Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

55 kDa erythrocyte membrane protein

Gene

MPP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Essential regulator of neutrophil polarity. Regulates neutrophil polarization by regulating AKT1 phosphorylation through a mechanism that is independent of PIK3CG activity (By similarity).By similarity

GO - Molecular functioni

  • guanylate kinase activity Source: ProtInc

GO - Biological processi

  • regulation of neutrophil chemotaxis Source: UniProtKB
  • signal transduction Source: ProtInc
Complete GO annotation...

Enzyme and pathway databases

BioCyciZFISH:ENSG00000130830-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
55 kDa erythrocyte membrane protein
Short name:
p55
Alternative name(s):
Membrane protein, palmitoylated 1
Gene namesi
Name:MPP1
Synonyms:DXS552E, EMP55
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

HGNCiHGNC:7219. MPP1.

Subcellular locationi

  • Membrane; Lipid-anchor
  • Cell projectionstereocilium By similarity

  • Note: Colocalizes with WHRN at stereocilium tip during hair cell development (By similarity). Colocalizes with MPP5 in the retina, at the outer limiting membrane (OLM). Colocalizes with WHRN in the retina, at the outer limiting membrane (OLM), outer plexifirm layer (OPL), basal bodies and at the connecting cilium (CC). Colocalizes with NF2 in non-myelin-forming Schwann cells.By similarity

GO - Cellular componenti

  • cortical cytoskeleton Source: Ensembl
  • integral component of plasma membrane Source: ProtInc
  • intracellular Source: LIFEdb
  • membrane Source: UniProtKB
  • stereocilium Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi4354.
OpenTargetsiENSG00000130830.
PharmGKBiPA30924.

Polymorphism and mutation databases

BioMutaiMPP1.
DMDMi1346575.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00000945652 – 46655 kDa erythrocyte membrane proteinAdd BLAST465

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylthreonineCombined sources1
Modified residuei13PhosphoserineCombined sources1
Modified residuei19PhosphoserineCombined sources1
Modified residuei49PhosphothreonineCombined sources1
Modified residuei52PhosphoserineBy similarity1
Modified residuei57PhosphoserineCombined sources1
Modified residuei110PhosphoserineCombined sources1
Modified residuei243PhosphoserineCombined sources1

Post-translational modificationi

Extensively palmitoylated by ZDHHC17, palmitoylation is essential for membrane organization and is crucial for proper erythrocytes morphology.2 Publications

Keywords - PTMi

Acetylation, Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

EPDiQ00013.
PaxDbiQ00013.
PeptideAtlasiQ00013.
PRIDEiQ00013.

PTM databases

iPTMnetiQ00013.
PhosphoSitePlusiQ00013.
SwissPalmiQ00013.

Expressioni

Tissue specificityi

Ubiquitous.1 Publication

Gene expression databases

BgeeiENSG00000130830.
CleanExiHS_MPP1.
ExpressionAtlasiQ00013. baseline and differential.
GenevisibleiQ00013. HS.

Organism-specific databases

HPAiHPA000167.
HPA000884.

Interactioni

Subunit structurei

Heterodimer with MPP5. Interacts with DLG5 and NF2. Interacts (via guanylate kinase-like domain) with WHRN (via third PDZ domain).2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
AMOTL2Q9Y2J43EBI-711788,EBI-746752
DNPEPQ9ULA05EBI-711788,EBI-748356
KLHL12Q53G595EBI-711788,EBI-740929
OPTNQ96CV92EBI-711788,EBI-748974

Protein-protein interaction databases

BioGridi110494. 44 interactors.
IntActiQ00013. 41 interactors.
MINTiMINT-1402557.
STRINGi9606.ENSP00000358547.

