Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

GA-binding protein subunit beta-1

Gene

Gabpb1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Transcription factor capable of interacting with purine rich repeats (GA repeats).

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Enzyme and pathway databases

ReactomeiR-MMU-2151201. Transcriptional activation of mitochondrial biogenesis.

Names & Taxonomyi

Protein namesi
Recommended name:
GA-binding protein subunit beta-1
Short name:
GABP subunit beta-1
Short name:
GABPB-1
Alternative name(s):
GABP subunit beta-2
Short name:
GABPB-2
Gene namesi
Name:Gabpb1
Synonyms:Gabpb, Gabpb2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 2

Organism-specific databases

MGIiMGI:95611. Gabpb1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methionineiRemovedBy similarity
Chaini2 – 383382GA-binding protein subunit beta-1PRO_0000066994Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylserineBy similarity

Keywords - PTMi

Acetylation

Proteomic databases

EPDiQ00420.
MaxQBiQ00420.
PaxDbiQ00420.
PRIDEiQ00420.

PTM databases

iPTMnetiQ00420.
PhosphoSiteiQ00420.

Expressioni

Gene expression databases

BgeeiQ00420.
CleanExiMM_GABPB1.
MM_GABPB2.
ExpressionAtlasiQ00420. baseline and differential.
GenevisibleiQ00420. MM.

Interactioni

Subunit structurei

Interacts with HCFC1, causing repression of transcriptional activity (By similarity). Heterotetramer of two alpha and two beta subunits.By similarity

GO - Molecular functioni

Protein-protein interaction databases

DIPiDIP-321N.
IntActiQ00420. 1 interaction.
MINTiMINT-1531801.
STRINGi10090.ENSMUSP00000099517.

Structurei

Secondary structure

1
383
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi6 – 1611Combined sources
Helixi19 – 2810Combined sources
Helixi41 – 488Combined sources
Helixi51 – 588Combined sources
Turni59 – 613Combined sources
Helixi74 – 818Combined sources
Helixi84 – 918Combined sources
Turni92 – 943Combined sources
Helixi107 – 1137Combined sources
Helixi117 – 1259Combined sources
Helixi140 – 1467Combined sources
Helixi150 – 1567Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1AWCX-ray2.15B5-157[»]
ProteinModelPortaliQ00420.
SMRiQ00420. Positions 5-281.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ00420.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati5 – 3430ANK 1Add
BLAST
Repeati37 – 6630ANK 2Add
BLAST
Repeati70 – 9930ANK 3Add
BLAST
Repeati103 – 13230ANK 4Add
BLAST
Repeati136 – 16631ANK 5Add
BLAST

Sequence similaritiesi

Contains 5 ANK repeats.PROSITE-ProRule annotation

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

eggNOGiENOG410IE1V. Eukaryota.
COG0666. LUCA.
GeneTreeiENSGT00840000129826.
HOVERGENiHBG051686.
InParanoidiQ00420.
KOiK09454.
OMAiHAQSKFC.
OrthoDBiEOG7ZD1W2.
PhylomeDBiQ00420.
TreeFamiTF326036.

Family and domain databases

Gene3Di1.25.40.20. 2 hits.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
[Graphical view]
PfamiPF12796. Ank_2. 1 hit.
[Graphical view]
PRINTSiPR01415. ANKYRIN.
SMARTiSM00248. ANK. 4 hits.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 3 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q00420-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSLVDLGKKL LEAARAGQDD EVRILMANGA PFTTDWLGTS PLHLAAQYGH
60 70 80 90 100
FSTTEVLLRA GVSRDARTKV DRTPLHMAAS EGHANIVEVL LKHGADVNAK
110 120 130 140 150
DMLKMTALHW ATEHNHQEVV ELLIKYGADV HTQSKFCKTA FDISIDNGNE
160 170 180 190 200
DLAEILQIAM QNQINTNPES PDTVTIHAAT PQFIIGPGGV VNLTDETGVS
210 220 230 240 250
AVQFGNSSTS VLATLAALAE ASAPLSNSSE TPVVATEEVV TAESVDGAIQ
260 270 280 290 300
QVVSSGGQQV ITIVTDGIQL GNLHSIPTSG MGQPIIVTMP DGQQVLTVPA
310 320 330 340 350
TDIAEETVIS EEPPAKRQCM EIIESRVECA EIEEREALQK QLDEANREAQ
360 370 380
KYRQQLLKKE QEAEAYRQKL EAMTRIQTNK EAV
Length:383
Mass (Da):41,358
Last modified:September 19, 2002 - v2
Checksum:iE3BCE5A05B1AF5A9
GO
Isoform 2 (identifier: Q00420-2) [UniParc]FASTAAdd to basket

