEMATOPO_REC_S_F1. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ARG-331.
  2. "The IL-9 receptor gene (IL9R): genomic structure, chromosomal localization in the pseudoautosomal region of the long arm of the sex chromosomes, and identification of IL9R pseudogenes at 9qter, 10pter, 16pter, and 18pter."
    Kermouni A., van Roost E., Arden K.C., Vermeesch J.R., Weiss S., Godelaine D., Flint J., Lurquin C., Szikora J.-P., Higgs D.R., Marynen P., Renauld J.-C.
    Genomics 29:371-382(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    Tissue: Melanoma.
  3. Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  4. SeattleSNPs variation discovery resource
    Submitted (DEC-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS LYS-63; GLN-239 AND CYS-288.
  5. "The DNA sequence of the human X chromosome."
    Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
    , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
    Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "Isolation and characterization of the human interleukin-9 receptor gene."
    Chang M.S., Engel G., Benedict C., Basu R., McNinch J.
    Blood 83:3199-3205(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 22-33, PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANT ARG-331.

Entry informationi

Entry nameiIL9R_HUMAN
AccessioniPrimary (citable) accession number: Q01113
Secondary accession number(s): B9ZVT0
, Q14634, Q8WWU1, Q96TF0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 1, 1993
Last sequence update: October 17, 2006
Last modified: April 29, 2015
This is version 149 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

The gene coding for this protein is located in the pseudoautosomal region 2 (PAR2) of X and Y chromosomes.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.