Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q00731

- VEGFA_MOUSE

UniProt

Q00731 - VEGFA_MOUSE

Protein

Vascular endothelial growth factor A

Gene

Vegfa

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 147 (01 Oct 2014)
      Sequence version 2 (01 Oct 1996)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. May play a role in increasing vascular permeability during lactation, when increased transport of molecules from the blood is required for efficient milk protein synthesis By similarity.By similarity

    GO - Molecular functioni

    1. chemoattractant activity Source: BHF-UCL
    2. cytokine activity Source: UniProtKB
    3. extracellular matrix binding Source: MGI
    4. fibronectin binding Source: UniProtKB
    5. growth factor activity Source: UniProtKB
    6. heparin binding Source: UniProtKB
    7. platelet-derived growth factor receptor binding Source: UniProtKB
    8. protein binding Source: MGI
    9. protein heterodimerization activity Source: MGI
    10. receptor agonist activity Source: UniProtKB
    11. receptor binding Source: MGI
    12. vascular endothelial growth factor receptor 1 binding Source: UniProtKB
    13. vascular endothelial growth factor receptor 2 binding Source: UniProtKB
    14. vascular endothelial growth factor receptor binding Source: UniProtKB

    GO - Biological processi

    1. activation of protein kinase activity Source: UniProtKB
    2. angiogenesis Source: MGI
    3. artery morphogenesis Source: MGI
    4. blood vessel development Source: MGI
    5. blood vessel morphogenesis Source: MGI
    6. branching morphogenesis of an epithelial tube Source: MGI
    7. camera-type eye morphogenesis Source: MGI
    8. cardiac muscle fiber development Source: MGI
    9. cardiac vascular smooth muscle cell development Source: BHF-UCL
    10. cell maturation Source: MGI
    11. cell migration Source: MGI
    12. cell migration involved in sprouting angiogenesis Source: UniProtKB
    13. cell proliferation Source: MGI
    14. cellular response to hypoxia Source: UniProtKB
    15. cellular response to vascular endothelial growth factor stimulus Source: UniProtKB
    16. commissural neuron axon guidance Source: BHF-UCL
    17. coronary artery morphogenesis Source: BHF-UCL
    18. coronary vein morphogenesis Source: BHF-UCL
    19. dopaminergic neuron differentiation Source: MGI
    20. endothelial cell chemotaxis Source: UniProtKB
    21. epithelial cell differentiation Source: MGI
    22. eye photoreceptor cell development Source: MGI
    23. growth Source: MGI
    24. heart morphogenesis Source: MGI
    25. in utero embryonic development Source: MGI
    26. kidney development Source: MGI
    27. lactation Source: MGI
    28. lung development Source: MGI
    29. lung vasculature development Source: MGI
    30. lymph vessel morphogenesis Source: BHF-UCL
    31. macrophage differentiation Source: UniProtKB
    32. mammary gland alveolus development Source: MGI
    33. mesoderm development Source: MGI
    34. monocyte differentiation Source: UniProtKB
    35. negative regulation of apoptotic process Source: UniProtKB
    36. negative regulation of extrinsic apoptotic signaling pathway Source: BHF-UCL
    37. negative regulation of neuron apoptotic process Source: BHF-UCL
    38. neuron development Source: BHF-UCL
    39. outflow tract morphogenesis Source: BHF-UCL
    40. ovarian follicle development Source: MGI
    41. patterning of blood vessels Source: MGI
    42. positive chemotaxis Source: BHF-UCL
    43. positive regulation of angiogenesis Source: UniProtKB
