Reviewed,
UniProtKB/Swiss-Prot Q00653 (NFKB2_HUMAN)
Last modified
January 19, 2010.
Version 133.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Nuclear factor NF-kappa-B p100 subunit Alternative name(s): DNA-binding factor KBF2 H2TF1 Lymphocyte translocation chromosome 10 Oncogene Lyt-10 Short name=Lyt10 Cleaved into the following chain: 1- Recommended name: Nuclear factor NF-kappa-B p52 subunit | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 900 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | NF-kappa-B is a pleiotropic transcription factor which is present in almost all cell types and is involved in many biological processed such as inflammation, immunity, differentiation, cell growth, tumorigenesis and apoptosis. NF-kappa-B is a homo- or heterodimeric complex formed by the Rel-like domain-containing proteins RELA/p65, RELB, NFKB1/p105, NFKB1/p50, REL and NFKB2/p52. The dimers bind at kappa-B sites in the DNA of their target genes and the individual dimers have distinct preferences for different kappa-B sites that they can bind with distinguishable affinity and specificity. Different dimer combinations act as transcriptional activators or repressors, respectively. NF-kappa-B is controlled by various mechanisms of post-translational modification and subcellular compartmentalization as well as by interactions with other cofactors or corepressors. NF-kappa-B complexes are held in the cytoplasm in an inactive state complexed with members of the NF-kappa-B inhibitor (I-kappa-B) family. In a conventional activation pathway, I-kappa-B is phosphorylated by I-kappa-B kinases (IKKs) in response to different activators, subsequently degraded thus liberating the active NF-kappa-B complex which translocates to the nucleus. In a non-canonical activation pathway, the MAP3K14-activated CHUK/IKKA homodimer phosphorylates NFKB2/p100 associated with RelB, inducing its proteolytic processing to NFKB2/p52 and the formation of NF-kappa-B RelB-p52 complexes. The NF-kappa-B heterodimeric RelB-p52 complex is a transcriptional activator. The NF-kappa-B p52-p52 homodimer is a transcriptional repressor. NFKB2 appears to have dual functions such as cytoplasmic retention of attached NF-kappa-B proteins by p100 and generation of p52 by a cotranslational processing. The proteasome-mediated process ensures the production of both p52 and p100 and preserves their independent function. p52 binds to the kappa-B consensus sequence 5'-GGRNNYYCC-3', located in the enhancer region of genes involved in immune response and acute phase reactions. p52 and p100 are respectively the minor and major form; the processing of p100 being relatively poor. Isoform p49 is a subunit of the NF-kappa-B protein complex, which stimulates the HIV enhancer in synergy with p65. Ref.12 |
| Subunit structure | Component of the NF-kappa-B RelB-p52 complex. Homodimer; component of the NF-kappa-B p52-p52 complex. Component of the NF-kappa-B p65-p52 complex. Component of the NF-kappa-B p52-c-Rel complex. NFKB2/p52 interacts with NFKBIE. Component of a complex consisting of the NF-kappa-B p50-p50 homodimer and BCL3. Ref.14 Ref.16 |
| Subcellular location | Nucleus. Cytoplasm. Note: Nuclear, but also found in the cytoplasm in an inactive form complexed to an inhibitor (I-kappa-B). |
| Domain | The C-terminus of p100 might be involved in cytoplasmic retention, inhibition of DNA-binding by p52 homodimers, and/or transcription activation By similarity. The glycine-rich region (GRR) appears to be a critical element in the generation of p52. |
| Post-translational modification | While translation occurs, the particular unfolded structure after the GRR repeat promotes the generation of p52 making it an acceptable substrate for the proteasome. This process is known as cotranslational processing. The processed form is active and the unprocessed form acts as an inhibitor (I kappa B-like), being able to form cytosolic complexes with NF-kappa B, trapping it in the cytoplasm. Complete folding of the region downstream of the GRR repeat precludes processing. Subsequent to MAP3K14-dependent serine phosphorylation, p100 polyubiquitination occurs then triggering its proteasome-dependent processing. Constitutive processing is tightly suppressed by its C-terminal processing inhibitory domain, named PID, which contains the death domain. |
| Involvement in disease | A chromosomal aberration involving NFKB2 is found in a case of B-cell non Hodgkin lymphoma (B-NHL). Translocation t(10;14)(q24;q32) with IGHA1. The resulting oncogene is also called Lyt-10C alpha variant. A chromosomal aberration involving NFKB2 is found in a cutaneous T-cell leukemia (C-TCL) cell line. This rearrangement produces the p80HT gene which encodes for a truncated 80 kDa protein (p80HT). In B-cell leukemia (B-CLL) cell line, LB40 and EB308, can be found after heterogeneous chromosomal aberrations, such as internal deletions. |
