Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Vascular endothelial growth factor A

Gene

Vegfa

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. May play a role in increasing vascular permeability during lactation, when increased transport of molecules from the blood is required for efficient milk protein synthesis (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

  • activation of protein kinase activity Source: UniProtKB
  • angiogenesis Source: CACAO
  • artery morphogenesis Source: MGI
  • basophil chemotaxis Source: MGI
  • blood vessel development Source: MGI
  • blood vessel endothelial cell proliferation involved in sprouting angiogenesis Source: CACAO
  • blood vessel morphogenesis Source: MGI
  • branching morphogenesis of an epithelial tube Source: MGI
  • camera-type eye morphogenesis Source: MGI
  • cardiac muscle fiber development Source: MGI
  • cardiac vascular smooth muscle cell development Source: BHF-UCL
  • cell maturation Source: MGI
  • cell migration Source: MGI
  • cell migration involved in sprouting angiogenesis Source: UniProtKB
  • cell proliferation Source: MGI
  • cellular response to hypoxia Source: UniProtKB
  • cellular response to vascular endothelial growth factor stimulus Source: UniProtKB
  • commissural neuron axon guidance Source: BHF-UCL
  • coronary artery morphogenesis Source: BHF-UCL
  • coronary vein morphogenesis Source: BHF-UCL
  • dopaminergic neuron differentiation Source: MGI
  • endothelial cell chemotaxis Source: UniProtKB
  • endothelial cell migration Source: MGI
  • epithelial cell differentiation Source: MGI
  • eye photoreceptor cell development Source: MGI
  • growth Source: MGI
  • heart morphogenesis Source: MGI
  • induction of positive chemotaxis Source: MGI
  • in utero embryonic development Source: MGI
  • kidney development Source: MGI
  • lactation Source: MGI
  • lung development Source: MGI
  • lung vasculature development Source: MGI
  • lymphangiogenesis Source: MGI
  • lymph vessel morphogenesis Source: BHF-UCL
  • macrophage differentiation Source: UniProtKB
  • mammary gland alveolus development Source: MGI
  • mesoderm development Source: MGI
  • monocyte differentiation Source: UniProtKB
  • negative regulation of apoptotic process Source: UniProtKB
  • negative regulation of cell-cell adhesion Source: MGI
  • negative regulation of cysteine-type endopeptidase activity involved in apoptotic process Source: MGI
  • negative regulation of extrinsic apoptotic signaling pathway Source: BHF-UCL
  • negative regulation of neuron apoptotic process Source: BHF-UCL
  • negative regulation of transcription from RNA polymerase II promoter Source: MGI
  • neuron development Source: BHF-UCL
  • outflow tract morphogenesis Source: BHF-UCL
  • ovarian follicle development Source: MGI
  • patterning of blood vessels Source: MGI
  • positive chemotaxis Source: BHF-UCL
  • positive regulation of angiogenesis Source: UniProtKB
  • positive regulation of axon extension involved in axon guidance Source: BHF-UCL
  • positive regulation of blood vessel endothelial cell migration Source: UniProtKB
  • positive regulation of branching involved in ureteric bud morphogenesis Source: UniProtKB
  • positive regulation of cell adhesion Source: UniProtKB
  • positive regulation of cell division Source: UniProtKB-KW
  • positive regulation of cell migration Source: MGI
  • positive regulation of cell migration involved in sprouting angiogenesis Source: UniProtKB
  • positive regulation of cell proliferation Source: MGI
