Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q00731

- VEGFA_MOUSE

UniProt

Q00731 - VEGFA_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Vascular endothelial growth factor A

Gene

Vegfa

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli

Functioni

Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. May play a role in increasing vascular permeability during lactation, when increased transport of molecules from the blood is required for efficient milk protein synthesis (By similarity).By similarity

GO - Molecular functioni

  1. chemoattractant activity Source: BHF-UCL
  2. cytokine activity Source: UniProtKB
  3. extracellular matrix binding Source: MGI
  4. fibronectin binding Source: UniProtKB
  5. growth factor activity Source: UniProtKB
  6. heparin binding Source: UniProtKB
  7. platelet-derived growth factor receptor binding Source: UniProtKB
  8. protein heterodimerization activity Source: MGI
  9. receptor agonist activity Source: UniProtKB
  10. receptor binding Source: MGI
  11. vascular endothelial growth factor receptor 1 binding Source: UniProtKB
  12. vascular endothelial growth factor receptor 2 binding Source: UniProtKB
  13. vascular endothelial growth factor receptor binding Source: UniProtKB

GO - Biological processi

  1. activation of protein kinase activity Source: UniProtKB
  2. angiogenesis Source: MGI
  3. artery morphogenesis Source: MGI
  4. blood vessel development Source: MGI
  5. blood vessel morphogenesis Source: MGI
  6. branching morphogenesis of an epithelial tube Source: MGI
  7. camera-type eye morphogenesis Source: MGI
  8. cardiac muscle fiber development Source: MGI
  9. cardiac vascular smooth muscle cell development Source: BHF-UCL
  10. cell maturation Source: MGI
  11. cell migration Source: MGI
  12. cell migration involved in sprouting angiogenesis Source: UniProtKB
  13. cell proliferation Source: MGI
  14. cellular response to hypoxia Source: UniProtKB
  15. cellular response to vascular endothelial growth factor stimulus Source: UniProtKB
  16. commissural neuron axon guidance Source: BHF-UCL
  17. coronary artery morphogenesis Source: BHF-UCL
  18. coronary vein morphogenesis Source: BHF-UCL
  19. dopaminergic neuron differentiation Source: MGI
  20. endothelial cell chemotaxis Source: UniProtKB
  21. epithelial cell differentiation Source: MGI
  22. eye photoreceptor cell development Source: MGI
  23. growth Source: MGI
  24. heart morphogenesis Source: MGI
  25. in utero embryonic development Source: MGI
  26. kidney development Source: MGI
  27. lactation Source: MGI
  28. lung development Source: MGI
  29. lung vasculature development Source: MGI
  30. lymph vessel morphogenesis Source: BHF-UCL
  31. macrophage differentiation Source: UniProtKB
  32. mammary gland alveolus development Source: MGI
  33. mesoderm development Source: MGI
  34. monocyte differentiation Source: UniProtKB
  35. negative regulation of apoptotic process Source: UniProtKB
  36. negative regulation of cell-cell adhesion Source: MGI
  37. negative regulation of extrinsic apoptotic signaling pathway Source: BHF-UCL
  38. negative regulation of neuron apoptotic process Source: BHF-UCL
  39. neuron development Source: BHF-UCL
  40. outflow tract morphogenesis Source: BHF-UCL
  41. ovarian follicle development Source: MGI
  42. patterning of blood vessels Source: MGI
  43. positive chemotaxis Source: BHF-UCL
  44. positive regulation of angiogenesis Source: UniProtKB
