Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

GA-binding protein subunit beta-1

Gene

Gabpb1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Transcription factor capable of interacting with purine rich repeats (GA repeats).

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Enzyme and pathway databases

ReactomeiR-MMU-2151201. Transcriptional activation of mitochondrial biogenesis.

Names & Taxonomyi

Protein namesi
Recommended name:
GA-binding protein subunit beta-1
Short name:
GABP subunit beta-1
Short name:
GABPB-1
Alternative name(s):
GABP subunit beta-2
Short name:
GABPB-2
Gene namesi
Name:Gabpb1
Synonyms:Gabpb, Gabpb2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 2

Organism-specific databases

MGIiMGI:95611. Gabpb1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00000669942 – 383GA-binding protein subunit beta-1Add BLAST382

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylserineBy similarity1

Keywords - PTMi

Acetylation

Proteomic databases

MaxQBiQ00420.
PaxDbiQ00420.
PeptideAtlasiQ00420.
PRIDEiQ00420.

PTM databases

iPTMnetiQ00420.
PhosphoSitePlusiQ00420.

Expressioni

Gene expression databases

BgeeiENSMUSG00000027361.
CleanExiMM_GABPB1.
MM_GABPB2.
ExpressionAtlasiQ00420. baseline and differential.
GenevisibleiQ00420. MM.

Interactioni

Subunit structurei

Interacts with HCFC1, causing repression of transcriptional activity (By similarity). Heterotetramer of two alpha and two beta subunits.By similarity

GO - Molecular functioni

Protein-protein interaction databases

DIPiDIP-321N.
IntActiQ00420. 1 interactor.
MINTiMINT-1531801.
STRINGi10090.ENSMUSP00000099517.

Structurei

Secondary structure

1383
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi6 – 16Combined sources11
Helixi19 – 28Combined sources10
Helixi41 – 48Combined sources8
Helixi51 – 58Combined sources8
Turni59 – 61Combined sources3
Helixi74 – 81Combined sources8
Helixi84 – 91Combined sources8
Turni92 – 94Combined sources3
Helixi107 – 113Combined sources7
Helixi117 – 125Combined sources9
Helixi140 – 146Combined sources7
Helixi150 – 156Combined sources7

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1AWCX-ray2.15B5-157[»]
ProteinModelPortaliQ00420.
SMRiQ00420.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ00420.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati5 – 34ANK 1Add BLAST30
Repeati37 – 66ANK 2Add BLAST30
Repeati70 – 99ANK 3Add BLAST30
Repeati103 – 132ANK 4Add BLAST30
Repeati136 – 166ANK 5Add BLAST31

Sequence similaritiesi

Contains 5 ANK repeats.PROSITE-ProRule annotation

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

eggNOGiENOG410IE1V. Eukaryota.
COG0666. LUCA.
GeneTreeiENSGT00860000133710.
HOVERGENiHBG051686.
InParanoidiQ00420.
KOiK09454.
OMAiHAQSKFC.
OrthoDBiEOG091G0AIM.
PhylomeDBiQ00420.
TreeFamiTF326036.

Family and domain databases

Gene3Di1.25.40.20. 2 hits.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
[Graphical view]
PfamiPF12796. Ank_2. 1 hit.
[Graphical view]
PRINTSiPR01415. ANKYRIN.
SMARTiSM00248. ANK. 4 hits.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 3 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q00420-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSLVDLGKKL LEAARAGQDD EVRILMANGA PFTTDWLGTS PLHLAAQYGH
60 70 80 90 100
FSTTEVLLRA GVSRDARTKV DRTPLHMAAS EGHANIVEVL LKHGADVNAK
110 120 130 140 150
DMLKMTALHW ATEHNHQEVV ELLIKYGADV HTQSKFCKTA FDISIDNGNE
160 170 180 190 200
DLAEILQIAM QNQINTNPES PDTVTIHAAT PQFIIGPGGV VNLTDETGVS
210 220 230 240 250
AVQFGNSSTS VLATLAALAE ASAPLSNSSE TPVVATEEVV TAESVDGAIQ
260 270 280 290 300
QVVSSGGQQV ITIVTDGIQL GNLHSIPTSG MGQPIIVTMP DGQQVLTVPA
310 320 330 340 350
TDIAEETVIS EEPPAKRQCM EIIESRVECA EIEEREALQK QLDEANREAQ
360 370 380
KYRQQLLKKE QEAEAYRQKL EAMTRIQTNK EAV
Length:383
Mass (Da):41,358
Last modified:September 19, 2002 - v2
Checksum:iE3BCE5A05B1AF5A9
GO
Isoform 2 (identifier: Q00420-2) [UniParc]FASTAAdd to basket
Also known as: GABP-beta-2 subunit, GABBP2