| Sequence similarities | Contains 7 ANK repeats. Contains 1 death domain. Contains 1 RHD (Rel-like) domain. |
| Sequence caution | The sequence CAA43715.1 differs from that shown. Reason: Frameshift at positions 455, 470 and 899. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q00653-1) Also known as: p100; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q00653-2) Also known as: p49; The sequence of this isoform differs from the canonical sequence as follows: 374-403: GSLGFFPSSLAYSPYQSGAGPMGCYPGGGG → EGVLMEGGVKVREAVEEKNLGEAGRGGSRL 404-900: Missing. | ||||||
| Note: Ref.1 (CAA43716) sequence differs from that shown due to a frameshift in position 400. Also includes sequencing errors. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 900 | 900 | Nuclear factor NF-kappa-B p100 subunit | PRO_0000030321 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 1 – 454 | 454 | Nuclear factor NF-kappa-B p52 subunit | PRO_0000030322 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 38 – 343 | 306 | RHD | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 487 – 519 | 33 | ANK 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 526 – 555 | 30 | ANK 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 559 – 591 | 33 | ANK 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 599 – 628 | 30 | ANK 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 633 – 663 | 31 | ANK 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 667 – 696 | 30 | ANK 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 729 – 758 | 30 | ANK 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 764 – 851 | 88 | Death | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 346 – 377 | 32 | GRR | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Motif | 337 – 341 | 5 | Nuclear localization signal Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Compositional bias | 350 – 400 | 51 | Gly-rich | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 454 – 455 | 2 | Cleavage (when cotranslationally processed) | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 490 – 491 | 2 | Breakpoint for translocation to form NFKB2-IGHA1 oncogene | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 429 | 1 | Phosphothreonine Ref.23 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 713 | 1 | Phosphoserine Ref.16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 715 | 1 | Phosphoserine Ref.16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 717 | 1 | Phosphoserine Ref.16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 866 | 1 | Phosphoserine; by MAP3K14 Ref.17 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 870 | 1 | Phosphoserine; by MAP3K14 Ref.17 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Cross-link | 855 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) Ref.21 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 374 – 403 | 30 | GSLGF…PGGGG → EGVLMEGGVKVREAVEEKNL GEAGRGGSRL in isoform 2. | VSP_005585 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 404 – 900 | 497 | Missing in isoform 2. | VSP_005586 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 14 | 1 | E → K: dbSNP rs45581936. Ref.6 | VAR_022223 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 351 | 1 | G → R: dbSNP rs45580031. Ref.6 | VAR_022224 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 392 | 1 | A → G: dbSNP rs11574848. | VAR_051781 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 452 | 1 | G → R: dbSNP rs45471103. Ref.6 | VAR_022225 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 618 – 900 | 283 | Missing in truncated form EB308. | VAR_018452 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 667 – 669 | 3 | AGN → SAS in truncated form p80HT. | VAR_006909 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 670 – 900 | 231 | Missing in truncated form p80HT. | VAR_006910 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 703 – 900 | 198 | Missing in truncated form LB40. | VAR_018453 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 247 – 249 | 3 | YLL → AAA: Two-fold reduction in heterodimerization with RelA. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 399 | 1 | P → A: No change in cleavage rate or products. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 404 | 1 | G → A: No change in cleavage rate or products. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 405 | 1 | A → P: No change in cleavage rate or products. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 406 | 1 | Q → N: No change in cleavage rate or products. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 713 | 1 | S → G: Loss of phosphorylation; when associated with A-715 and A-717. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 715 | 1 | S → A: Loss of phosphorylation; when associated with G-713 and A-717. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 717 | 1 | S → A: Loss of phosphorylation; when associated with G-713 and A-715. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 866 | 1 | S → A: Decrease in MAP3K14-induced phosphorylation; no inducible processing occurs; when associated with A-869. Ref.17 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 870 | 1 | S → A: Decrease in MAP3K14-induced phosphorylation; no inducible processing occurs; when associated with A-865. Ref.17 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 144 | 1 | K → E in AAB21124. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 213 | 1 | I → T Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 213 | 1 | I → T Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 213 | 1 | I → T Ref.9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 396 | 1 | G → R Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 396 | 1 | G → R Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 433 – 434 | 2 | EP → DA in AAB21124. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 459 | 1 | R → K AA sequence Ref.10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 470 | 1 | A → R in AAB21124. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 741 | 1 | K → L in CAA43715. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 860 | 1 | A → T in AAB21124. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 860 | 1 | Missing in CAA43715. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 860 | 1 | Missing in AAP88771. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 860 | 1 | Missing in AAH02844. Ref.8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 876 | 1 | E → K in AAB21124. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 891 | 1 | C → S in CAA43715. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 39 – 44 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 48 – 51 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 56 – 58 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 79 – 83 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 87 – 96 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 98 – 101 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 106 – 111 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 120 – 124 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 130 – 132 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 136 – 140 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 143 – 145 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 146 – 158 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 159 – 161 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 168 – 182 | 15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 189 – 198 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 217 – 219 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 223 – 225 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 230 – 234 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 236 – 239 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 245 – 252 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 255 – 257 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 258 – 264 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 266 – 268 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 270 – 273 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 278 – 280 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 283 – 285 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 286 – 290 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 303 – 311 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 312 – 314 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 321 – 326 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 765 – 767 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 772 – 782 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 783 – 786 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 791 – 798 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 801 – 808 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 813 – 823 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 828 – 838 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 841 – 848 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning of an NF-kappa B subunit which stimulates HIV transcription in synergy with p65." Schmid R.M., Perkins N.D., Duckett C.S., Andrews P.C., Nabel G.J. Nature 352:733-736(1991) [PubMed: 1876189] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). Tissue: Leukemia. |
| [2] | "A novel mitogen-inducible gene product related to p50/p105-NF-kappa B participates in transactivation through a kappa B site." Bours V., Burd P.R., Brown K., Villalobos J., Park S., Ryseck R.P., Bravo R., Kelly K., Siebenlist U. Mol. Cell. Biol. 12:685-695(1992) [PubMed: 1531086] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "Rearrangement and altered expression of the NFKB-2 gene in human cutaneous T-lymphoma cells." Thakur S., Lin H.C., Tseng W.T., Kumar S., Bravo R., Foss F., Gelinas C., Rabson A.B. Oncogene 9:2335-2344(1994) [PubMed: 8036016] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHROMOSOMAL TRANSLOCATION, P80HT GENERATION. |