  • positive regulation of cell proliferation by VEGF-activated platelet derived growth factor receptor signaling pathway Source: UniProtKB
  • positive regulation of cellular component movement Source: UniProtKB
  • positive regulation of CREB transcription factor activity Source: UniProtKB
  • positive regulation of endothelial cell chemotaxis by VEGF-activated vascular endothelial growth factor receptor signaling pathway Source: BHF-UCL
  • positive regulation of endothelial cell migration Source: UniProtKB
  • positive regulation of endothelial cell proliferation Source: MGI
  • positive regulation of epithelial cell proliferation Source: MGI
  • positive regulation of ERK1 and ERK2 cascade Source: BHF-UCL
  • positive regulation of focal adhesion assembly Source: UniProtKB
  • positive regulation of gene expression Source: MGI
  • positive regulation of histone deacetylase activity Source: MGI
  • positive regulation of lymphangiogenesis Source: MGI
  • positive regulation of MAP kinase activity Source: UniProtKB
  • positive regulation of mast cell chemotaxis Source: MGI
  • positive regulation of mesenchymal cell proliferation Source: MGI
  • positive regulation of neuroblast proliferation Source: MGI
  • positive regulation of p38MAPK cascade Source: MGI
  • positive regulation of peptidyl-serine phosphorylation Source: BHF-UCL
  • positive regulation of peptidyl-tyrosine autophosphorylation Source: UniProtKB
  • positive regulation of peptidyl-tyrosine phosphorylation Source: UniProtKB
  • positive regulation of positive chemotaxis Source: UniProtKB
  • positive regulation of protein autophosphorylation Source: UniProtKB
  • positive regulation of protein complex assembly Source: UniProtKB
  • positive regulation of protein kinase B signaling Source: BHF-UCL
  • positive regulation of protein kinase C signaling Source: UniProtKB
  • positive regulation of protein kinase D signaling Source: BHF-UCL
  • positive regulation of protein localization to early endosome Source: MGI
  • positive regulation of protein phosphorylation Source: UniProtKB
  • positive regulation of receptor internalization Source: UniProtKB
  • positive regulation of retinal ganglion cell axon guidance Source: BHF-UCL
  • positive regulation of transcription from RNA polymerase II promoter Source: UniProtKB
  • positive regulation of transcription from RNA polymerase II promoter in response to hypoxia Source: MGI
  • positive regulation of vascular endothelial growth factor receptor signaling pathway Source: UniProtKB
  • positive regulation of vascular permeability Source: MGI
  • post-embryonic camera-type eye development Source: MGI
  • primitive erythrocyte differentiation Source: MGI
  • regulation of cell shape Source: UniProtKB
  • regulation of cGMP metabolic process Source: MGI
  • regulation of endothelial cell differentiation Source: MGI
  • regulation of hematopoietic progenitor cell differentiation Source: MGI
  • regulation of retinal ganglion cell axon guidance Source: BHF-UCL
  • regulation of transcription from RNA polymerase II promoter Source: MGI
  • response to hypoxia Source: UniProtKB
  • retinal blood vessel morphogenesis Source: CACAO
  • sprouting angiogenesis Source: BHF-UCL
  • surfactant homeostasis Source: MGI
  • tube formation Source: UniProtKB
  • vascular endothelial growth factor receptor signaling pathway Source: MGI
  • vascular endothelial growth factor signaling pathway Source: BHF-UCL
  • vasculature development Source: MGI
  • VEGF-activated neuropilin signaling pathway Source: BHF-UCL
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, Growth factor, Mitogen