The sequence of this isoform differs from the canonical sequence as follows:
     334-383: EREALQKQLDEANREAQKYRQQLLKKEQEAEAYRQKLEAMTRIQTNKEAV → VRSLIPGVFCCSHPK

Show »
Length:348
Mass (Da):36,967
Checksum:i959E2B8504F1292D
GO
Isoform 3 (identifier: Q00420-3) [UniParc]FASTAAdd to basket
Also known as: GABP-beta-1

The sequence of this isoform differs from the canonical sequence as follows:
     233-233: Missing.

Note: May be due to competing acceptor splice sites.
Show »
Length:382
Mass (Da):41,258
Checksum:i0A5FE3F71D4227AF
GO
Isoform 4 (identifier: Q00420-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     233-233: V → G
     234-383: Missing.

Note: May be due to an intron retention. No experimental confirmation available.
Show »
Length:233
Mass (Da):24,803
Checksum:i4E7D67CF5B2D8250
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_009333233Missing in isoform 3. 1 Publication1
Alternative sequenceiVSP_009334233V → G in isoform 4. 1 Publication1
Alternative sequenceiVSP_009335234 – 383Missing in isoform 4. 1 PublicationAdd BLAST150
Alternative sequenceiVSP_009336334 – 383EREAL…NKEAV → VRSLIPGVFCCSHPK in isoform 2. 1 PublicationAdd BLAST50

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M74516 mRNA. Translation: AAA53031.1.
M74517 mRNA. Translation: AAA53032.1.
AK040722 mRNA. Translation: BAC30682.1.
AK052828 mRNA. Translation: BAC35165.1.
AL844555 Genomic DNA. Translation: CAM18699.1.
AL844555 Genomic DNA. Translation: CAM18701.1.
BC013558 mRNA. Translation: AAH13558.1.
CCDSiCCDS16685.1. [Q00420-3]
CCDS16686.1. [Q00420-2]
CCDS71135.1. [Q00420-4]
CCDS71137.1. [Q00420-1]
PIRiB40858.
C40858.
RefSeqiNP_001258396.1. NM_001271467.1. [Q00420-3]
NP_001258397.1. NM_001271468.1. [Q00420-1]
NP_001258421.1. NM_001271492.1. [Q00420-4]
NP_034379.1. NM_010249.2. [Q00420-2]
NP_997552.1. NM_207669.2. [Q00420-3]
XP_006498820.1. XM_006498757.3. [Q00420-1]
XP_006498821.1. XM_006498758.3. [Q00420-1]
XP_006498822.1. XM_006498759.3. [Q00420-1]
XP_006498823.1. XM_006498760.3. [Q00420-1]
XP_006498824.1. XM_006498761.3. [Q00420-3]
UniGeneiMm.293266.