  45. positive regulation of axon extension involved in axon guidance Source: BHF-UCL
  46. positive regulation of blood vessel endothelial cell migration Source: UniProtKB
  47. positive regulation of branching involved in ureteric bud morphogenesis Source: UniProtKB
  48. positive regulation of cell adhesion Source: UniProtKB
  49. positive regulation of cell division Source: UniProtKB-KW
  50. positive regulation of cell migration involved in sprouting angiogenesis Source: UniProtKB
  51. positive regulation of cell proliferation Source: MGI
  52. positive regulation of cell proliferation by VEGF-activated platelet derived growth factor receptor signaling pathway Source: UniProtKB
  53. positive regulation of cellular component movement Source: UniProtKB
  54. positive regulation of CREB transcription factor activity Source: UniProtKB
  55. positive regulation of endothelial cell chemotaxis by VEGF-activated vascular endothelial growth factor receptor signaling pathway Source: BHF-UCL
  56. positive regulation of endothelial cell migration Source: UniProtKB
  57. positive regulation of endothelial cell proliferation Source: MGI
  58. positive regulation of epithelial cell proliferation Source: MGI
  59. positive regulation of ERK1 and ERK2 cascade Source: BHF-UCL
  60. positive regulation of focal adhesion assembly Source: UniProtKB
  61. positive regulation of intracellular signal transduction Source: UniProtKB
  62. positive regulation of lymphangiogenesis Source: MGI
  63. positive regulation of MAP kinase activity Source: UniProtKB
  64. positive regulation of mesenchymal cell proliferation Source: MGI
  65. positive regulation of neuroblast proliferation Source: MGI
  66. positive regulation of peptidyl-serine phosphorylation Source: BHF-UCL
  67. positive regulation of peptidyl-tyrosine autophosphorylation Source: UniProtKB
  68. positive regulation of peptidyl-tyrosine phosphorylation Source: UniProtKB
  69. positive regulation of positive chemotaxis Source: UniProtKB
  70. positive regulation of protein autophosphorylation Source: UniProtKB
  71. positive regulation of protein complex assembly Source: UniProtKB
  72. positive regulation of protein kinase B signaling Source: BHF-UCL
  73. positive regulation of protein kinase C signaling Source: UniProtKB
  74. positive regulation of protein phosphorylation Source: UniProtKB
  75. positive regulation of receptor internalization Source: UniProtKB
  76. positive regulation of retinal ganglion cell axon guidance Source: BHF-UCL
  77. positive regulation of transcription from RNA polymerase II promoter Source: UniProtKB
  78. positive regulation of vascular endothelial growth factor receptor signaling pathway Source: UniProtKB
  79. positive regulation of vascular permeability Source: MGI
  80. post-embryonic camera-type eye development Source: MGI
  81. primitive erythrocyte differentiation Source: MGI
  82. regulation of cell shape Source: UniProtKB
  83. regulation of retinal ganglion cell axon guidance Source: BHF-UCL
  84. response to hypoxia Source: UniProtKB
  85. sprouting angiogenesis Source: BHF-UCL
  86. surfactant homeostasis Source: MGI
  87. tube formation Source: UniProtKB
  88. vascular endothelial growth factor receptor signaling pathway Source: MGI
  89. vascular endothelial growth factor signaling pathway Source: BHF-UCL
  90. vasculature development Source: MGI
  91. VEGF-activated neuropilin signaling pathway Source: BHF-UCL
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, Growth factor, Mitogen