    44. positive regulation of axon extension involved in axon guidance Source: BHF-UCL
    45. positive regulation of blood vessel endothelial cell migration Source: UniProtKB
    46. positive regulation of branching involved in ureteric bud morphogenesis Source: UniProtKB
    47. positive regulation of cell adhesion Source: UniProtKB
    48. positive regulation of cell division Source: UniProtKB-KW
    49. positive regulation of cell migration involved in sprouting angiogenesis Source: UniProtKB
    50. positive regulation of cell proliferation Source: MGI
    51. positive regulation of cell proliferation by VEGF-activated platelet derived growth factor receptor signaling pathway Source: UniProtKB
    52. positive regulation of cellular component movement Source: UniProtKB
    53. positive regulation of CREB transcription factor activity Source: UniProtKB
    54. positive regulation of endothelial cell chemotaxis by VEGF-activated vascular endothelial growth factor receptor signaling pathway Source: BHF-UCL
    55. positive regulation of endothelial cell migration Source: UniProtKB
    56. positive regulation of endothelial cell proliferation Source: MGI
    57. positive regulation of epithelial cell proliferation Source: MGI
    58. positive regulation of ERK1 and ERK2 cascade Source: BHF-UCL
    59. positive regulation of focal adhesion assembly Source: UniProtKB
    60. positive regulation of intracellular signal transduction Source: UniProtKB
    61. positive regulation of lymphangiogenesis Source: MGI
    62. positive regulation of MAP kinase activity Source: UniProtKB
    63. positive regulation of mesenchymal cell proliferation Source: MGI
    64. positive regulation of neuroblast proliferation Source: MGI
    65. positive regulation of peptidyl-serine phosphorylation Source: BHF-UCL
    66. positive regulation of peptidyl-tyrosine autophosphorylation Source: UniProtKB
    67. positive regulation of peptidyl-tyrosine phosphorylation Source: UniProtKB
    68. positive regulation of positive chemotaxis Source: UniProtKB
    69. positive regulation of protein autophosphorylation Source: UniProtKB
    70. positive regulation of protein complex assembly Source: UniProtKB
    71. positive regulation of protein kinase B signaling Source: BHF-UCL
    72. positive regulation of protein kinase C signaling Source: UniProtKB
    73. positive regulation of protein phosphorylation Source: UniProtKB
    74. positive regulation of receptor internalization Source: UniProtKB
    75. positive regulation of retinal ganglion cell axon guidance Source: BHF-UCL
    76. positive regulation of transcription from RNA polymerase II promoter Source: UniProtKB
    77. positive regulation of vascular endothelial growth factor receptor signaling pathway Source: UniProtKB
    78. positive regulation of vascular permeability Source: MGI
    79. post-embryonic camera-type eye development Source: MGI
    80. primitive erythrocyte differentiation Source: MGI
    81. regulation of cell shape Source: UniProtKB
    82. regulation of retinal ganglion cell axon guidance Source: BHF-UCL
    83. response to hypoxia Source: UniProtKB
    84. sprouting angiogenesis Source: BHF-UCL
    85. surfactant homeostasis Source: MGI
    86. tube formation Source: UniProtKB
    87. vascular endothelial growth factor receptor signaling pathway Source: MGI
    88. vascular endothelial growth factor signaling pathway Source: BHF-UCL
    89. vasculature development Source: MGI
    90. VEGF-activated neuropilin signaling pathway Source: BHF-UCL

    Keywords - Molecular functioni

    Developmental protein, Growth factor, Mitogen

    Keywords - Biological processi

    Angiogenesis, Differentiation

    Keywords - Ligandi

    Heparin-binding

    Enzyme and pathway databases

    ReactomeiREACT_199107. Regulation of gene expression by Hypoxia-inducible Factor.
    REACT_205099. VEGF binds to VEGFR leading to receptor dimerization.
    REACT_224551. VEGF ligand-receptor interactions.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Vascular endothelial growth factor A
    Short name:
    VEGF-A
    Alternative name(s):
    Vascular permeability factor
    Short name:
    VPF
    Gene namesi
    Name:Vegfa
    Synonyms:Vegf
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 17

    Organism-specific databases

    MGIiMGI:103178. Vegfa.

    Subcellular locationi

    Isoform VEGF-3 : Cell membrane; Peripheral membrane protein
    Note: Remains cell-surface associated unless released by heparin.

    GO - Cellular componenti

    1. cell surface Source: UniProtKB
    2. cytoplasm Source: MGI
    3. extracellular region Source: MGI
    4. extracellular space Source: MGI
    5. plasma membrane Source: UniProtKB-SubCell
    6. secretory granule Source: UniProtKB

    Keywords - Cellular componenti

    Cell membrane, Membrane, Secreted

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2626By similarityAdd
    BLAST
    Chaini27 – 214188Vascular endothelial growth factor APRO_0000023388Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi51 ↔ 93By similarity
    Disulfide bondi76 – 76InterchainBy similarity
    Disulfide bondi82 ↔ 127By similarity
    Disulfide bondi85 – 85InterchainBy similarity
    Disulfide bondi86 ↔ 129By similarity
    Glycosylationi100 – 1001N-linked (GlcNAc...)Curated

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiQ00731.
    PRIDEiQ00731.

    PTM databases

    PhosphoSiteiQ00731.

    Expressioni

    Tissue specificityi

    In developing embryos, expressed mainly in the choroid plexus, paraventricular neuroepithelium, placenta and kidney glomeruli. Also found in bronchial epithelium, adrenal gland and in seminiferous tubules of testis. High expression of VEGF continues in kidney glomeruli and choroid plexus in adults.

    Developmental stagei

    Levels increase during pregnancy (maximum 5.5-fold at 5 days) and a more marked increase occurs during lactation (maximal 9.7-fold at 7 days). Levels decrease progressively during the phase of involution.1 Publication

    Inductioni

    By IL-6 and FSH in vitro.1 Publication

    Gene expression databases

    ArrayExpressiQ00731.
    BgeeiQ00731.
    CleanExiMM_VEGFA.
    GenevestigatoriQ00731.

    Interactioni

    Subunit structurei

    Homodimer; disulfide-linked. Also found as heterodimer with PGF By similarity.By similarity

    Protein-protein interaction databases

    BioGridi204512. 3 interactions.
    DIPiDIP-31909N.
    IntActiQ00731. 2 interactions.

    Structurei

    3D structure databases

    ProteinModelPortaliQ00731.
    SMRiQ00731. Positions 37-134, 166-214.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domaini

    Isoform VEGF-3 contains a basic insert which acts as a cell retention signal.

    Sequence similaritiesi

    Belongs to the PDGF/VEGF growth factor family.Curated

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiNOG73329.
    GeneTreeiENSGT00730000110791.
    HOGENOMiHOG000230896.
    HOVERGENiHBG000105.
    InParanoidiQ00731.
    KOiK05448.
    OrthoDBiEOG74R1S0.
    PhylomeDBiQ00731.

    Family and domain databases

    Gene3Di2.10.160.10. 1 hit.
    2.10.90.10. 1 hit.
    InterProiIPR029034. Cystine-knot_cytokine.
    IPR023581. PD_growth_factor_CS.
    IPR000072. PDGF/VEGF_dom.
    IPR027928. VEGF_C.
    [Graphical view]
    PfamiPF00341. PDGF. 1 hit.
    PF14554. VEGF_C. 1 hit.
    [Graphical view]
    SMARTiSM00141. PDGF. 1 hit.
    [Graphical view]
    SUPFAMiSSF57501. SSF57501. 1 hit.
    SSF57593. SSF57593. 1 hit.
    PROSITEiPS00249. PDGF_1. 1 hit.
    PS50278. PDGF_2. 1 hit.
    [Graphical view]

    Sequences (6)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 6 isoformsi produced by alternative promoter usage, alternative splicing and alternative initiation. Align

    Isoform VEGF-3 (identifier: Q00731-1) [UniParc]FASTAAdd to Basket

    Also known as: VEGF188

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MNFLLSWVHW TLALLLYLHH AKWSQAAPTT EGEQKSHEVI KFMDVYQRSY    50
    CRPIETLVDI FQEYPDEIEY IFKPSCVPLM RCAGCCNDEA LECVPTSESN 100
    ITMQIMRIKP HQSQHIGEMS FLQHSRCECR PKKDRTKPEK KSVRGKGKGQ 150
    KRKRKKSRFK SWSVHCEPCS ERRKHLFVQD PQTCKCSCKN TDSRCKARQL 200
    ELNERTCRCD KPRR 214
    Length:214
    Mass (Da):25,283
    Last modified:October 1, 1996 - v2
    Checksum:iB5540B51E4BB6E17
    GO
    Isoform VEGF-1 (identifier: Q00731-2) [UniParc]FASTAAdd to Basket

    Also known as: VEGF164

    The sequence of this isoform differs from the canonical sequence as follows:
         140-140: K → N
         141-164: Missing.

    Show »
    Length:190
    Mass (Da):22,440
    Checksum:i7B0BE0B9541E3805
    GO
    Isoform VEGF-2 (identifier: Q00731-3) [UniParc]FASTAAdd to Basket

    Also known as: VEGF120

    The sequence of this isoform differs from the canonical sequence as follows:
         141-208: Missing.

    Show »
    Length:146
    Mass (Da):17,233
    Checksum:i30635EADAD328C29
    GO
    Isoform VEGF-4 (identifier: Q00731-4) [UniParc]FASTAAdd to Basket

    Also known as: VEGF115

    The sequence of this isoform differs from the canonical sequence as follows:
         105-141: IMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKK → VGTCGTGDGAGAGGGRRTVVQGGALEGCLGLCLGNFW
         142-214: Missing.

    Show »
    Length:141
    Mass (Da):15,584
    Checksum:iA9AC452E770CC338
    GO
    Isoform VEGF-5 (identifier: Q00731-5) [UniParc]FASTAAdd to Basket

    Also known as: VEGF102

    The sequence of this isoform differs from the canonical sequence as follows:
         105-128: IMRIKPHQSQHIGEMSFLQHSRCE → VGTCGTGDGAGAGGAGGQWYKEGH
         129-214: Missing.

    Show »
    Length:128
    Mass (Da):14,309
    Checksum:i44405AD86973E191
    GO
    Isoform L-VEGF-1 (identifier: Q00731-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MTDRQTDTAP...AGPGRASETM
         140-140: K → N
         141-164: Missing.

    Note: Gene prediction based on EST data. Produced by alternative promoter usage and alternative initiation. Starts at an alternative upstream CUG codon.

    Show »
    Length:368
    Mass (Da):40,288
    Checksum:i8B8EAC32ADE8BDFD
    GO

    Sequence cautioni

    The sequence AAH61468.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti61 – 611F → I in AAC05442. (PubMed:9446618)Curated
    Sequence conflicti117 – 1182GE → ER in AAA40547. (PubMed:1644816)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MTDRQTDTAPSPSAHLLAGG LPTVDAAASREEPKPAPGGG VEGVGARGIARKLFVQLLGS SRSVVAVVCAAGDKPIGAGR SASSGLEKPGPEKRGEEEKE EERGPQWALGSQEPSSWTGE AAVCADSAPAARAPQAPARA SVPEGRGARQGAQESGLPRS PSRRGSASRAGPGRASETM in isoform L-VEGF-1. CuratedVSP_038746
    Alternative sequencei105 – 14137IMRIK…KPEKK → VGTCGTGDGAGAGGGRRTVV QGGALEGCLGLCLGNFW in isoform VEGF-4. 1 PublicationVSP_016418Add
    BLAST
    Alternative sequencei105 – 12824IMRIK…HSRCE → VGTCGTGDGAGAGGAGGQWY KEGH in isoform VEGF-5. 1 PublicationVSP_016419Add
    BLAST
    Alternative sequencei129 – 21486Missing in isoform VEGF-5. 1 PublicationVSP_016420Add
    BLAST
    Alternative sequencei140 – 1401K → N in isoform VEGF-1 and isoform L-VEGF-1. 2 PublicationsVSP_004626
    Alternative sequencei141 – 20868Missing in isoform VEGF-2. 1 PublicationVSP_004628Add
    BLAST
    Alternative sequencei141 – 16424Missing in isoform VEGF-1 and isoform L-VEGF-1. 2 PublicationsVSP_004627Add
    BLAST
    Alternative sequencei142 – 21473Missing in isoform VEGF-4. 1 PublicationVSP_016421Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    S37052 mRNA. Translation: AAB22252.1.
    S38083 mRNA. Translation: AAB22253.1.
    S38100 mRNA. Translation: AAB22254.1.
    M95200 mRNA. Translation: AAA40547.1.
    U50279 mRNA. Translation: AAC05442.1.
    AY263146 mRNA. Translation: AAP86647.1.
    AC127690 Genomic DNA. No translation available.
    BC061468 mRNA. Translation: AAH61468.1. Different initiation.
    AY707864 mRNA. Translation: AAU11325.1.
    AY750956 mRNA. Translation: AAU95484.1.
    AY750957 mRNA. Translation: AAU95485.1.
    U41383 Genomic DNA. No translation available.
    CCDSiCCDS28818.2. [Q00731-6]
    CCDS70817.1. [Q00731-3]
    PIRiA44881.
    B44881.
    RefSeqiNP_001020421.2. NM_001025250.3.
    NP_001020428.2. NM_001025257.3.
    NP_001103736.1. NM_001110266.1.
    NP_001103737.1. NM_001110267.1.
    NP_001103738.1. NM_001110268.1.
    NP_001273985.1. NM_001287056.1. [Q00731-1]
    NP_001273986.1. NM_001287057.1. [Q00731-2]
    NP_001273987.1. NM_001287058.1. [Q00731-3]
    NP_033531.3. NM_009505.4. [Q00731-6]
    UniGeneiMm.282184.

    Genome annotation databases

    EnsembliENSMUST00000024747; ENSMUSP00000024747; ENSMUSG00000023951. [Q00731-3]
    GeneIDi22339.
    KEGGimmu:22339.
    UCSCiuc008cro.3. mouse. [Q00731-6]
    uc008crr.3. mouse. [Q00731-5]
    uc012aui.2. mouse. [Q00731-1]

    Keywords - Coding sequence diversityi

    Alternative initiation, Alternative promoter usage, Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    S37052 mRNA. Translation: AAB22252.1 .
    S38083 mRNA. Translation: AAB22253.1 .
    S38100 mRNA. Translation: AAB22254.1 .
    M95200 mRNA. Translation: AAA40547.1 .
    U50279 mRNA. Translation: AAC05442.1 .
    AY263146 mRNA. Translation: AAP86647.1 .
    AC127690 Genomic DNA. No translation available.
    BC061468 mRNA. Translation: AAH61468.1 . Different initiation.
    AY707864 mRNA. Translation: AAU11325.1 .
    AY750956 mRNA. Translation: AAU95484.1 .
    AY750957 mRNA. Translation: AAU95485.1 .
    U41383 Genomic DNA. No translation available.
    CCDSi CCDS28818.2. [Q00731-6 ]
    CCDS70817.1. [Q00731-3 ]
    PIRi A44881.
    B44881.
    RefSeqi NP_001020421.2. NM_001025250.3.
    NP_001020428.2. NM_001025257.3.
    NP_001103736.1. NM_001110266.1.
    NP_001103737.1. NM_001110267.1.
    NP_001103738.1. NM_001110268.1.
    NP_001273985.1. NM_001287056.1. [Q00731-1 ]
    NP_001273986.1. NM_001287057.1. [Q00731-2 ]
    NP_001273987.1. NM_001287058.1. [Q00731-3 ]
    NP_033531.3. NM_009505.4. [Q00731-6 ]
    UniGenei Mm.282184.

    3D structure databases

    ProteinModelPortali Q00731.
    SMRi Q00731. Positions 37-134, 166-214.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 204512. 3 interactions.
    DIPi DIP-31909N.
    IntActi Q00731. 2 interactions.

    PTM databases

    PhosphoSitei Q00731.

    Proteomic databases

    PaxDbi Q00731.
    PRIDEi Q00731.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000024747 ; ENSMUSP00000024747 ; ENSMUSG00000023951 . [Q00731-3 ]
    GeneIDi 22339.
    KEGGi mmu:22339.
    UCSCi uc008cro.3. mouse. [Q00731-6 ]
    uc008crr.3. mouse. [Q00731-5 ]
    uc012aui.2. mouse. [Q00731-1 ]

    Organism-specific databases

    CTDi 7422.
    MGIi MGI:103178. Vegfa.

    Phylogenomic databases

    eggNOGi NOG73329.
    GeneTreei ENSGT00730000110791.
    HOGENOMi HOG000230896.
    HOVERGENi HBG000105.
    InParanoidi Q00731.
    KOi K05448.
    OrthoDBi EOG74R1S0.
    PhylomeDBi Q00731.

    Enzyme and pathway databases

    Reactomei REACT_199107. Regulation of gene expression by Hypoxia-inducible Factor.
    REACT_205099. VEGF binds to VEGFR leading to receptor dimerization.
    REACT_224551. VEGF ligand-receptor interactions.

    Miscellaneous databases

    ChiTaRSi VEGFA. mouse.
    NextBioi 302593.
    PROi Q00731.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q00731.
    Bgeei Q00731.
    CleanExi MM_VEGFA.
    Genevestigatori Q00731.

    Family and domain databases

    Gene3Di 2.10.160.10. 1 hit.
    2.10.90.10. 1 hit.
    InterProi IPR029034. Cystine-knot_cytokine.
    IPR023581. PD_growth_factor_CS.
    IPR000072. PDGF/VEGF_dom.
    IPR027928. VEGF_C.
    [Graphical view ]
    Pfami PF00341. PDGF. 1 hit.
    PF14554. VEGF_C. 1 hit.
    [Graphical view ]
    SMARTi SM00141. PDGF. 1 hit.
    [Graphical view ]
    SUPFAMi SSF57501. SSF57501. 1 hit.
    SSF57593. SSF57593. 1 hit.
    PROSITEi PS00249. PDGF_1. 1 hit.
    PS50278. PDGF_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Expression of vascular endothelial growth factor during embryonic angiogenesis and endothelial cell differentiation."
      Breier G., Albrecht U., Sterrer S., Risau W.
      Development 114:521-532(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS VEGF-1; VEGF-2 AND VEGF-3).
    2. "Vascular endothelial growth factor. Regulation by cell differentiation and activated second messenger pathways."
      Claffey K.P., Wilkison W.O., Spiegelman B.M.
      J. Biol. Chem. 267:16317-16322(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM VEGF-1).
    3. "A novel alternatively spliced form of murine vascular endothelial growth factor, VEGF 115."
      Sugihara T., Wadhwa R., Kaul S.C., Mitsui Y.
      J. Biol. Chem. 273:3033-3038(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM VEGF-4).
      Strain: ICR.
    4. "Identification of a unique Mus musculus VEGF isoform of 102 amino acids."
      Jankowsky J.A., Adamski F.M., Robertson F.M.
      Submitted (MAR-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM VEGF-5).
      Strain: FVB/N.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM L-VEGF-1).
      Strain: C57BL/6.
      Tissue: Brain.
    7. "Alternatively spliced forms of mouse VEGF."
      Minchenko O.H., Minchenko D.O., Opentanova I.L.
      Submitted (SEP-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-123 (ISOFORMS VEGF-1/VEGF-2/VEGF-3).
      Strain: C57BL/6.
      Tissue: Retina.
    8. "The mouse gene for vascular endothelial growth factor. Genomic structure, definition of the transcriptional unit, and characterization of transcriptional and post-transcriptional regulatory sequences."
      Shima D.T., Kuroki M., Deutsch U., Ng Y., Adamis A.P., D'Amore P.A.
      J. Biol. Chem. 271:3877-3883(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-3 (ISOFORMS VEGF-1/VEGF-2/VEGF-3/VEGF-4/VEGF-5).
    9. "Regulation of VEGF and VEGF receptor expression in the rodent mammary gland during pregnancy, lactation, and involution."
      Pepper M.S., Baetens D., Mandriota S.J., Di Sanza C., Oikemus S., Lane T.F., Soriano J.V., Montesano R., Iruela-Arispe M.L.
      Dev. Dyn. 218:507-524(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: DEVELOPMENTAL STAGE.
    10. "The regulators of VEGF expression in mouse ovaries."
      Shin S.-Y., Lee H.-J., Ko D.-S., Lee H.-C., Park W.I.
      Yonsei Med. J. 46:679-686(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: INDUCTION.

    Entry informationi

    Entry nameiVEGFA_MOUSE
    AccessioniPrimary (citable) accession number: Q00731
    Secondary accession number(s): O70123
    , Q66S31, Q6GT23, Q6WZL9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 1, 1993
    Last sequence update: October 1, 1996
    Last modified: October 1, 2014
    This is version 147 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3