| [4] | Rabson A.B. Submitted (FEB-2006) to the EMBL/GenBank/DDBJ databases Cited for: SEQUENCE REVISION. |
| [5] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [6] | NIEHS SNPs program Submitted (DEC-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS LYS-14; ARG-351 AND ARG-452. |
| [7] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed: 15164054] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Lymph. |
| [9] | "Transcriptional regulation of NF-kappa B2: evidence for kappa B-mediated positive and negative autoregulation." Liptay S., Schmid R.M., Nabel E.G., Nabel G.J. Mol. Cell. Biol. 14:7695-7703(1994) [PubMed: 7969113] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-220. |
| [10] | "Purification of the major histocompatibility complex class I transcription factor H2TF1. The full-length product of the nfkb2 gene." Potter D.A., Larson C.J., Eckes P., Schmid R.M., Nabel G.J., Verdine G.L., Sharp P.A. J. Biol. Chem. 268:18882-18890(1993) [PubMed: 8360178] [Abstract] Cited for: PROTEIN SEQUENCE OF 459-470; 580-597 AND 636-647 (ISOFORM 1). |
| [11] | "The oncoprotein Bcl-3 directly transactivates through kappa B motifs via association with DNA-binding p50B homodimers." Bours V., Franzoso G., Azarenko V., Park S., Kanno T., Brown K., Siebenlist U. Cell 72:729-739(1993) [PubMed: 8453667] [Abstract] Cited for: IDENTIFICATION IN A COMPLEX WITH BCL3. |
| [12] | "Differential interactions of Rel-NF-kappa B complexes with I kappa B alpha determine pools of constitutive and inducible NF-kappa B activity." Dobrzanski P., Ryseck R.P., Bravo R. EMBO J. 13:4608-4616(1994) [PubMed: 7925301] [Abstract] Cited for: FUNCTION, IDENTIFICATION IN THE NF-KAPPA-B RELB-P52 COMPLEX. |
| [13] | "Activation of multiple NF-kappa B/Rel DNA-binding complexes by tumor necrosis factor." Beg A.A., Baldwin A.S. Jr. Oncogene 9:1487-1492(1994) [PubMed: 8152812] [Abstract] Cited for: IDENTIFICATION IN THE NF-KAPPA-B P52-C-REL COMPLEX, IDENTIFICATION IN THE NF-KAPPA-B P65-P52 COMPLEX. |
| [14] | "A new member of the IkappaB protein family, IkappaB epsilon, inhibits RelA (p65)-mediated NF-kappaB transcription." Li Z., Nabel G.J. Mol. Cell. Biol. 17:6184-6190(1997) [PubMed: 9315679] [Abstract] Cited for: INTERACTION WITH NFKBIE. |
| [15] | "The generation of nfkb2 p52: mechanism and efficiency." Heusch M., Lin L., Geleziunas R., Greene W.C. Oncogene 18:6201-6208(1999) [PubMed: 10597218] [Abstract] Cited for: COTRANSLATIONAL FOLDING/PROCESSING OF P100, GENERATION OF P52/P100. |
| [16] | "Differential regulation of NF-kappaB2(p100) processing and control by amino-terminal sequences." Betts J.C., Nabel G.J. Mol. Cell. Biol. 16:6363-6371(1996) [PubMed: 8887665] [Abstract] Cited for: PHOSPHORYLATION AT SER-713; SER-715 AND SER-717, MUTAGENESIS, DIMERIZATION, PROTEOLYTIC PROCESSING OF P100. |
| [17] | "NF-kappaB-inducing kinase regulates the processing of NF-kappaB2 p100." Xiao G., Harhaj E.W., Sun S.-C. Mol. Cell 7:401-409(2001) [PubMed: 11239468] [Abstract] Cited for: PHOSPHORYLATION AT SER-866 AND SER-870, MUTAGENESIS OF SER-866 AND SER-870, PROTEOLYTIC PROCESSING OF P100. |
| [18] | "B cell lymphoma-associated chromosomal translocation involves candidate oncogene lyt-10, homologous to NF-kappa B p50." Neri A., Chang C.C., Lombardi L., Salina M., Corradini P., Maiolo A.T., Chaganti R.S., Dalla-Favera R. Cell 67:1075-1087(1991) [PubMed: 1760839] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION WITH IGHA1. |
| [19] | "Heterogeneous chromosomal aberrations generate 3' truncations of the NFKB2/lyt-10 gene in lymphoid malignancies." Migliazza A., Lombardi L., Rocchi M., Trecca D., Chang C.-C., Antonacci R., Fracchiolla N.S., Ciana P., Maiolo A.T., Neri A. Blood 84:3850-3860(1994) [PubMed: 7949142] [Abstract] Cited for: CHROMOSOMAL ABERRATIONS, GENERATION OF LB40 AND EB308. |
| [20] | "Structural and functional characterization of the promoter regions of the NFKB2 gene." Lombardi L., Ciana P., Cappellini C., Trecca D., Guerrini L., Migliazza A., Maiolo A.T., Neri A. Nucleic Acids Res. 23:2328-2336(1995) [PubMed: 7541912] [Abstract] Cited for: CHARACTERIZATION OF THE TWO PROMOTER REGIONS. |
| [21] | "Mechanism of processing of the NF-kappa B2 p100 precursor: identification of the specific polyubiquitin chain-anchoring lysine residue and analysis of the role of NEDD8-modification on the SCF(beta-TrCP) ubiquitin ligase." Amir R.E., Haecker H., Karin M., Ciechanover A. Oncogene 23:2540-2547(2004) [PubMed: 14676825] [Abstract] Cited for: UBIQUITINATION AT LYS-855. |
| [22] | "IL-1 receptor-associated kinase 1 is critical for latent membrane protein 1-induced p65/RelA serine 536 phosphorylation and NF-kappaB activation." Song Y.J., Jen K.Y., Soni V., Kieff E., Cahir-McFarland E. Proc. Natl. Acad. Sci. U.S.A. 103:2689-2694(2006) [PubMed: 16477006] [Abstract] Cited for: IDENTIFICATION IN THE NF-KAPPA-B P65-P52 COMPLEX. |
| [23] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-429, MASS SPECTROMETRY. |
| [24] | Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| [25] | "Structure of the human NF-kappaB p52 homodimer-DNA complex at 2.1-A resolution." Cramer P., Larson C.J., Verdine G.L., Mueller C.W. EMBO J. 16:7078-7090(1997) [PubMed: 9384586] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.1 ANGSTROMS) OF 37-327. |
| [26] | "Solution structure of the death domain of nuclear factor NF-kappa-B p100." RIKEN structural genomics initiative (RSGI) Submitted (DEC-2006) to the PDB data bank Cited for: STRUCTURE BY NMR OF 764-859. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | X61498 mRNA. Translation: CAA43715.1. Frameshift. X61499 mRNA. Translation: CAA43716.1. Sequence problems. S76638 mRNA. Translation: AAB21124.1. U09609 mRNA. Translation: AAA21462.2. BT009769 mRNA. Translation: AAP88771.1. AY865619 Genomic DNA. Translation: AAW56071.1. AL121928 Genomic DNA. Translation: CAC08399.1. BC002844 mRNA. Translation: AAH02844.1. U20816 Genomic DNA. Translation: AAA68171.1. | ||||||||||||||||||||||||
| IPI | IPI00411715. IPI00845373. | ||||||||||||||||||||||||
| PIR | A42024. A57034. I38609. S17233. | ||||||||||||||||||||||||
| RefSeq | NP_001070961.1. NP_001070962.1. NP_002493.3. | ||||||||||||||||||||||||
| UniGene | Hs.73090 | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| SMR | Q00653. Positions 486-699, 489-750. | ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| DIP | DIP-24239N. DIP-27535N. | ||||||||||||||||||||||||
| IntAct | Q00653. 171 interactions. | ||||||||||||||||||||||||
| STRING | Q00653. | ||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||
| PhosphoSite | Q00653. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PRIDE | Q00653. | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENST00000189444; ENSP00000189444; ENSG00000077150; Homo sapiens. [Genome view] ENST00000369966; ENSP00000358983; ENSG00000077150; Homo sapiens. [Genome view] ENST00000454143; ENSP00000393635; ENSG00000077150; Homo sapiens. [Genome view] | ||||||||||||||||||||||||
| GeneID | 4791. | ||||||||||||||||||||||||
| KEGG | hsa:4791. | ||||||||||||||||||||||||
| UCSC | uc001kvb.1. human. uc001kvc.2. human. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 4791. | ||||||||||||||||||||||||
| GeneCards | GC10P104144. | ||||||||||||||||||||||||
| H-InvDB | HIX0009155. | ||||||||||||||||||||||||
| HGNC | HGNC:7795. NFKB2. | ||||||||||||||||||||||||
| HPA | CAB022098. HPA008422. HPA023900. | ||||||||||||||||||||||||
| MIM | 164012. gene. | ||||||||||||||||||||||||
| PharmGKB | PA31600. | ||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| eggNOG | prNOG08254. | ||||||||||||||||||||||||
| HOGENOM | HBG444006. | ||||||||||||||||||||||||
| HOVERGEN | Q00653. | ||||||||||||||||||||||||
| InParanoid | Q00653. | ||||||||||||||||||||||||
| OMA | QTSVVSF. | ||||||||||||||||||||||||
| OrthoDB | EOG9FXTSQ. | ||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||
| Pathway_Interaction_DB | nfkappabalternativepathway. Alternative NF-kappaB pathway. il12_2pathway. IL12-mediated signaling events. | ||||||||||||||||||||||||
| Reactome | REACT_6900. Signaling in Immune system. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| ArrayExpress | Q00653. | ||||||||||||||||||||||||
| Bgee | Q00653. | ||||||||||||||||||||||||
| CleanEx | HS_NFKB2. | ||||||||||||||||||||||||
| Genevestigator | Q00653. | ||||||||||||||||||||||||
| GermOnline | ENSG00000077150. Homo sapiens. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| InterPro | IPR002110. Ankyrin_rpt. IPR020683. Ankyrin_rpt-contain_dom. IPR000488. Death. IPR011029. DEATH-like. IPR013783. Ig-like_fold. IPR014756. Ig_E-set. IPR002909. IPT_TIG_rcpt. IPR015682. NF-kappaB_related2. IPR000451. NF_Rel_dor. IPR008967. p53-like_TF_DNA-bd. IPR011539. RHD. [Graphical view] | ||||||||||||||||||||||||
| Gene3D | G3DSA:1.25.40.20. ANK. 1 hit. G3DSA:1.10.533.10. DEATH_like. 1 hit. G3DSA:2.60.40.10. Ig-like_fold. 1 hit. G3DSA:2.60.40.340. RHD. 1 hit. | ||||||||||||||||||||||||
| PANTHER | PTHR18958:SF244. NF_kB_related2. 1 hit. | ||||||||||||||||||||||||
| Pfam | PF00023. Ank. 2 hits. PF00531. Death. 1 hit. PF00554. RHD. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| PRINTS | PR00057. NFKBTNSCPFCT. | ||||||||||||||||||||||||
| SMART | SM00248. ANK. 6 hits. SM00005. DEATH. 1 hit. SM00429. IPT. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| PROSITE | PS50297. ANK_REP_REGION. 1 hit. PS50088. ANK_REPEAT. 5 hits. PS50017. DEATH_DOMAIN. False negative. PS01204. REL_1. 1 hit. PS50254. REL_2. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other Resources | |||||||||||||||||||||||||
| NextBio | 18458. | ||||||||||||||||||||||||
| PMAP-CutDB | Q00653. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | NFKB2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q00653 Secondary accession number(s): Q04860 Q9H472 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