Keywords - Biological processi

Angiogenesis, Differentiation

Keywords - Ligandi

Heparin-binding

Enzyme and pathway databases

ReactomeiREACT_199107. Regulation of gene expression by Hypoxia-inducible Factor.
REACT_205099. VEGF binds to VEGFR leading to receptor dimerization.
REACT_224551. VEGF ligand-receptor interactions.
REACT_243939. EPHA-mediated growth cone collapse.
REACT_245086. VEGFR2 mediated cell proliferation.
REACT_257088. VEGFA-VEGFR2 Pathway.

Names & Taxonomyi

Protein namesi
Recommended name:
Vascular endothelial growth factor A
Short name:
VEGF-A
Alternative name(s):
Vascular permeability factor
Short name:
VPF
Gene namesi
Name:Vegfa
Synonyms:Vegf
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 17

Organism-specific databases

MGIiMGI:103178. Vegfa.

Subcellular locationi

Isoform VEGF-3 : Cell membrane; Peripheral membrane protein
Note: Remains cell-surface associated unless released by heparin.

GO - Cellular componenti

  1. cell surface Source: UniProtKB
  2. cytoplasm Source: MGI
  3. extracellular region Source: MGI
  4. extracellular space Source: MGI
  5. plasma membrane Source: UniProtKB-KW
  6. secretory granule Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2626By similarityAdd
BLAST
Chaini27 – 214188Vascular endothelial growth factor APRO_0000023388Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi51 ↔ 93By similarity
Disulfide bondi76 – 76InterchainBy similarity
Disulfide bondi82 ↔ 127By similarity
Disulfide bondi85 – 85InterchainBy similarity
Disulfide bondi86 ↔ 129By similarity
Glycosylationi100 – 1001N-linked (GlcNAc...)Curated

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ00731.
PRIDEiQ00731.

PTM databases

PhosphoSiteiQ00731.

Expressioni

Tissue specificityi

In developing embryos, expressed mainly in the choroid plexus, paraventricular neuroepithelium, placenta and kidney glomeruli. Also found in bronchial epithelium, adrenal gland and in seminiferous tubules of testis. High expression of VEGF continues in kidney glomeruli and choroid plexus in adults.

Developmental stagei

Levels increase during pregnancy (maximum 5.5-fold at 5 days) and a more marked increase occurs during lactation (maximal 9.7-fold at 7 days). Levels decrease progressively during the phase of involution.1 Publication

Inductioni

By IL-6 and FSH in vitro.1 Publication

Gene expression databases

BgeeiQ00731.
CleanExiMM_VEGFA.
ExpressionAtlasiQ00731. baseline and differential.
GenevestigatoriQ00731.

Interactioni

Subunit structurei

Homodimer; disulfide-linked. Also found as heterodimer with PGF (By similarity).By similarity

Protein-protein interaction databases

BioGridi204512. 3 interactions.
DIPiDIP-31909N.
IntActiQ00731. 2 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ00731.
SMRiQ00731. Positions 37-134, 166-214.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domaini

Isoform VEGF-3 contains a basic insert which acts as a cell retention signal.

Sequence similaritiesi

Belongs to the PDGF/VEGF growth factor family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG73329.
GeneTreeiENSGT00730000110791.
HOGENOMiHOG000230896.
HOVERGENiHBG000105.
InParanoidiQ00731.
KOiK05448.
OrthoDBiEOG74R1S0.
PhylomeDBiQ00731.

Family and domain databases

Gene3Di2.10.160.10. 1 hit.
2.10.90.10. 1 hit.
InterProiIPR029034. Cystine-knot_cytokine.
IPR023581. PD_growth_factor_CS.
IPR000072. PDGF/VEGF_dom.
IPR027928. VEGF_C.
[Graphical view]
PfamiPF00341. PDGF. 1 hit.
PF14554. VEGF_C. 1 hit.
[Graphical view]
SMARTiSM00141. PDGF. 1 hit.
[Graphical view]
SUPFAMiSSF57501. SSF57501. 1 hit.
SSF57593. SSF57593. 1 hit.
PROSITEiPS00249. PDGF_1. 1 hit.
PS50278. PDGF_2. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative promoter usage, alternative splicing and alternative initiation. Align

Isoform VEGF-3 (identifier: Q00731-1) [UniParc]FASTAAdd to Basket

Also known as: VEGF188

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNFLLSWVHW TLALLLYLHH AKWSQAAPTT EGEQKSHEVI KFMDVYQRSY
60 70 80 90 100
CRPIETLVDI FQEYPDEIEY IFKPSCVPLM RCAGCCNDEA LECVPTSESN
110 120 130 140 150
ITMQIMRIKP HQSQHIGEMS FLQHSRCECR PKKDRTKPEK KSVRGKGKGQ
160 170 180 190 200
KRKRKKSRFK SWSVHCEPCS ERRKHLFVQD PQTCKCSCKN TDSRCKARQL
210
ELNERTCRCD KPRR
Length:214
Mass (Da):25,283
Last modified:October 1, 1996 - v2
Checksum:iB5540B51E4BB6E17
GO
Isoform VEGF-1 (identifier: Q00731-2) [UniParc]FASTAAdd to Basket

Also known as: VEGF164

The sequence of this isoform differs from the canonical sequence as follows:
     140-140: K → N
     141-164: Missing.