Also known as: GABP-beta-2 subunit, GABBP2

The sequence of this isoform differs from the canonical sequence as follows:
     334-383: EREALQKQLDEANREAQKYRQQLLKKEQEAEAYRQKLEAMTRIQTNKEAV → VRSLIPGVFCCSHPK

Show »
Length:348
Mass (Da):36,967
Checksum:i959E2B8504F1292D
GO
Isoform 3 (identifier: Q00420-3) [UniParc]FASTAAdd to basket

Also known as: GABP-beta-1

The sequence of this isoform differs from the canonical sequence as follows:
     233-233: Missing.

Note: May be due to competing acceptor splice sites.
Show »
Length:382
Mass (Da):41,258
Checksum:i0A5FE3F71D4227AF
GO
Isoform 4 (identifier: Q00420-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     233-233: V → G
     234-383: Missing.

Note: May be due to an intron retention. No experimental confirmation available.
Show »
Length:233
Mass (Da):24,803
Checksum:i4E7D67CF5B2D8250
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei233 – 2331Missing in isoform 3. 1 PublicationVSP_009333
Alternative sequencei233 – 2331V → G in isoform 4. 1 PublicationVSP_009334
Alternative sequencei234 – 383150Missing in isoform 4. 1 PublicationVSP_009335Add
BLAST
Alternative sequencei334 – 38350EREAL…NKEAV → VRSLIPGVFCCSHPK in isoform 2. 1 PublicationVSP_009336Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M74516 mRNA. Translation: AAA53031.1.
M74517 mRNA. Translation: AAA53032.1.
AK040722 mRNA. Translation: BAC30682.1.
AK052828 mRNA. Translation: BAC35165.1.
AL844555 Genomic DNA. Translation: CAM18699.1.
AL844555 Genomic DNA. Translation: CAM18701.1.
BC013558 mRNA. Translation: AAH13558.1.
CCDSiCCDS16685.1. [Q00420-3]
CCDS16686.1. [Q00420-2]
CCDS71135.1. [Q00420-4]
CCDS71137.1. [Q00420-1]
PIRiB40858.
C40858.
RefSeqiNP_001258396.1. NM_001271467.1. [Q00420-3]
NP_001258397.1. NM_001271468.1. [Q00420-1]
NP_001258421.1. NM_001271492.1. [Q00420-4]
NP_034379.1. NM_010249.2. [Q00420-2]
NP_997552.1. NM_207669.2. [Q00420-3]
XP_006498820.1. XM_006498757.2. [Q00420-1]
XP_006498821.1. XM_006498758.2. [Q00420-1]
XP_006498822.1. XM_006498759.2. [Q00420-1]
XP_006498823.1. XM_006498760.2. [Q00420-1]
XP_006498824.1. XM_006498761.2. [Q00420-3]
UniGeneiMm.293266.

Genome annotation databases

EnsembliENSMUST00000089745; ENSMUSP00000087177; ENSMUSG00000027361. [Q00420-4]
ENSMUST00000103226; ENSMUSP00000099516; ENSMUSG00000027361. [Q00420-2]
ENSMUST00000103227; ENSMUSP00000099517; ENSMUSG00000027361. [Q00420-3]
ENSMUST00000110424; ENSMUSP00000106054; ENSMUSG00000027361. [Q00420-3]
ENSMUST00000110425; ENSMUSP00000106055; ENSMUSG00000027361. [Q00420-1]
GeneIDi14391.
KEGGimmu:14391.
UCSCiuc008mdv.2. mouse. [Q00420-1]
uc008mdx.2. mouse. [Q00420-2]
uc008mdz.2. mouse. [Q00420-4]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M74516 mRNA. Translation: AAA53031.1.
M74517 mRNA. Translation: AAA53032.1.
AK040722 mRNA. Translation: BAC30682.1.
AK052828 mRNA. Translation: BAC35165.1.
AL844555 Genomic DNA. Translation: CAM18699.1.
AL844555 Genomic DNA. Translation: CAM18701.1.
BC013558 mRNA. Translation: AAH13558.1.
CCDSiCCDS16685.1. [Q00420-3]
CCDS16686.1. [Q00420-2]
CCDS71135.1. [Q00420-4]
CCDS71137.1. [Q00420-1]
PIRiB40858.
C40858.
RefSeqiNP_001258396.1. NM_001271467.1. [Q00420-3]
NP_001258397.1. NM_001271468.1. [Q00420-1]
NP_001258421.1. NM_001271492.1. [Q00420-4]
NP_034379.1. NM_010249.2. [Q00420-2]
NP_997552.1. NM_207669.2. [Q00420-3]
XP_006498820.1. XM_006498757.2. [Q00420-1]
XP_006498821.1. XM_006498758.2. [Q00420-1]
XP_006498822.1. XM_006498759.2. [Q00420-1]
XP_006498823.1. XM_006498760.2. [Q00420-1]
XP_006498824.1. XM_006498761.2. [Q00420-3]
UniGeneiMm.293266.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1AWCX-ray2.15B5-157[»]
ProteinModelPortaliQ00420.
SMRiQ00420. Positions 5-281.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