Structurei

Secondary structure

1466
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi70 – 76Combined sources7
Beta strandi78 – 80Combined sources3
Beta strandi83 – 88Combined sources6
Beta strandi94 – 99Combined sources6
Beta strandi101 – 103Combined sources3
Helixi104 – 108Combined sources5
Beta strandi116 – 120Combined sources5
Turni125 – 127Combined sources3
Helixi131 – 139Combined sources9
Beta strandi142 – 149Combined sources8
Beta strandi284 – 288Combined sources5
Helixi295 – 305Combined sources11
Turni307 – 309Combined sources3
Helixi336 – 344Combined sources9
Beta strandi348 – 354Combined sources7
Beta strandi357 – 362Combined sources6
Helixi363 – 371Combined sources9
Beta strandi375 – 379Combined sources5
Helixi382 – 384Combined sources3
Helixi385 – 388Combined sources4
Turni391 – 393Combined sources3
Beta strandi395 – 402Combined sources8
Beta strandi405 – 407Combined sources3
Helixi410 – 426Combined sources17
Helixi427 – 429Combined sources3
Beta strandi431 – 437Combined sources7
Helixi439 – 452Combined sources14

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2EJYNMR-A69-153[»]
2EV8NMR-A69-153[»]
3NEYX-ray2.26A/B/C/D/E/F282-460[»]
ProteinModelPortaliQ00013.
SMRiQ00013.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ00013.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini71 – 152PDZPROSITE-ProRule annotationAdd BLAST82
Domaini158 – 228SH3PROSITE-ProRule annotationAdd BLAST71
Domaini282 – 451Guanylate kinase-likePROSITE-ProRule annotationAdd BLAST170

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni268 – 466Interaction with MPP51 PublicationAdd BLAST199

Sequence similaritiesi

Belongs to the MAGUK family.Curated
Contains 1 guanylate kinase-like domain.PROSITE-ProRule annotation
Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation
Contains 1 SH3 domain.PROSITE-ProRule annotation

Keywords - Domaini

SH3 domain

Phylogenomic databases

eggNOGiKOG0609. Eukaryota.
COG0194. LUCA.
GeneTreeiENSGT00760000118866.
HOGENOMiHOG000233034.
HOVERGENiHBG001858.
InParanoidiQ00013.
OMAiIPNQQSR.
OrthoDBiEOG091G065I.
PhylomeDBiQ00013.
TreeFamiTF314263.

Family and domain databases

Gene3Di2.30.42.10. 1 hit.
3.40.50.300. 2 hits.
InterProiIPR008145. GK/Ca_channel_bsu.
IPR008144. Guanylate_kin-like_dom.
IPR020590. Guanylate_kinase_CS.
IPR027417. P-loop_NTPase.
IPR001478. PDZ.
IPR011511. SH3_2.
IPR001452. SH3_domain.
[Graphical view]
PfamiPF00625. Guanylate_kin. 1 hit.
PF00595. PDZ. 1 hit.
PF07653. SH3_2. 1 hit.
[Graphical view]
SMARTiSM00072. GuKc. 1 hit.
SM00228. PDZ. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 1 hit.
SSF50156. SSF50156. 1 hit.
SSF52540. SSF52540. 1 hit.
PROSITEiPS00856. GUANYLATE_KINASE_1. 1 hit.
PS50052. GUANYLATE_KINASE_2. 1 hit.
PS50106. PDZ. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q00013-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTLKASEGES GGSMHTALSD LYLEHLLQKR SRPEAVSHPL NTVTEDMYTN
60 70 80 90 100
GSPAPGSPAQ VKGQEVRKVR LIQFEKVTEE PMGITLKLNE KQSCTVARIL
110 120 130 140 150
HGGMIHRQGS LHVGDEILEI NGTNVTNHSV DQLQKAMKET KGMISLKVIP
160 170 180 190 200
NQQSRLPALQ MFMRAQFDYD PKKDNLIPCK EAGLKFATGD IIQIINKDDS
210 220 230 240 250
NWWQGRVEGS SKESAGLIPS PELQEWRVAS MAQSAPSEAP SCSPFGKKKK
260 270 280 290 300
YKDKYLAKHS SIFDQLDVVS YEEVVRLPAF KRKTLVLIGA SGVGRSHIKN
310 320 330 340 350
ALLSQNPEKF VYPVPYTTRP PRKSEEDGKE YHFISTEEMT RNISANEFLE
360 370 380 390 400
FGSYQGNMFG TKFETVHQIH KQNKIAILDI EPQTLKIVRT AELSPFIVFI
410 420 430 440 450
APTDQGTQTE ALQQLQKDSE AIRSQYAHYF DLSLVNNGVD ETLKKLQEAF
460
DQACSSPQWV PVSWVY
Length:466
Mass (Da):52,296
Last modified:February 1, 1996 - v2
Checksum:iDC68AA68EF48A26E
GO
Isoform 2 (identifier: Q00013-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MTLKASEGESGGSMHTALSDLYLEHLLQKRSRPE → MESW