Show »
Length:190
Mass (Da):22,440
Checksum:i7B0BE0B9541E3805
GO
Isoform VEGF-2 (identifier: Q00731-3) [UniParc]FASTAAdd to Basket

Also known as: VEGF120

The sequence of this isoform differs from the canonical sequence as follows:
     141-208: Missing.

Show »
Length:146
Mass (Da):17,233
Checksum:i30635EADAD328C29
GO
Isoform VEGF-4 (identifier: Q00731-4) [UniParc]FASTAAdd to Basket

Also known as: VEGF115

The sequence of this isoform differs from the canonical sequence as follows:
     105-141: IMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKK → VGTCGTGDGAGAGGGRRTVVQGGALEGCLGLCLGNFW
     142-214: Missing.

Show »
Length:141
Mass (Da):15,584
Checksum:iA9AC452E770CC338
GO
Isoform VEGF-5 (identifier: Q00731-5) [UniParc]FASTAAdd to Basket

Also known as: VEGF102

The sequence of this isoform differs from the canonical sequence as follows:
     105-128: IMRIKPHQSQHIGEMSFLQHSRCE → VGTCGTGDGAGAGGAGGQWYKEGH
     129-214: Missing.

Show »
Length:128
Mass (Da):14,309
Checksum:i44405AD86973E191
GO
Isoform L-VEGF-1 (identifier: Q00731-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTDRQTDTAP...AGPGRASETM
     140-140: K → N
     141-164: Missing.

Note: Gene prediction based on EST data. Produced by alternative promoter usage and alternative initiation. Starts at an alternative upstream CUG codon.

Show »
Length:368
Mass (Da):40,288
Checksum:i8B8EAC32ADE8BDFD
GO

Sequence cautioni

The sequence AAH61468.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti61 – 611F → I in AAC05442. (PubMed:9446618)Curated
Sequence conflicti117 – 1182GE → ER in AAA40547. (PubMed:1644816)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MTDRQTDTAPSPSAHLLAGG LPTVDAAASREEPKPAPGGG VEGVGARGIARKLFVQLLGS SRSVVAVVCAAGDKPIGAGR SASSGLEKPGPEKRGEEEKE EERGPQWALGSQEPSSWTGE AAVCADSAPAARAPQAPARA SVPEGRGARQGAQESGLPRS PSRRGSASRAGPGRASETM in isoform L-VEGF-1. CuratedVSP_038746
Alternative sequencei105 – 14137IMRIK…KPEKK → VGTCGTGDGAGAGGGRRTVV QGGALEGCLGLCLGNFW in isoform VEGF-4. 1 PublicationVSP_016418Add
BLAST
Alternative sequencei105 – 12824IMRIK…HSRCE → VGTCGTGDGAGAGGAGGQWY KEGH in isoform VEGF-5. 1 PublicationVSP_016419Add
BLAST
Alternative sequencei129 – 21486Missing in isoform VEGF-5. 1 PublicationVSP_016420Add
BLAST
Alternative sequencei140 – 1401K → N in isoform VEGF-1 and isoform L-VEGF-1. 2 PublicationsVSP_004626
Alternative sequencei141 – 20868Missing in isoform VEGF-2. 1 PublicationVSP_004628Add
BLAST
Alternative sequencei141 – 16424Missing in isoform VEGF-1 and isoform L-VEGF-1. 2 PublicationsVSP_004627Add
BLAST
Alternative sequencei142 – 21473Missing in isoform VEGF-4. 1 PublicationVSP_016421Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
S37052 mRNA. Translation: AAB22252.1.
S38083 mRNA. Translation: AAB22253.1.
S38100 mRNA. Translation: AAB22254.1.
M95200 mRNA. Translation: AAA40547.1.
U50279 mRNA. Translation: AAC05442.1.
AY263146 mRNA. Translation: AAP86647.1.
AC127690 Genomic DNA. No translation available.
BC061468 mRNA. Translation: AAH61468.1. Different initiation.
AY707864 mRNA. Translation: AAU11325.1.
AY750956 mRNA. Translation: AAU95484.1.
AY750957 mRNA. Translation: AAU95485.1.
U41383 Genomic DNA. No translation available.
CCDSiCCDS28818.2. [Q00731-6]
CCDS70817.1. [Q00731-3]
PIRiA44881.
B44881.
RefSeqiNP_001020421.2. NM_001025250.3.
NP_001020428.2. NM_001025257.3.
NP_001103736.1. NM_001110266.1.
NP_001103737.1. NM_001110267.1.
NP_001103738.1. NM_001110268.1.
NP_001273985.1. NM_001287056.1. [Q00731-1]
NP_001273986.1. NM_001287057.1. [Q00731-2]
NP_001273987.1. NM_001287058.1. [Q00731-3]
NP_033531.3. NM_009505.4. [Q00731-6]
UniGeneiMm.282184.