Genome annotation databases

EnsembliENSMUST00000089745; ENSMUSP00000087177; ENSMUSG00000027361. [Q00420-4]
ENSMUST00000103226; ENSMUSP00000099516; ENSMUSG00000027361. [Q00420-2]
ENSMUST00000103227; ENSMUSP00000099517; ENSMUSG00000027361. [Q00420-3]
ENSMUST00000110424; ENSMUSP00000106054; ENSMUSG00000027361. [Q00420-3]
ENSMUST00000110425; ENSMUSP00000106055; ENSMUSG00000027361. [Q00420-1]
GeneIDi14391.
KEGGimmu:14391.
UCSCiuc008mdv.2. mouse. [Q00420-1]
uc008mdx.2. mouse. [Q00420-2]
uc008mdz.2. mouse. [Q00420-4]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M74516 mRNA. Translation: AAA53031.1.
M74517 mRNA. Translation: AAA53032.1.
AK040722 mRNA. Translation: BAC30682.1.
AK052828 mRNA. Translation: BAC35165.1.
AL844555 Genomic DNA. Translation: CAM18699.1.
AL844555 Genomic DNA. Translation: CAM18701.1.
BC013558 mRNA. Translation: AAH13558.1.
CCDSiCCDS16685.1. [Q00420-3]
CCDS16686.1. [Q00420-2]
CCDS71135.1. [Q00420-4]
CCDS71137.1. [Q00420-1]
PIRiB40858.
C40858.
RefSeqiNP_001258396.1. NM_001271467.1. [Q00420-3]
NP_001258397.1. NM_001271468.1. [Q00420-1]
NP_001258421.1. NM_001271492.1. [Q00420-4]
NP_034379.1. NM_010249.2. [Q00420-2]
NP_997552.1. NM_207669.2. [Q00420-3]
XP_006498820.1. XM_006498757.3. [Q00420-1]
XP_006498821.1. XM_006498758.3. [Q00420-1]
XP_006498822.1. XM_006498759.3. [Q00420-1]
XP_006498823.1. XM_006498760.3. [Q00420-1]
XP_006498824.1. XM_006498761.3. [Q00420-3]
UniGeneiMm.293266.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1AWCX-ray2.15B5-157[»]
ProteinModelPortaliQ00420.
SMRiQ00420.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

DIPiDIP-321N.
IntActiQ00420. 1 interactor.
MINTiMINT-1531801.
STRINGi10090.ENSMUSP00000099517.

PTM databases

iPTMnetiQ00420.
PhosphoSitePlusiQ00420.

Proteomic databases

MaxQBiQ00420.
PaxDbiQ00420.
PeptideAtlasiQ00420.
PRIDEiQ00420.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000089745; ENSMUSP00000087177; ENSMUSG00000027361. [Q00420-4]
ENSMUST00000103226; ENSMUSP00000099516; ENSMUSG00000027361. [Q00420-2]
ENSMUST00000103227; ENSMUSP00000099517; ENSMUSG00000027361. [Q00420-3]
ENSMUST00000110424; ENSMUSP00000106054; ENSMUSG00000027361. [Q00420-3]
ENSMUST00000110425; ENSMUSP00000106055; ENSMUSG00000027361. [Q00420-1]
GeneIDi14391.
KEGGimmu:14391.
UCSCiuc008mdv.2. mouse. [Q00420-1]
uc008mdx.2. mouse. [Q00420-2]
uc008mdz.2. mouse. [Q00420-4]

Organism-specific databases

CTDi2553.
MGIiMGI:95611. Gabpb1.

Phylogenomic databases

eggNOGiENOG410IE1V. Eukaryota.
COG0666. LUCA.
GeneTreeiENSGT00860000133710.
HOVERGENiHBG051686.
InParanoidiQ00420.
KOiK09454.
OMAiHAQSKFC.
OrthoDBiEOG091G0AIM.
PhylomeDBiQ00420.
TreeFamiTF326036.

Enzyme and pathway databases

ReactomeiR-MMU-2151201. Transcriptional activation of mitochondrial biogenesis.

Miscellaneous databases

EvolutionaryTraceiQ00420.
PROiQ00420.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000027361.
CleanExiMM_GABPB1.
MM_GABPB2.
ExpressionAtlasiQ00420. baseline and differential.
GenevisibleiQ00420. MM.

Family and domain databases

Gene3Di1.25.40.20. 2 hits.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
[Graphical view]
PfamiPF12796. Ank_2. 1 hit.
[Graphical view]
PRINTSiPR01415. ANKYRIN.
SMARTiSM00248. ANK. 4 hits.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 3 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiGABP1_MOUSE
AccessioniPrimary (citable) accession number: Q00420
Secondary accession number(s): A2AQ68
, A2AQ70, Q00421, Q8BS31, Q91YZ0, Q9QVV2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 1992
Last sequence update: September 19, 2002
Last modified: November 30, 2016
This is version 169 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.