Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q00731 (VEGFA_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 145. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Vascular endothelial growth factor A

Short name=VEGF-A
Alternative name(s):
Vascular permeability factor
Short name=VPF
Gene names
Name:Vegfa
Synonyms:Vegf
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length214 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. May play a role in increasing vascular permeability during lactation, when increased transport of molecules from the blood is required for efficient milk protein synthesis By similarity.

Subunit structure

Homodimer; disulfide-linked. Also found as heterodimer with PGF By similarity.

Subcellular location

Isoform VEGF-1: Secreted.

Isoform VEGF-2: Secreted.

Isoform VEGF-3: Cell membrane; Peripheral membrane protein. Note: Remains cell-surface associated unless released by heparin.

Tissue specificity

In developing embryos, expressed mainly in the choroid plexus, paraventricular neuroepithelium, placenta and kidney glomeruli. Also found in bronchial epithelium, adrenal gland and in seminiferous tubules of testis. High expression of VEGF continues in kidney glomeruli and choroid plexus in adults.

Developmental stage

Levels increase during pregnancy (maximum 5.5-fold at 5 days) and a more marked increase occurs during lactation (maximal 9.7-fold at 7 days). Levels decrease progressively during the phase of involution. Ref.9

Induction

By IL-6 and FSH in vitro. Ref.10

Domain

Isoform VEGF-3 contains a basic insert which acts as a cell retention signal.

Sequence similarities

Belongs to the PDGF/VEGF growth factor family.

Sequence caution

The sequence AAH61468.1 differs from that shown. Reason: Erroneous initiation.

Ontologies

Keywords
   Biological processAngiogenesis
Differentiation
   Cellular componentCell membrane
Membrane
Secreted
   Coding sequence diversityAlternative initiation
Alternative promoter usage
Alternative splicing
   DomainSignal
   LigandHeparin-binding
   Molecular functionDevelopmental protein
Growth factor
Mitogen
   PTMDisulfide bond
Glycoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processVEGF-activated neuropilin signaling pathway

Inferred from mutant phenotype PubMed 21658587. Source: BHF-UCL

activation of protein kinase activity

Inferred from sequence or structural similarity. Source: UniProtKB

angiogenesis

Inferred from direct assay PubMed 10617467PubMed 12975317PubMed 14998491PubMed 17626017. Source: MGI