Genome annotation databases

EnsembliENSMUST00000024747; ENSMUSP00000024747; ENSMUSG00000023951. [Q00731-3]
GeneIDi22339.
KEGGimmu:22339.
UCSCiuc008cro.3. mouse. [Q00731-6]
uc008crr.3. mouse. [Q00731-5]
uc012aui.2. mouse. [Q00731-1]

Keywords - Coding sequence diversityi

Alternative initiation, Alternative promoter usage, Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
S37052 mRNA. Translation: AAB22252.1 .
S38083 mRNA. Translation: AAB22253.1 .
S38100 mRNA. Translation: AAB22254.1 .
M95200 mRNA. Translation: AAA40547.1 .
U50279 mRNA. Translation: AAC05442.1 .
AY263146 mRNA. Translation: AAP86647.1 .
AC127690 Genomic DNA. No translation available.
BC061468 mRNA. Translation: AAH61468.1 . Different initiation.
AY707864 mRNA. Translation: AAU11325.1 .
AY750956 mRNA. Translation: AAU95484.1 .
AY750957 mRNA. Translation: AAU95485.1 .
U41383 Genomic DNA. No translation available.
CCDSi CCDS28818.2. [Q00731-6 ]
CCDS70817.1. [Q00731-3 ]
PIRi A44881.
B44881.
RefSeqi NP_001020421.2. NM_001025250.3.
NP_001020428.2. NM_001025257.3.
NP_001103736.1. NM_001110266.1.
NP_001103737.1. NM_001110267.1.
NP_001103738.1. NM_001110268.1.
NP_001273985.1. NM_001287056.1. [Q00731-1 ]
NP_001273986.1. NM_001287057.1. [Q00731-2 ]
NP_001273987.1. NM_001287058.1. [Q00731-3 ]
NP_033531.3. NM_009505.4. [Q00731-6 ]
UniGenei Mm.282184.

3D structure databases

ProteinModelPortali Q00731.
SMRi Q00731. Positions 37-134, 166-214.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 204512. 3 interactions.
DIPi DIP-31909N.
IntActi Q00731. 2 interactions.

PTM databases

PhosphoSitei Q00731.

Proteomic databases

PaxDbi Q00731.
PRIDEi Q00731.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000024747 ; ENSMUSP00000024747 ; ENSMUSG00000023951 . [Q00731-3 ]
GeneIDi 22339.
KEGGi mmu:22339.
UCSCi uc008cro.3. mouse. [Q00731-6 ]
uc008crr.3. mouse. [Q00731-5 ]
uc012aui.2. mouse. [Q00731-1 ]

Organism-specific databases

CTDi 7422.
MGIi MGI:103178. Vegfa.

Phylogenomic databases

eggNOGi NOG73329.
GeneTreei ENSGT00730000110791.
HOGENOMi HOG000230896.
HOVERGENi HBG000105.
InParanoidi Q00731.
KOi K05448.
OrthoDBi EOG74R1S0.
PhylomeDBi Q00731.

Enzyme and pathway databases

Reactomei REACT_199107. Regulation of gene expression by Hypoxia-inducible Factor.
REACT_205099. VEGF binds to VEGFR leading to receptor dimerization.
REACT_224551. VEGF ligand-receptor interactions.
REACT_243939. EPHA-mediated growth cone collapse.
REACT_245086. VEGFR2 mediated cell proliferation.
REACT_257088. VEGFA-VEGFR2 Pathway.