DIPiDIP-321N.
IntActiQ00420. 1 interaction.
MINTiMINT-1531801.
STRINGi10090.ENSMUSP00000099517.

PTM databases

iPTMnetiQ00420.
PhosphoSiteiQ00420.

Proteomic databases

EPDiQ00420.
MaxQBiQ00420.
PaxDbiQ00420.
PRIDEiQ00420.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000089745; ENSMUSP00000087177; ENSMUSG00000027361. [Q00420-4]
ENSMUST00000103226; ENSMUSP00000099516; ENSMUSG00000027361. [Q00420-2]
ENSMUST00000103227; ENSMUSP00000099517; ENSMUSG00000027361. [Q00420-3]
ENSMUST00000110424; ENSMUSP00000106054; ENSMUSG00000027361. [Q00420-3]
ENSMUST00000110425; ENSMUSP00000106055; ENSMUSG00000027361. [Q00420-1]
GeneIDi14391.
KEGGimmu:14391.
UCSCiuc008mdv.2. mouse. [Q00420-1]
uc008mdx.2. mouse. [Q00420-2]
uc008mdz.2. mouse. [Q00420-4]

Organism-specific databases

CTDi2553.
MGIiMGI:95611. Gabpb1.

Phylogenomic databases

eggNOGiENOG410IE1V. Eukaryota.
COG0666. LUCA.
GeneTreeiENSGT00840000129826.
HOVERGENiHBG051686.
InParanoidiQ00420.
KOiK09454.
OMAiHAQSKFC.
OrthoDBiEOG7ZD1W2.
PhylomeDBiQ00420.
TreeFamiTF326036.

Enzyme and pathway databases

ReactomeiR-MMU-2151201. Transcriptional activation of mitochondrial biogenesis.

Miscellaneous databases

EvolutionaryTraceiQ00420.
NextBioi285917.
PROiQ00420.
SOURCEiSearch...

Gene expression databases

BgeeiQ00420.
CleanExiMM_GABPB1.
MM_GABPB2.
ExpressionAtlasiQ00420. baseline and differential.
GenevisibleiQ00420. MM.

Family and domain databases

Gene3Di1.25.40.20. 2 hits.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
[Graphical view]
PfamiPF12796. Ank_2. 1 hit.
[Graphical view]
PRINTSiPR01415. ANKYRIN.
SMARTiSM00248. ANK. 4 hits.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 3 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of Ets- and notch-related subunits in GA binding protein."
    Lamarco K., Thompson C.C., Byers B.P., Walton E.M., McKnight S.L.
    Science 253:789-792(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3).
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4).
    Strain: C57BL/6J.
    Tissue: Aorta, Mammary gland and Vein.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  5. "The structure of GABPalpha/beta: an ETS domain-ankyrin repeat heterodimer bound to DNA."
    Batchelor A.H., Piper D.E., de la Brousse F.C., McKnight S.L., Wolberger C.
    Science 279:1037-1041(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.15 ANGSTROMS) OF 5-157.

Entry informationi

Entry nameiGABP1_MOUSE
AccessioniPrimary (citable) accession number: Q00420
Secondary accession number(s): A2AQ68
, A2AQ70, Q00421, Q8BS31, Q91YZ0, Q9QVV2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 1992
Last sequence update: September 19, 2002
Last modified: May 11, 2016
This is version 163 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.