artery morphogenesis

Inferred from mutant phenotype PubMed 10229225. Source: MGI

blood vessel development

Inferred from mutant phenotype PubMed 15927453PubMed 16251428. Source: MGI

blood vessel morphogenesis

Inferred from direct assay PubMed 15919073. Source: MGI

branching morphogenesis of an epithelial tube

Inferred from direct assay PubMed 16375885. Source: MGI

camera-type eye morphogenesis

Inferred from mutant phenotype PubMed 16251428. Source: MGI

cardiac muscle fiber development

Inferred from mutant phenotype PubMed 10229225. Source: MGI

cardiac vascular smooth muscle cell development

Inferred from mutant phenotype PubMed 18093989. Source: BHF-UCL

cell maturation

Inferred from mutant phenotype PubMed 12053176. Source: MGI

cell migration

Inferred from direct assay PubMed 15601856. Source: MGI

cell migration involved in sprouting angiogenesis

Inferred from sequence or structural similarity. Source: UniProtKB

cell proliferation

Inferred from mutant phenotype PubMed 14722611. Source: MGI

cellular response to hypoxia

Inferred from sequence or structural similarity. Source: UniProtKB

cellular response to vascular endothelial growth factor stimulus

Inferred from sequence or structural similarity. Source: UniProtKB

commissural neuron axon guidance

Inferred from direct assay PubMed 21658587. Source: BHF-UCL

coronary artery morphogenesis

Inferred from mutant phenotype PubMed 18093989. Source: BHF-UCL

coronary vein morphogenesis

Inferred from mutant phenotype PubMed 18093989. Source: BHF-UCL

dopaminergic neuron differentiation

Inferred from genetic interaction PubMed 17215402. Source: MGI

endothelial cell chemotaxis

Inferred from sequence or structural similarity. Source: UniProtKB

epithelial cell differentiation

Inferred from mutant phenotype PubMed 16251428. Source: MGI

eye photoreceptor cell development

Inferred from mutant phenotype PubMed 16251428. Source: MGI

growth

Inferred from mutant phenotype PubMed 10229225. Source: MGI

heart morphogenesis

Inferred from mutant phenotype PubMed 10229225. Source: MGI

in utero embryonic development

Inferred from mutant phenotype PubMed 10229225. Source: MGI

kidney development

Inferred from mutant phenotype PubMed 10229225. Source: MGI

lactation

Inferred from mutant phenotype PubMed 17625068. Source: MGI

lung development

Inferred from direct assay PubMed 16375885. Source: MGI

lung vasculature development

Inferred from direct assay PubMed 11066091. Source: MGI

lymph vessel morphogenesis

Inferred from mutant phenotype PubMed 18093989. Source: BHF-UCL

macrophage differentiation

Inferred from sequence or structural similarity. Source: UniProtKB

mammary gland alveolus development

Inferred from mutant phenotype PubMed 17625068. Source: MGI

mesoderm development

Inferred from mutant phenotype PubMed 12890722. Source: MGI

monocyte differentiation

Inferred from sequence or structural similarity. Source: UniProtKB

negative regulation of apoptotic process

Inferred from sequence or structural similarity. Source: UniProtKB

negative regulation of extrinsic apoptotic signaling pathway

Inferred from direct assay PubMed 21828096. Source: BHF-UCL

negative regulation of neuron apoptotic process

Inferred from direct assay PubMed 21828096. Source: BHF-UCL

neuron development

Inferred from mutant phenotype PubMed 21828096. Source: BHF-UCL

outflow tract morphogenesis

Inferred from mutant phenotype PubMed 18093989. Source: BHF-UCL

ovarian follicle development

Inferred from mutant phenotype PubMed 17050862. Source: MGI

patterning of blood vessels

Inferred from mutant phenotype PubMed 17428830. Source: MGI

positive chemotaxis

Inferred from direct assay PubMed 21658587. Source: BHF-UCL

positive regulation of CREB transcription factor activity

Inferred from sequence or structural similarity. Source: UniProtKB

positive regulation of ERK1 and ERK2 cascade

Inferred from direct assay PubMed 21828096. Source: BHF-UCL

positive regulation of MAP kinase activity

Inferred from sequence or structural similarity. Source: UniProtKB

positive regulation of angiogenesis

Inferred from sequence or structural similarity. Source: UniProtKB

positive regulation of axon extension involved in axon guidance

Inferred from direct assay PubMed 21658587. Source: BHF-UCL

positive regulation of blood vessel endothelial cell migration

Inferred from sequence or structural similarity. Source: UniProtKB

positive regulation of branching involved in ureteric bud morphogenesis

Inferred from direct assay PubMed 16291795. Source: UniProtKB

positive regulation of cell adhesion

Inferred from sequence or structural similarity. Source: UniProtKB

positive regulation of cell division

Inferred from electronic annotation. Source: UniProtKB-KW

positive regulation of cell migration involved in sprouting angiogenesis

Inferred from sequence or structural similarity. Source: UniProtKB

positive regulation of cell proliferation

Inferred from direct assay PubMed 17475663. Source: MGI

positive regulation of cell proliferation by VEGF-activated platelet derived growth factor receptor signaling pathway

Inferred from sequence or structural similarity. Source: UniProtKB

positive regulation of cellular component movement

Inferred from sequence or structural similarity. Source: UniProtKB

positive regulation of endothelial cell chemotaxis by VEGF-activated vascular endothelial growth factor receptor signaling pathway

