Q00731 (VEGFA_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 133.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Vascular endothelial growth factor A Short name=VEGF-A Alternative name(s): Vascular permeability factor Short name=VPF | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 214 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. May play a role in increasing vascular permeability during lactation, when increased transport of molecules from the blood is required for efficient milk protein synthesis By similarity. |
| Subunit structure | Homodimer; disulfide-linked. Also found as heterodimer with PGF By similarity. |
| Subcellular location | Isoform VEGF-3: Cell membrane; Peripheral membrane protein. Note: Remains cell-surface associated unless released by heparin. |
| Tissue specificity | In developing embryos, expressed mainly in the choroid plexus, paraventricular neuroepithelium, placenta and kidney glomeruli. Also found in bronchial epithelium, adrenal gland and in seminiferous tubules of testis. High expression of VEGF continues in kidney glomeruli and choroid plexus in adults. |
| Developmental stage | Levels increase during pregnancy (maximum 5.5-fold at 5 days) and a more marked increase occurs during lactation (maximal 9.7-fold at 7 days). Levels decrease progressively during the phase of involution. Ref.9 |
| Induction | By IL-6 and FSH in vitro. Ref.10 |
| Domain | Isoform VEGF-3 contains a basic insert which acts as a cell retention signal. |
| Sequence similarities | Belongs to the PDGF/VEGF growth factor family. |
| Sequence caution | The sequence AAH61468.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Alternative products
| This entry describes 6 isoforms produced by alternative promoter usage, alternative splicing and alternative initiation. [Align] [Select] | ||||||
| Isoform VEGF-3 (identifier: Q00731-1) Also known as: VEGF188; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform VEGF-1 (identifier: Q00731-2) Also known as: VEGF164; The sequence of this isoform differs from the canonical sequence as follows: 140-140: K → N 141-164: Missing. | ||||||
| Isoform VEGF-2 (identifier: Q00731-3) Also known as: VEGF120; The sequence of this isoform differs from the canonical sequence as follows: 141-208: Missing. | ||||||
| Isoform VEGF-4 (identifier: Q00731-4) Also known as: VEGF115; The sequence of this isoform differs from the canonical sequence as follows: 105-141: IMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKK → VGTCGTGDGAGAGGGRRTVVQGGALEGCLGLCLGNFW 142-214: Missing. | ||||||
| Isoform VEGF-5 (identifier: Q00731-5) Also known as: VEGF102; The sequence of this isoform differs from the canonical sequence as follows: 105-128: IMRIKPHQSQHIGEMSFLQHSRCE → VGTCGTGDGAGAGGAGGQWYKEGH 129-214: Missing. | ||||||
| Isoform L-VEGF-1 (identifier: Q00731-6) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MTDRQTDTAP...AGPGRASETM 140-140: K → N 141-164: Missing. | ||||||
| Note: Gene prediction based on EST data. Produced by alternative promoter usage and alternative initiation. Starts at an alternative upstream CUG codon. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 26 | 26 | By similarity | ||||||||
| Chain | 27 – 214 | 188 | Vascular endothelial growth factor A | PRO_0000023388 | |||||||
Amino acid modifications | |||||||||||
| Glycosylation | 100 | 1 | N-linked (GlcNAc...) Probable | ||||||||
| Disulfide bond | 51 ↔ 93 | By similarity | |||||||||
| Disulfide bond | 76 | Interchain By similarity | |||||||||
| Disulfide bond | 82 ↔ 127 | By similarity | |||||||||
| Disulfide bond | 85 | Interchain By similarity | |||||||||
| Disulfide bond | 86 ↔ 129 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 | 1 | M → MTDRQTDTAPSPSAHLLAGG LPTVDAAASREEPKPAPGGG VEGVGARGIARKLFVQLLGS SRSVVAVVCAAGDKPIGAGR SASSGLEKPGPEKRGEEEKE EERGPQWALGSQEPSSWTGE AAVCADSAPAARAPQAPARA SVPEGRGARQGAQESGLPRS PSRRGSASRAGPGRASETM in isoform L-VEGF-1. | VSP_038746 | |||||||
| Alternative sequence | 105 – 141 | 37 | IMRIK…KPEKK → VGTCGTGDGAGAGGGRRTVV QGGALEGCLGLCLGNFW in isoform VEGF-4. | VSP_016418 | |||||||
| Alternative sequence | 105 – 128 | 24 | IMRIK…HSRCE → VGTCGTGDGAGAGGAGGQWY KEGH in isoform VEGF-5. | VSP_016419 | |||||||
| Alternative sequence | 129 – 214 | 86 | Missing in isoform VEGF-5. | VSP_016420 | |||||||
| Alternative sequence | 140 | 1 | K → N in isoform VEGF-1 and isoform L-VEGF-1. | VSP_004626 | |||||||
| Alternative sequence | 141 – 208 | 68 | Missing in isoform VEGF-2. | VSP_004628 | |||||||
| Alternative sequence | 141 – 164 | 24 | Missing in isoform VEGF-1 and isoform L-VEGF-1. | VSP_004627 | |||||||
| Alternative sequence | 142 – 214 | 73 | Missing in isoform VEGF-4. | VSP_016421 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 61 | 1 | F → I in AAC05442. Ref.3 | ||||||||