Keywords - Biological processi

Angiogenesis, Differentiation

Keywords - Ligandi

Heparin-binding

Enzyme and pathway databases

ReactomeiREACT_280640. EPHA-mediated growth cone collapse.
REACT_293283. VEGF binds to VEGFR leading to receptor dimerization.
REACT_299722. VEGFR2 mediated cell proliferation.
REACT_307071. Platelet degranulation.
REACT_315885. VEGFA-VEGFR2 Pathway.
REACT_343634. VEGF ligand-receptor interactions.

Names & Taxonomyi

Protein namesi
Recommended name:
Vascular endothelial growth factor A
Short name:
VEGF-A
Alternative name(s):
Vascular permeability factor
Short name:
VPF
Gene namesi
Name:Vegfa
Synonyms:Vegf
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589 Componenti: Chromosome 17

Organism-specific databases

MGIiMGI:103178. Vegfa.

Subcellular locationi

Isoform VEGF-3 :

GO - Cellular componenti

  • cell surface Source: UniProtKB
  • cytoplasm Source: MGI
  • extracellular region Source: MGI
  • extracellular space Source: MGI
  • plasma membrane Source: UniProtKB-SubCell
  • secretory granule Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2626By similarityAdd
BLAST
Chaini27 – 214188Vascular endothelial growth factor APRO_0000023388Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi51 ↔ 93By similarity
Disulfide bondi76 – 76InterchainBy similarity
Disulfide bondi82 ↔ 127By similarity
Disulfide bondi85 – 85InterchainBy similarity
Disulfide bondi86 ↔ 129By similarity
Glycosylationi100 – 1001N-linked (GlcNAc...)Curated

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ00731.
PRIDEiQ00731.

PTM databases

PhosphoSiteiQ00731.

Expressioni

Tissue specificityi

In developing embryos, expressed mainly in the choroid plexus, paraventricular neuroepithelium, placenta and kidney glomeruli. Also found in bronchial epithelium, adrenal gland and in seminiferous tubules of testis. High expression of VEGF continues in kidney glomeruli and choroid plexus in adults.

Developmental stagei

Levels increase during pregnancy (maximum 5.5-fold at 5 days) and a more marked increase occurs during lactation (maximal 9.7-fold at 7 days). Levels decrease progressively during the phase of involution.1 Publication

Inductioni

By IL-6 and FSH in vitro.1 Publication

Gene expression databases

BgeeiQ00731.
CleanExiMM_VEGFA.
ExpressionAtlasiQ00731. baseline and differential.
GenevisibleiQ00731. MM.

Interactioni

Subunit structurei

Homodimer; disulfide-linked. Also found as heterodimer with PGF (By similarity).By similarity

Protein-protein interaction databases

BioGridi204512. 3 interactions.
DIPiDIP-31909N.
IntActiQ00731. 2 interactions.
STRINGi10090.ENSMUSP00000115883.

Structurei

3D structure databases

ProteinModelPortaliQ00731.
SMRiQ00731. Positions 37-134, 166-214.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domaini

Isoform VEGF-3 contains a basic insert which acts as a cell retention signal.

Sequence similaritiesi

Belongs to the PDGF/VEGF growth factor family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG73329.
GeneTreeiENSGT00730000110791.
HOGENOMiHOG000230896.
HOVERGENiHBG000105.
InParanoidiQ00731.
KOiK05448.
OrthoDBiEOG74R1S0.
PhylomeDBiQ00731.

Family and domain databases

Gene3Di2.10.160.10. 1 hit.
2.10.90.10. 1 hit.
InterProiIPR029034. Cystine-knot_cytokine.
IPR023581. PD_growth_factor_CS.
IPR000072. PDGF/VEGF_dom.
IPR027928. VEGF_C.
[Graphical view]
PfamiPF00341. PDGF. 1 hit.
PF14554. VEGF_C. 1 hit.
[Graphical view]
SMARTiSM00141. PDGF. 1 hit.
[Graphical view]
SUPFAMiSSF57501. SSF57501. 1 hit.
SSF57593. SSF57593. 1 hit.
PROSITEiPS00249. PDGF_1. 1 hit.
PS50278. PDGF_2. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative promoter usage, alternative splicing and alternative initiation. AlignAdd to basket

Isoform VEGF-3 (identifier: Q00731-1) [UniParc]FASTAAdd to basket

Also known as: VEGF188

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNFLLSWVHW TLALLLYLHH AKWSQAAPTT EGEQKSHEVI KFMDVYQRSY
60 70 80 90 100
CRPIETLVDI FQEYPDEIEY IFKPSCVPLM RCAGCCNDEA LECVPTSESN
110 120 130 140 150
ITMQIMRIKP HQSQHIGEMS FLQHSRCECR PKKDRTKPEK KSVRGKGKGQ
160 170 180 190 200
KRKRKKSRFK SWSVHCEPCS ERRKHLFVQD PQTCKCSCKN TDSRCKARQL
210
ELNERTCRCD KPRR
Length:214
Mass (Da):25,283
Last modified:October 1, 1996 - v2
Checksum:iB5540B51E4BB6E17
GO
Isoform VEGF-1 (identifier: Q00731-2) [UniParc]FASTAAdd to basket

Also known as: VEGF164

The sequence of this isoform differs from the canonical sequence as follows:
     140-140: K → N
     141-164: Missing.