Inferred from sequence or structural similarity. Source: BHF-UCL

positive regulation of endothelial cell migration

Inferred from sequence or structural similarity. Source: UniProtKB

positive regulation of endothelial cell proliferation

Inferred from direct assay Ref.1Ref.3. Source: MGI

positive regulation of epithelial cell proliferation

Inferred from mutant phenotype PubMed 15927453. Source: MGI

positive regulation of focal adhesion assembly

Inferred from sequence or structural similarity. Source: UniProtKB

positive regulation of intracellular signal transduction

Inferred from sequence or structural similarity. Source: UniProtKB

positive regulation of lymphangiogenesis

Inferred from direct assay PubMed 20133819. Source: MGI

positive regulation of mesenchymal cell proliferation

Inferred from direct assay PubMed 16375885. Source: MGI

positive regulation of neuroblast proliferation

Inferred from genetic interaction PubMed 17215402. Source: MGI

positive regulation of peptidyl-serine phosphorylation

Inferred from sequence or structural similarity. Source: BHF-UCL

positive regulation of peptidyl-tyrosine autophosphorylation

Inferred from sequence or structural similarity. Source: UniProtKB

positive regulation of peptidyl-tyrosine phosphorylation

Inferred from sequence or structural similarity. Source: UniProtKB

positive regulation of positive chemotaxis

Inferred from sequence or structural similarity. Source: UniProtKB

positive regulation of protein autophosphorylation

Inferred from sequence or structural similarity. Source: UniProtKB

positive regulation of protein complex assembly

Inferred from sequence or structural similarity. Source: UniProtKB

positive regulation of protein kinase B signaling

Inferred from direct assay PubMed 21828096. Source: BHF-UCL

positive regulation of protein kinase C signaling

Inferred from sequence or structural similarity. Source: UniProtKB

positive regulation of protein phosphorylation

Inferred from sequence or structural similarity. Source: UniProtKB

positive regulation of receptor internalization

Inferred from sequence or structural similarity. Source: UniProtKB

positive regulation of retinal ganglion cell axon guidance

Inferred from mutant phenotype PubMed 21658587. Source: BHF-UCL

positive regulation of transcription from RNA polymerase II promoter

Inferred from sequence or structural similarity. Source: UniProtKB

positive regulation of vascular endothelial growth factor receptor signaling pathway

Inferred from sequence or structural similarity. Source: UniProtKB

positive regulation of vascular permeability

Inferred from direct assay PubMed 10617467. Source: MGI

post-embryonic camera-type eye development

Inferred from mutant phenotype PubMed 10229225. Source: MGI

primitive erythrocyte differentiation

Inferred from mutant phenotype PubMed 14729577. Source: MGI

regulation of cell shape

Inferred from sequence or structural similarity. Source: UniProtKB

regulation of retinal ganglion cell axon guidance

Inferred from direct assay PubMed 21658587. Source: BHF-UCL

response to hypoxia

Inferred from sequence or structural similarity. Source: UniProtKB

surfactant homeostasis

Inferred from mutant phenotype PubMed 12053176. Source: MGI

tube formation

Inferred from sequence or structural similarity. Source: UniProtKB

vascular endothelial growth factor receptor signaling pathway

Inferred from direct assay Ref.1. Source: MGI

vascular endothelial growth factor signaling pathway

Inferred from direct assay PubMed 21828096. Source: BHF-UCL

vasculature development

Inferred from mutant phenotype PubMed 10229225. Source: MGI

   Cellular_componentcell surface

Inferred from sequence or structural similarity. Source: UniProtKB

cytoplasm

Inferred from direct assay PubMed 12975317. Source: MGI

extracellular region

Inferred from direct assay PubMed 8614412Ref.3. Source: MGI

extracellular space

Inferred from direct assay PubMed 12053176Ref.1PubMed 17475663PubMed 18559975PubMed 18753609. Source: MGI