Note: No experimental confirmation available.
Show »
Length:436
Mass (Da):49,075
Checksum:iD70881879A5C497A
GO
Isoform 3 (identifier: Q00013-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     161-180: Missing.

Note: No experimental confirmation available.
Show »
Length:446
Mass (Da):49,854
Checksum:iC935FBFA6E563CE1
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti204Q → R in AAV35469 (Ref. 5) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_011914448E → Q.Corresponds to variant rs14092dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0426751 – 34MTLKA…RSRPE → MESW in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_044634161 – 180Missing in isoform 3. 1 PublicationAdd BLAST20

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M64925 mRNA. Translation: AAA60059.1.
M87059 Genomic DNA. Translation: AAA60060.1.
U39611 Genomic DNA. Translation: AAD14835.1.
AY423731 mRNA. Translation: AAS00494.1.
AK290246 mRNA. Translation: BAF82935.1.
AK303111 mRNA. Translation: BAG64217.1.
AK312296 mRNA. Translation: BAG35223.1.
AK315957 mRNA. Translation: BAH14328.1.
AY634686 mRNA. Translation: AAV35469.1.
AC109993 Genomic DNA. No translation available.
CH471172 Genomic DNA. Translation: EAW72655.1.
CH471172 Genomic DNA. Translation: EAW72656.1.
CH471172 Genomic DNA. Translation: EAW72660.1.
BC002392 mRNA. Translation: AAH02392.1.
CCDSiCCDS14762.1. [Q00013-1]
CCDS55544.1. [Q00013-2]
CCDS55545.1. [Q00013-3]
PIRiA39599.
RefSeqiNP_001159932.1. NM_001166460.1.
NP_001159933.1. NM_001166461.1. [Q00013-3]
NP_001159934.1. NM_001166462.1. [Q00013-2]
NP_002427.1. NM_002436.3. [Q00013-1]
UniGeneiHs.496984.

Genome annotation databases

EnsembliENST00000369534; ENSP00000358547; ENSG00000130830. [Q00013-1]
ENST00000393531; ENSP00000377165; ENSG00000130830. [Q00013-3]
ENST00000413259; ENSP00000400155; ENSG00000130830. [Q00013-2]
GeneIDi4354.
KEGGihsa:4354.
UCSCiuc004fmp.3. human. [Q00013-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M64925 mRNA. Translation: AAA60059.1.
M87059 Genomic DNA. Translation: AAA60060.1.
U39611 Genomic DNA. Translation: AAD14835.1.
AY423731 mRNA. Translation: AAS00494.1.
AK290246 mRNA. Translation: BAF82935.1.
AK303111 mRNA. Translation: BAG64217.1.
AK312296 mRNA. Translation: BAG35223.1.
AK315957 mRNA. Translation: BAH14328.1.
AY634686 mRNA. Translation: AAV35469.1.
AC109993 Genomic DNA. No translation available.
CH471172 Genomic DNA. Translation: EAW72655.1.
CH471172 Genomic DNA. Translation: EAW72656.1.
CH471172 Genomic DNA. Translation: EAW72660.1.
BC002392 mRNA. Translation: AAH02392.1.
CCDSiCCDS14762.1. [Q00013-1]
CCDS55544.1. [Q00013-2]
CCDS55545.1. [Q00013-3]
PIRiA39599.
RefSeqiNP_001159932.1. NM_001166460.1.
NP_001159933.1. NM_001166461.1. [Q00013-3]
NP_001159934.1. NM_001166462.1. [Q00013-2]
NP_002427.1. NM_002436.3. [Q00013-1]
UniGeneiHs.496984.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2EJYNMR-A69-153[»]
2EV8NMR-A69-153[»]
3NEYX-ray2.26A/B/C/D/E/F282-460[»]
ProteinModelPortaliQ00013.
SMRiQ00013.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110494. 44 interactors.
IntActiQ00013. 41 interactors.
MINTiMINT-1402557.
STRINGi9606.ENSP00000358547.