Show »
Length:190
Mass (Da):22,440
Checksum:i7B0BE0B9541E3805
GO
Isoform VEGF-2 (identifier: Q00731-3) [UniParc]FASTAAdd to basket

Also known as: VEGF120

The sequence of this isoform differs from the canonical sequence as follows:
     141-208: Missing.

Show »
Length:146
Mass (Da):17,233
Checksum:i30635EADAD328C29
GO
Isoform VEGF-4 (identifier: Q00731-4) [UniParc]FASTAAdd to basket

Also known as: VEGF115

The sequence of this isoform differs from the canonical sequence as follows:
     105-141: IMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKK → VGTCGTGDGAGAGGGRRTVVQGGALEGCLGLCLGNFW
     142-214: Missing.

Show »
Length:141
Mass (Da):15,584
Checksum:iA9AC452E770CC338
GO
Isoform VEGF-5 (identifier: Q00731-5) [UniParc]FASTAAdd to basket

Also known as: VEGF102

The sequence of this isoform differs from the canonical sequence as follows:
     105-128: IMRIKPHQSQHIGEMSFLQHSRCE → VGTCGTGDGAGAGGAGGQWYKEGH
     129-214: Missing.

Show »
Length:128
Mass (Da):14,309
Checksum:i44405AD86973E191
GO
Isoform L-VEGF-1 (identifier: Q00731-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTDRQTDTAP...AGPGRASETM
     140-140: K → N
     141-164: Missing.

Note: Gene prediction based on EST data. Produced by alternative promoter usage and alternative initiation. Starts at an alternative upstream CUG codon.
Show »
Length:368
Mass (Da):40,288
Checksum:i8B8EAC32ADE8BDFD
GO

Sequence cautioni

The sequence AAH61468.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti61 – 611F → I in AAC05442 (PubMed:9446618).Curated
Sequence conflicti117 – 1182GE → ER in AAA40547 (PubMed:1644816).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MTDRQTDTAPSPSAHLLAGG LPTVDAAASREEPKPAPGGG VEGVGARGIARKLFVQLLGS SRSVVAVVCAAGDKPIGAGR SASSGLEKPGPEKRGEEEKE EERGPQWALGSQEPSSWTGE AAVCADSAPAARAPQAPARA SVPEGRGARQGAQESGLPRS PSRRGSASRAGPGRASETM in isoform L-VEGF-1. CuratedVSP_038746
Alternative sequencei105 – 14137IMRIK…KPEKK → VGTCGTGDGAGAGGGRRTVV QGGALEGCLGLCLGNFW in isoform VEGF-4. 1 PublicationVSP_016418Add
BLAST
Alternative sequencei105 – 12824IMRIK…HSRCE → VGTCGTGDGAGAGGAGGQWY KEGH in isoform VEGF-5. 1 PublicationVSP_016419Add
BLAST
Alternative sequencei129 – 21486Missing in isoform VEGF-5. 1 PublicationVSP_016420Add
BLAST
Alternative sequencei140 – 1401K → N in isoform VEGF-1 and isoform L-VEGF-1. 2 PublicationsVSP_004626
Alternative sequencei141 – 20868Missing in isoform VEGF-2. 1 PublicationVSP_004628Add
BLAST
Alternative sequencei141 – 16424Missing in isoform VEGF-1 and isoform L-VEGF-1. 2 PublicationsVSP_004627Add
BLAST
Alternative sequencei142 – 21473Missing in isoform VEGF-4. 1 PublicationVSP_016421Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
S37052 mRNA. Translation: AAB22252.1.
S38083 mRNA. Translation: AAB22253.1.
S38100 mRNA. Translation: AAB22254.1.
M95200 mRNA. Translation: AAA40547.1.
U50279 mRNA. Translation: AAC05442.1.
AY263146 mRNA. Translation: AAP86647.1.
AC127690 Genomic DNA. No translation available.
BC061468 mRNA. Translation: AAH61468.1. Different initiation.
AY707864 mRNA. Translation: AAU11325.1.
AY750956 mRNA. Translation: AAU95484.1.
AY750957 mRNA. Translation: AAU95485.1.
U41383 Genomic DNA. No translation available.
CCDSiCCDS28818.2. [Q00731-6]
CCDS70817.1. [Q00731-3]
PIRiA44881.
B44881.
RefSeqiNP_001020421.2. NM_001025250.3.
NP_001020428.2. NM_001025257.3.
NP_001103736.1. NM_001110266.1.
NP_001103737.1. NM_001110267.1.
NP_001103738.1. NM_001110268.1.
NP_001273985.1. NM_001287056.1. [Q00731-1]
NP_001273986.1. NM_001287057.1. [Q00731-2]
NP_001273987.1. NM_001287058.1. [Q00731-3]
NP_033531.3. NM_009505.4. [Q00731-6]
UniGeneiMm.282184.

Genome annotation databases

EnsembliENSMUST00000024747; ENSMUSP00000024747; ENSMUSG00000023951. [Q00731-3]
GeneIDi22339.
KEGGimmu:22339.
UCSCiuc008cro.3. mouse. [Q00731-6]
uc008crr.3. mouse. [Q00731-5]
uc012aui.2. mouse. [Q00731-1]

Keywords - Coding sequence diversityi

Alternative initiation, Alternative promoter usage, Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
S37052 mRNA. Translation: AAB22252.1.
S38083 mRNA. Translation: AAB22253.1.
S38100 mRNA. Translation: AAB22254.1.
M95200 mRNA. Translation: AAA40547.1.
U50279 mRNA. Translation: AAC05442.1.
AY263146 mRNA. Translation: AAP86647.1.
AC127690 Genomic DNA. No translation available.
BC061468 mRNA. Translation: AAH61468.1. Different initiation.
AY707864 mRNA. Translation: AAU11325.1.
AY750956 mRNA. Translation: AAU95484.1.
AY750957 mRNA. Translation: AAU95485.1.
U41383 Genomic DNA. No translation available.
CCDSiCCDS28818.2. [Q00731-6]
CCDS70817.1. [Q00731-3]
PIRiA44881.
B44881.
RefSeqiNP_001020421.2. NM_001025250.3.
NP_001020428.2. NM_001025257.3.
NP_001103736.1. NM_001110266.1.
NP_001103737.1. NM_001110267.1.
NP_001103738.1. NM_001110268.1.
NP_001273985.1. NM_001287056.1. [Q00731-1]
NP_001273986.1. NM_001287057.1. [Q00731-2]
NP_001273987.1. NM_001287058.1. [Q00731-3]
NP_033531.3. NM_009505.4. [Q00731-6]
UniGeneiMm.282184.

3D structure databases

ProteinModelPortaliQ00731.
SMRiQ00731. Positions 37-134, 166-214.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi204512. 3 interactions.
DIPiDIP-31909N.
IntActiQ00731. 2 interactions.
STRINGi10090.ENSMUSP00000115883.

PTM databases

PhosphoSiteiQ00731.

Proteomic databases

PaxDbiQ00731.
PRIDEiQ00731.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000024747; ENSMUSP00000024747; ENSMUSG00000023951. [Q00731-3]
GeneIDi22339.
KEGGimmu:22339.
UCSCiuc008cro.3. mouse. [Q00731-6]
uc008crr.3. mouse. [Q00731-5]
uc012aui.2. mouse. [Q00731-1]

Organism-specific databases

CTDi7422.
MGIiMGI:103178. Vegfa.

Phylogenomic databases

eggNOGiNOG73329.
GeneTreeiENSGT00730000110791.
HOGENOMiHOG000230896.
HOVERGENiHBG000105.
InParanoidiQ00731.
KOiK05448.
OrthoDBiEOG74R1S0.
PhylomeDBiQ00731.

Enzyme and pathway databases

ReactomeiREACT_280640. EPHA-mediated growth cone collapse.
REACT_293283. VEGF binds to VEGFR leading to receptor dimerization.
REACT_299722. VEGFR2 mediated cell proliferation.
REACT_307071. Platelet degranulation.
REACT_315885. VEGFA-VEGFR2 Pathway.
REACT_343634. VEGF ligand-receptor interactions.

Miscellaneous databases

ChiTaRSiVegfa. mouse.
NextBioi302593.
PROiQ00731.
SOURCEiSearch...

Gene expression databases

BgeeiQ00731.
CleanExiMM_VEGFA.
ExpressionAtlasiQ00731. baseline and differential.
GenevisibleiQ00731. MM.

Family and domain databases

Gene3Di2.10.160.10. 1 hit.
2.10.90.10. 1 hit.
InterProiIPR029034. Cystine-knot_cytokine.
IPR023581. PD_growth_factor_CS.
IPR000072. PDGF/VEGF_dom.
IPR027928. VEGF_C.
[Graphical view]
PfamiPF00341. PDGF. 1 hit.
PF14554. VEGF_C. 1 hit.
[Graphical view]
SMARTiSM00141. PDGF. 1 hit.
[Graphical view]
SUPFAMiSSF57501. SSF57501. 1 hit.
SSF57593. SSF57593. 1 hit.
PROSITEiPS00249. PDGF_1. 1 hit.
PS50278. PDGF_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Expression of vascular endothelial growth factor during embryonic angiogenesis and endothelial cell differentiation."
    Breier G., Albrecht U., Sterrer S., Risau W.
    Development 114:521-532(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS VEGF-1; VEGF-2 AND VEGF-3).
  2. "Vascular endothelial growth factor. Regulation by cell differentiation and activated second messenger pathways."
    Claffey K.P., Wilkison W.O., Spiegelman B.M.
    J. Biol. Chem. 267:16317-16322(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM VEGF-1).
  3. "A novel alternatively spliced form of murine vascular endothelial growth factor, VEGF 115."
    Sugihara T., Wadhwa R., Kaul S.C., Mitsui Y.
    J. Biol. Chem. 273:3033-3038(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM VEGF-4).
    Strain: ICR.
  4. "Identification of a unique Mus musculus VEGF isoform of 102 amino acids."
    Jankowsky J.A., Adamski F.M., Robertson F.M.
    Submitted (MAR-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM VEGF-5).
    Strain: FVB/N.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM L-VEGF-1).
    Strain: C57BL/6.
    Tissue: Brain.
  7. "Alternatively spliced forms of mouse VEGF."
    Minchenko O.H., Minchenko D.O., Opentanova I.L.
    Submitted (SEP-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-123 (ISOFORMS VEGF-1/VEGF-2/VEGF-3).
    Strain: C57BL/6.
    Tissue: Retina.
  8. "The mouse gene for vascular endothelial growth factor. Genomic structure, definition of the transcriptional unit, and characterization of transcriptional and post-transcriptional regulatory sequences."
    Shima D.T., Kuroki M., Deutsch U., Ng Y., Adamis A.P., D'Amore P.A.
    J. Biol. Chem. 271:3877-3883(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-3 (ISOFORMS VEGF-1/VEGF-2/VEGF-3/VEGF-4/VEGF-5).
  9. "Regulation of VEGF and VEGF receptor expression in the rodent mammary gland during pregnancy, lactation, and involution."
    Pepper M.S., Baetens D., Mandriota S.J., Di Sanza C., Oikemus S., Lane T.F., Soriano J.V., Montesano R., Iruela-Arispe M.L.
    Dev. Dyn. 218:507-524(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: DEVELOPMENTAL STAGE.
  10. "The regulators of VEGF expression in mouse ovaries."
    Shin S.-Y., Lee H.-J., Ko D.-S., Lee H.-C., Park W.I.
    Yonsei Med. J. 46:679-686(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: INDUCTION.

Entry informationi

Entry nameiVEGFA_MOUSE
AccessioniPrimary (citable) accession number: Q00731
Secondary accession number(s): O70123
, Q66S31, Q6GT23, Q6WZL9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 1, 1993
Last sequence update: October 1, 1996
Last modified: June 24, 2015
This is version 156 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.