plasma membrane

Inferred from electronic annotation. Source: UniProtKB-SubCell

secretory granule

Inferred from sequence or structural similarity. Source: UniProtKB

   Molecular_functionchemoattractant activity

Inferred from direct assay PubMed 21658587. Source: BHF-UCL

cytokine activity

Inferred from sequence or structural similarity. Source: UniProtKB

extracellular matrix binding

Inferred from direct assay PubMed 17626017. Source: MGI

fibronectin binding

Inferred from sequence or structural similarity. Source: UniProtKB

growth factor activity

Inferred from sequence or structural similarity. Source: UniProtKB

heparin binding

Inferred from sequence or structural similarity. Source: UniProtKB

platelet-derived growth factor receptor binding

Inferred from sequence or structural similarity. Source: UniProtKB

protein binding

Inferred from physical interaction PubMed 10705382. Source: MGI

protein heterodimerization activity

Inferred from sequence orthology PubMed 8702615. Source: MGI

receptor agonist activity

Inferred from sequence or structural similarity. Source: UniProtKB

receptor binding

Inferred from direct assay PubMed 17626017. Source: MGI

vascular endothelial growth factor receptor 1 binding

Inferred from sequence or structural similarity. Source: UniProtKB

vascular endothelial growth factor receptor 2 binding

Inferred from sequence or structural similarity. Source: UniProtKB

vascular endothelial growth factor receptor binding

Inferred from sequence or structural similarity. Source: UniProtKB

Complete GO annotation...

Alternative products

This entry describes 6 isoforms produced by alternative promoter usage, alternative splicing and alternative initiation. [Align] [Select]
Isoform VEGF-3 (identifier: Q00731-1)

Also known as: VEGF188;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform VEGF-1 (identifier: Q00731-2)

Also known as: VEGF164;

The sequence of this isoform differs from the canonical sequence as follows:
     140-140: K → N
     141-164: Missing.
Isoform VEGF-2 (identifier: Q00731-3)

Also known as: VEGF120;

The sequence of this isoform differs from the canonical sequence as follows:
     141-208: Missing.
Isoform VEGF-4 (identifier: Q00731-4)

Also known as: VEGF115;

The sequence of this isoform differs from the canonical sequence as follows:
     105-141: IMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKK → VGTCGTGDGAGAGGGRRTVVQGGALEGCLGLCLGNFW
     142-214: Missing.
Isoform VEGF-5 (identifier: Q00731-5)

Also known as: VEGF102;

The sequence of this isoform differs from the canonical sequence as follows:
     105-128: IMRIKPHQSQHIGEMSFLQHSRCE → VGTCGTGDGAGAGGAGGQWYKEGH
     129-214: Missing.
Isoform L-VEGF-1 (identifier: Q00731-6)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTDRQTDTAP...AGPGRASETM
     140-140: K → N
     141-164: Missing.
Note: Gene prediction based on EST data. Produced by alternative promoter usage and alternative initiation. Starts at an alternative upstream CUG codon.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2626 By similarity
Chain27 – 214188Vascular endothelial growth factor A
PRO_0000023388

Amino acid modifications

Glycosylation1001N-linked (GlcNAc...) Probable
Disulfide bond51 ↔ 93 By similarity
Disulfide bond76Interchain By similarity
Disulfide bond82 ↔ 127 By similarity
Disulfide bond85Interchain By similarity
Disulfide bond86 ↔ 129 By similarity

Natural variations

Alternative sequence11M → MTDRQTDTAPSPSAHLLAGG LPTVDAAASREEPKPAPGGG VEGVGARGIARKLFVQLLGS SRSVVAVVCAAGDKPIGAGR SASSGLEKPGPEKRGEEEKE EERGPQWALGSQEPSSWTGE AAVCADSAPAARAPQAPARA SVPEGRGARQGAQESGLPRS PSRRGSASRAGPGRASETM in isoform L-VEGF-1.
VSP_038746
Alternative sequence105 – 14137IMRIK…KPEKK → VGTCGTGDGAGAGGGRRTVV QGGALEGCLGLCLGNFW in isoform VEGF-4.
VSP_016418
Alternative sequence105 – 12824IMRIK…HSRCE → VGTCGTGDGAGAGGAGGQWY KEGH in isoform VEGF-5.
VSP_016419
Alternative sequence129 – 21486Missing in isoform VEGF-5.
VSP_016420
Alternative sequence1401K → N in isoform VEGF-1 and isoform L-VEGF-1.
VSP_004626
Alternative sequence141 – 20868Missing in isoform VEGF-2.
VSP_004628
Alternative sequence141 – 16424Missing in isoform VEGF-1 and isoform L-VEGF-1.
VSP_004627
Alternative sequence142 – 21473Missing in isoform VEGF-4.
VSP_016421

Experimental info

Sequence conflict611F → I in AAC05442. Ref.3
Sequence conflict117 – 1182GE → ER in AAA40547. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform VEGF-3 (VEGF188) [UniParc].