Miscellaneous databases

ChiTaRSi Vegfa. mouse.
NextBioi 302593.
PROi Q00731.
SOURCEi Search...

Gene expression databases

Bgeei Q00731.
CleanExi MM_VEGFA.
ExpressionAtlasi Q00731. baseline and differential.
Genevestigatori Q00731.

Family and domain databases

Gene3Di 2.10.160.10. 1 hit.
2.10.90.10. 1 hit.
InterProi IPR029034. Cystine-knot_cytokine.
IPR023581. PD_growth_factor_CS.
IPR000072. PDGF/VEGF_dom.
IPR027928. VEGF_C.
[Graphical view ]
Pfami PF00341. PDGF. 1 hit.
PF14554. VEGF_C. 1 hit.
[Graphical view ]
SMARTi SM00141. PDGF. 1 hit.
[Graphical view ]
SUPFAMi SSF57501. SSF57501. 1 hit.
SSF57593. SSF57593. 1 hit.
PROSITEi PS00249. PDGF_1. 1 hit.
PS50278. PDGF_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Expression of vascular endothelial growth factor during embryonic angiogenesis and endothelial cell differentiation."
    Breier G., Albrecht U., Sterrer S., Risau W.
    Development 114:521-532(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS VEGF-1; VEGF-2 AND VEGF-3).
  2. "Vascular endothelial growth factor. Regulation by cell differentiation and activated second messenger pathways."
    Claffey K.P., Wilkison W.O., Spiegelman B.M.
    J. Biol. Chem. 267:16317-16322(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM VEGF-1).
  3. "A novel alternatively spliced form of murine vascular endothelial growth factor, VEGF 115."
    Sugihara T., Wadhwa R., Kaul S.C., Mitsui Y.
    J. Biol. Chem. 273:3033-3038(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM VEGF-4).
    Strain: ICR.
  4. "Identification of a unique Mus musculus VEGF isoform of 102 amino acids."
    Jankowsky J.A., Adamski F.M., Robertson F.M.
    Submitted (MAR-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM VEGF-5).
    Strain: FVB/N.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM L-VEGF-1).
    Strain: C57BL/6.
    Tissue: Brain.
  7. "Alternatively spliced forms of mouse VEGF."
    Minchenko O.H., Minchenko D.O., Opentanova I.L.
    Submitted (SEP-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-123 (ISOFORMS VEGF-1/VEGF-2/VEGF-3).
    Strain: C57BL/6.
    Tissue: Retina.
  8. "The mouse gene for vascular endothelial growth factor. Genomic structure, definition of the transcriptional unit, and characterization of transcriptional and post-transcriptional regulatory sequences."
    Shima D.T., Kuroki M., Deutsch U., Ng Y., Adamis A.P., D'Amore P.A.
    J. Biol. Chem. 271:3877-3883(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-3 (ISOFORMS VEGF-1/VEGF-2/VEGF-3/VEGF-4/VEGF-5).
  9. "Regulation of VEGF and VEGF receptor expression in the rodent mammary gland during pregnancy, lactation, and involution."
    Pepper M.S., Baetens D., Mandriota S.J., Di Sanza C., Oikemus S., Lane T.F., Soriano J.V., Montesano R., Iruela-Arispe M.L.
    Dev. Dyn. 218:507-524(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: DEVELOPMENTAL STAGE.
  10. "The regulators of VEGF expression in mouse ovaries."
    Shin S.-Y., Lee H.-J., Ko D.-S., Lee H.-C., Park W.I.
    Yonsei Med. J. 46:679-686(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: INDUCTION.

Entry informationi

Entry nameiVEGFA_MOUSE
AccessioniPrimary (citable) accession number: Q00731
Secondary accession number(s): O70123
, Q66S31, Q6GT23, Q6WZL9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 1, 1993
Last sequence update: October 1, 1996
Last modified: November 26, 2014
This is version 149 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3