| Sequence conflict | 117 – 118 | 2 | GE → ER in AAA40547. Ref.2 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Expression of vascular endothelial growth factor during embryonic angiogenesis and endothelial cell differentiation." Breier G., Albrecht U., Sterrer S., Risau W. Development 114:521-532(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS VEGF-1; VEGF-2 AND VEGF-3). |
| [2] | "Vascular endothelial growth factor. Regulation by cell differentiation and activated second messenger pathways." Claffey K.P., Wilkison W.O., Spiegelman B.M. J. Biol. Chem. 267:16317-16322(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM VEGF-1). |
| [3] | "A novel alternatively spliced form of murine vascular endothelial growth factor, VEGF 115." Sugihara T., Wadhwa R., Kaul S.C., Mitsui Y. J. Biol. Chem. 273:3033-3038(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM VEGF-4). Strain: ICR. |
| [4] | "Identification of a unique Mus musculus VEGF isoform of 102 amino acids." Jankowsky J.A., Adamski F.M., Robertson F.M. Submitted (MAR-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM VEGF-5). Strain: FVB/N. |
| [5] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM L-VEGF-1). Strain: C57BL/6. Tissue: Brain. |
| [7] | "Alternatively spliced forms of mouse VEGF." Minchenko O.H., Minchenko D.O., Opentanova I.L. Submitted (SEP-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-123 (ISOFORMS VEGF-1/VEGF-2/VEGF-3). Strain: C57BL/6. Tissue: Retina. |
| [8] | "The mouse gene for vascular endothelial growth factor. Genomic structure, definition of the transcriptional unit, and characterization of transcriptional and post-transcriptional regulatory sequences." Shima D.T., Kuroki M., Deutsch U., Ng Y., Adamis A.P., D'Amore P.A. J. Biol. Chem. 271:3877-3883(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-3 (ISOFORMS VEGF-1/VEGF-2/VEGF-3/VEGF-4/VEGF-5). |
| [9] | "Regulation of VEGF and VEGF receptor expression in the rodent mammary gland during pregnancy, lactation, and involution." Pepper M.S., Baetens D., Mandriota S.J., Di Sanza C., Oikemus S., Lane T.F., Soriano J.V., Montesano R., Iruela-Arispe M.L. Dev. Dyn. 218:507-524(2000) [PubMed] [Europe PMC] [Abstract] Cited for: DEVELOPMENTAL STAGE. |
| [10] | "The regulators of VEGF expression in mouse ovaries." Shin S.-Y., Lee H.-J., Ko D.-S., Lee H.-C., Park W.I. Yonsei Med. J. 46:679-686(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INDUCTION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | S37052 mRNA. Translation: AAB22252.1. S38083 mRNA. Translation: AAB22253.1. S38100 mRNA. Translation: AAB22254.1. M95200 mRNA. Translation: AAA40547.1. U50279 mRNA. Translation: AAC05442.1. AY263146 mRNA. Translation: AAP86647.1. AC127690 Genomic DNA. No translation available. BC061468 mRNA. Translation: AAH61468.1. Different initiation. AY707864 mRNA. Translation: AAU11325.1. AY750956 mRNA. Translation: AAU95484.1. AY750957 mRNA. Translation: AAU95485.1. U41383 Genomic DNA. No translation available. |
| IPI | IPI00402915. IPI00475372. IPI00656297. IPI00955379. IPI00989242. IPI00989633. |
| PIR | A44881. B44881. |
| RefSeq | NP_001020421.2. NM_001025250.3. NP_001020428.2. NM_001025257.3. NP_001103736.1. NM_001110266.1. NP_001103737.1. NM_001110267.1. NP_001103738.1. NM_001110268.1. NP_033531.3. NM_009505.4. |
| UniGene | Mm.282184. |
3D structure databases | |
| ProteinModelPortal | Q00731. |
| SMR | Q00731. Positions 37-134, 166-214. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q00731. 2 interactions. |
PTM databases | |
| PhosphoSite | Q00731. |
Proteomic databases | |
| PaxDb | Q00731. |
| PRIDE | Q00731. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000024747; ENSMUSP00000024747; ENSMUSG00000023951. |
| GeneID | 22339. |
| KEGG | mmu:22339. |
| UCSC | uc008cro.3. mouse. uc008crr.3. mouse. uc012aui.2. mouse. |
Organism-specific databases | |
| CTD | 7422. |
| MGI | MGI:103178. Vegfa. |
Phylogenomic databases | |
| eggNOG | NOG73329. |
| GeneTree | ENSGT00530000062930. |
| HOGENOM | HOG000230896. |
| HOVERGEN | HBG000105. |
| InParanoid | Q00731. |
| KO | K05448. |
| OrthoDB | EOG45757X. |
Gene expression databases | |
| ArrayExpress | Q00731. |
| Bgee | Q00731. |
| CleanEx | MM_VEGFA. |
| Genevestigator | Q00731. |
| GermOnline | ENSMUSG00000023951. Mus musculus. |
Family and domain databases | |
| InterPro | IPR000072. PD_growth_factor. IPR023581. PD_growth_factor_CS. [Graphical view] |
| Pfam | PF00341. PDGF. 1 hit. [Graphical view] |
| SMART | SM00141. PDGF. 1 hit. [Graphical view] |
| PROSITE | PS00249. PDGF_1. 1 hit. PS50278. PDGF_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | VEGFA. mouse. |
| NextBio | 302593. |
| SOURCE | Search... |
Entry information
| Entry name | VEGFA_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q00731 Secondary accession number(s): O70123 Q6WZL9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