Last modified October 1, 1996. Version 2.
Checksum: B5540B51E4BB6E17

FASTA21425,283
        10         20         30         40         50         60 
MNFLLSWVHW TLALLLYLHH AKWSQAAPTT EGEQKSHEVI KFMDVYQRSY CRPIETLVDI 

        70         80         90        100        110        120 
FQEYPDEIEY IFKPSCVPLM RCAGCCNDEA LECVPTSESN ITMQIMRIKP HQSQHIGEMS 

       130        140        150        160        170        180 
FLQHSRCECR PKKDRTKPEK KSVRGKGKGQ KRKRKKSRFK SWSVHCEPCS ERRKHLFVQD 

       190        200        210 
PQTCKCSCKN TDSRCKARQL ELNERTCRCD KPRR 

« Hide

Isoform VEGF-1 (VEGF164) [UniParc].

Checksum: 7B0BE0B9541E3805
Show »

FASTA19022,440
Isoform VEGF-2 (VEGF120) [UniParc].

Checksum: 30635EADAD328C29
Show »

FASTA14617,233
Isoform VEGF-4 (VEGF115) [UniParc].

Checksum: A9AC452E770CC338
Show »

FASTA14115,584
Isoform VEGF-5 (VEGF102) [UniParc].

Checksum: 44405AD86973E191
Show »

FASTA12814,309
Isoform L-VEGF-1 [UniParc].

Checksum: 8B8EAC32ADE8BDFD
Show »

FASTA36840,288

References

« Hide 'large scale' references
[1]"Expression of vascular endothelial growth factor during embryonic angiogenesis and endothelial cell differentiation."
Breier G., Albrecht U., Sterrer S., Risau W.
Development 114:521-532(1992) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS VEGF-1; VEGF-2 AND VEGF-3).
[2]"Vascular endothelial growth factor. Regulation by cell differentiation and activated second messenger pathways."
Claffey K.P., Wilkison W.O., Spiegelman B.M.
J. Biol. Chem. 267:16317-16322(1992) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM VEGF-1).
[3]"A novel alternatively spliced form of murine vascular endothelial growth factor, VEGF 115."
Sugihara T., Wadhwa R., Kaul S.C., Mitsui Y.
J. Biol. Chem. 273:3033-3038(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM VEGF-4).
Strain: ICR.
[4]"Identification of a unique Mus musculus VEGF isoform of 102 amino acids."
Jankowsky J.A., Adamski F.M., Robertson F.M.
Submitted (MAR-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM VEGF-5).
Strain: FVB/N.
[5]"Lineage-specific biology revealed by a finished genome assembly of the mouse."
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. expand/collapse author list , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.
PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: C57BL/6J.
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM L-VEGF-1).
Strain: C57BL/6.
Tissue: Brain.
[7]"Alternatively spliced forms of mouse VEGF."
Minchenko O.H., Minchenko D.O., Opentanova I.L.
Submitted (SEP-2004) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-123 (ISOFORMS VEGF-1/VEGF-2/VEGF-3).
Strain: C57BL/6.
Tissue: Retina.
[8]"The mouse gene for vascular endothelial growth factor. Genomic structure, definition of the transcriptional unit, and characterization of transcriptional and post-transcriptional regulatory sequences."
Shima D.T., Kuroki M., Deutsch U., Ng Y., Adamis A.P., D'Amore P.A.
J. Biol. Chem. 271:3877-3883(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-3 (ISOFORMS VEGF-1/VEGF-2/VEGF-3/VEGF-4/VEGF-5).
[9]"Regulation of VEGF and VEGF receptor expression in the rodent mammary gland during pregnancy, lactation, and involution."
Pepper M.S., Baetens D., Mandriota S.J., Di Sanza C., Oikemus S., Lane T.F., Soriano J.V., Montesano R., Iruela-Arispe M.L.
Dev. Dyn. 218:507-524(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: DEVELOPMENTAL STAGE.
[10]"The regulators of VEGF expression in mouse ovaries."
Shin S.-Y., Lee H.-J., Ko D.-S., Lee H.-C., Park W.I.
Yonsei Med. J. 46:679-686(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: INDUCTION.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
S37052 mRNA. Translation: AAB22252.1.
S38083 mRNA. Translation: AAB22253.1.
S38100 mRNA. Translation: AAB22254.1.
M95200 mRNA. Translation: AAA40547.1.
U50279 mRNA. Translation: AAC05442.1.
AY263146 mRNA. Translation: AAP86647.1.
AC127690 Genomic DNA. No translation available.
BC061468 mRNA. Translation: AAH61468.1. Different initiation.
AY707864 mRNA. Translation: AAU11325.1.
AY750956 mRNA. Translation: AAU95484.1.
AY750957 mRNA. Translation: AAU95485.1.
U41383 Genomic DNA. No translation available.
CCDSCCDS28818.2. [Q00731-6]
CCDS70817.1. [Q00731-3]
PIRA44881.
B44881.
RefSeqNP_001020421.2. NM_001025250.3.
NP_001020428.2. NM_001025257.3.
NP_001103736.1. NM_001110266.1.
NP_001103737.1. NM_001110267.1.
NP_001103738.1. NM_001110268.1.
NP_001273985.1. NM_001287056.1. [Q00731-1]
NP_001273986.1. NM_001287057.1. [Q00731-2]
NP_001273987.1. NM_001287058.1. [Q00731-3]
NP_033531.3. NM_009505.4. [Q00731-6]
UniGeneMm.282184.