PTM databases

iPTMnetiQ00013.
PhosphoSitePlusiQ00013.
SwissPalmiQ00013.

Polymorphism and mutation databases

BioMutaiMPP1.
DMDMi1346575.

Proteomic databases

EPDiQ00013.
PaxDbiQ00013.
PeptideAtlasiQ00013.
PRIDEiQ00013.

Protocols and materials databases

DNASUi4354.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000369534; ENSP00000358547; ENSG00000130830. [Q00013-1]
ENST00000393531; ENSP00000377165; ENSG00000130830. [Q00013-3]
ENST00000413259; ENSP00000400155; ENSG00000130830. [Q00013-2]
GeneIDi4354.
KEGGihsa:4354.
UCSCiuc004fmp.3. human. [Q00013-1]

Organism-specific databases

CTDi4354.
DisGeNETi4354.
GeneCardsiMPP1.
HGNCiHGNC:7219. MPP1.
HPAiHPA000167.
HPA000884.
MIMi305360. gene.
neXtProtiNX_Q00013.
OpenTargetsiENSG00000130830.
PharmGKBiPA30924.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0609. Eukaryota.
COG0194. LUCA.
GeneTreeiENSGT00760000118866.
HOGENOMiHOG000233034.
HOVERGENiHBG001858.
InParanoidiQ00013.
OMAiIPNQQSR.
OrthoDBiEOG091G065I.
PhylomeDBiQ00013.
TreeFamiTF314263.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000130830-MONOMER.

Miscellaneous databases

ChiTaRSiMPP1. human.
EvolutionaryTraceiQ00013.
GeneWikiiMPP1.
GenomeRNAii4354.
PROiQ00013.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000130830.
CleanExiHS_MPP1.
ExpressionAtlasiQ00013. baseline and differential.
GenevisibleiQ00013. HS.

Family and domain databases

Gene3Di2.30.42.10. 1 hit.
3.40.50.300. 2 hits.
InterProiIPR008145. GK/Ca_channel_bsu.
IPR008144. Guanylate_kin-like_dom.
IPR020590. Guanylate_kinase_CS.
IPR027417. P-loop_NTPase.
IPR001478. PDZ.
IPR011511. SH3_2.
IPR001452. SH3_domain.
[Graphical view]
PfamiPF00625. Guanylate_kin. 1 hit.
PF00595. PDZ. 1 hit.
PF07653. SH3_2. 1 hit.
[Graphical view]
SMARTiSM00072. GuKc. 1 hit.
SM00228. PDZ. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 1 hit.
SSF50156. SSF50156. 1 hit.
SSF52540. SSF52540. 1 hit.
PROSITEiPS00856. GUANYLATE_KINASE_1. 1 hit.
PS50052. GUANYLATE_KINASE_2. 1 hit.
PS50106. PDZ. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiEM55_HUMAN
AccessioniPrimary (citable) accession number: Q00013
Secondary accession number(s): B4DZV5
, G3XAI1, Q2TSB6, Q5J7V5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 1992
Last sequence update: February 1, 1996
Last modified: November 30, 2016
This is version 175 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.