3D structure databases

ProteinModelPortalQ00731.
SMRQ00731. Positions 37-134, 166-214.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid204512. 3 interactions.
DIPDIP-31909N.
IntActQ00731. 2 interactions.

PTM databases

PhosphoSiteQ00731.

Proteomic databases

PaxDbQ00731.
PRIDEQ00731.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000024747; ENSMUSP00000024747; ENSMUSG00000023951. [Q00731-3]
GeneID22339.
KEGGmmu:22339.
UCSCuc008cro.3. mouse. [Q00731-6]
uc008crr.3. mouse. [Q00731-5]
uc012aui.2. mouse. [Q00731-1]

Organism-specific databases

CTD7422.
MGIMGI:103178. Vegfa.

Phylogenomic databases

eggNOGNOG73329.
GeneTreeENSGT00730000110791.
HOGENOMHOG000230896.
HOVERGENHBG000105.
InParanoidQ00731.
KOK05448.
OrthoDBEOG74R1S0.
PhylomeDBQ00731.

Gene expression databases

ArrayExpressQ00731.
BgeeQ00731.
CleanExMM_VEGFA.
GenevestigatorQ00731.

Family and domain databases

Gene3D2.10.160.10. 1 hit.
2.10.90.10. 1 hit.
InterProIPR029034. Cystine-knot_cytokine.
IPR023581. PD_growth_factor_CS.
IPR000072. PDGF/VEGF_dom.
IPR027928. VEGF_C.
[Graphical view]
PfamPF00341. PDGF. 1 hit.
PF14554. VEGF_C. 1 hit.
[Graphical view]
SMARTSM00141. PDGF. 1 hit.
[Graphical view]
SUPFAMSSF57501. SSF57501. 1 hit.
SSF57593. SSF57593. 1 hit.
PROSITEPS00249. PDGF_1. 1 hit.
PS50278. PDGF_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSVEGFA. mouse.
NextBio302593.
PROQ00731.
SOURCESearch...

Entry information

Entry nameVEGFA_MOUSE
AccessionPrimary (citable) accession number: Q00731
Secondary accession number(s): O70123 expand/collapse secondary AC list , Q66S31, Q6GT23, Q6WZL9
Entry history
Integrated into UniProtKB/Swiss-Prot: April 1, 1993
Last sequence update: October 1, 1996
Last modified: July 9, 2014
This is version 145 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot