Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

55 kDa erythrocyte membrane protein

Gene

MPP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Essential regulator of neutrophil polarity. Regulates neutrophil polarization by regulating AKT1 phosphorylation through a mechanism that is independent of PIK3CG activity (By similarity).By similarity

GO - Molecular functioni

  • guanylate kinase activity Source: ProtInc

GO - Biological processi

  • regulation of neutrophil chemotaxis Source: UniProtKB
  • signal transduction Source: ProtInc

Names & Taxonomyi

Protein namesi
Recommended name:
55 kDa erythrocyte membrane protein
Short name:
p55
Alternative name(s):
Membrane protein, palmitoylated 1
Gene namesi
Name:MPP1
Synonyms:DXS552E, EMP55
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi

Organism-specific databases

EuPathDBiHostDB:ENSG00000130830.14
HGNCiHGNC:7219 MPP1
MIMi305360 gene
neXtProtiNX_Q00013

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi4354
OpenTargetsiENSG00000130830
PharmGKBiPA30924

Polymorphism and mutation databases

BioMutaiMPP1
DMDMi1346575

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00000945652 – 46655 kDa erythrocyte membrane proteinAdd BLAST465

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylthreonineCombined sources1
Modified residuei13PhosphoserineCombined sources1
Modified residuei19PhosphoserineCombined sources1
Modified residuei49PhosphothreonineCombined sources1
Modified residuei52PhosphoserineBy similarity1
Modified residuei57PhosphoserineCombined sources1
Modified residuei110PhosphoserineCombined sources1
Modified residuei243PhosphoserineCombined sources1

Post-translational modificationi

Extensively palmitoylated by ZDHHC17, palmitoylation is essential for membrane organization and is crucial for proper erythrocytes morphology.2 Publications

Keywords - PTMi

Acetylation, Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

EPDiQ00013
PaxDbiQ00013
PeptideAtlasiQ00013
PRIDEiQ00013

PTM databases

iPTMnetiQ00013
PhosphoSitePlusiQ00013
SwissPalmiQ00013

Expressioni

Tissue specificityi

Ubiquitous.1 Publication

Gene expression databases

BgeeiENSG00000130830
CleanExiHS_MPP1
ExpressionAtlasiQ00013 baseline and differential
GenevisibleiQ00013 HS

Organism-specific databases

HPAiHPA000167

Interactioni

Subunit structurei

Heterodimer with MPP5. Interacts with DLG5 and NF2. Interacts (via guanylate kinase-like domain) with WHRN (via third PDZ domain).2 Publications

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi110494, 48 interactors
CORUMiQ00013
ELMiQ00013
IntActiQ00013, 59 interactors
MINTiQ00013
STRINGi9606.ENSP00000358547

Structurei

Secondary structure

1466
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi70 – 76Combined sources7
Beta strandi78 – 80Combined sources3
Beta strandi83 – 88Combined sources6
Beta strandi94 – 99Combined sources6
Beta strandi101 – 103Combined sources3
Helixi104 – 108Combined sources5
Beta strandi116 – 120Combined sources5
Turni125 – 127Combined sources3
Helixi131 – 139Combined sources9
Beta strandi142 – 149Combined sources8
Beta strandi284 – 288Combined sources5
Helixi295 – 305Combined sources11
Turni307 – 309Combined sources3
Helixi336 – 344Combined sources9
Beta strandi348 – 354Combined sources7
Beta strandi357 – 362Combined sources6
Helixi363 – 371Combined sources9
Beta strandi375 – 379Combined sources5
Helixi382 – 384Combined sources3
Helixi385 – 388Combined sources4
Turni391 – 393Combined sources3
Beta strandi395 – 402Combined sources8
Beta strandi405 – 407Combined sources3
Helixi410 – 426Combined sources17
Helixi427 – 429Combined sources3
Beta strandi431 – 437Combined sources7
Helixi439 – 452Combined sources14

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2EJYNMR-A69-153[»]
2EV8NMR-A69-153[»]
3NEYX-ray2.26A/B/C/D/E/F282-460[»]
ProteinModelPortaliQ00013
SMRiQ00013
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ00013

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini71 – 152PDZPROSITE-ProRule annotationAdd BLAST82
Domaini158 – 228SH3PROSITE-ProRule annotationAdd BLAST71
Domaini282 – 451Guanylate kinase-likePROSITE-ProRule annotationAdd BLAST170

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni268 – 466Interaction with MPP51 PublicationAdd BLAST199

Sequence similaritiesi

Belongs to the MAGUK family.Curated

Keywords - Domaini

SH3 domain

Phylogenomic databases

eggNOGiKOG0609 Eukaryota
COG0194 LUCA
GeneTreeiENSGT00760000118866
HOGENOMiHOG000233034
HOVERGENiHBG001858
InParanoidiQ00013
KOiK21880
OMAiFVYPAPY
OrthoDBiEOG091G065I
PhylomeDBiQ00013
TreeFamiTF314263

Family and domain databases

CDDicd12080 SH3_MPP1, 1 hit
InterProiView protein in InterPro
IPR008145 GK/Ca_channel_bsu
IPR008144 Guanylate_kin-like_dom
IPR020590 Guanylate_kinase_CS
IPR035475 MPP1_SH3
IPR027417 P-loop_NTPase
IPR001478 PDZ
IPR036034 PDZ_sf
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
PfamiView protein in Pfam
PF00625 Guanylate_kin, 1 hit
PF00595 PDZ, 1 hit
PF07653 SH3_2, 1 hit
SMARTiView protein in SMART
SM00072 GuKc, 1 hit
SM00228 PDZ, 1 hit
SM00326 SH3, 1 hit
SUPFAMiSSF50044 SSF50044, 1 hit
SSF50156 SSF50156, 1 hit
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS00856 GUANYLATE_KINASE_1, 1 hit
PS50052 GUANYLATE_KINASE_2, 1 hit
PS50106 PDZ, 1 hit
PS50002 SH3, 1 hit

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q00013-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTLKASEGES GGSMHTALSD LYLEHLLQKR SRPEAVSHPL NTVTEDMYTN
60 70 80 90 100
GSPAPGSPAQ VKGQEVRKVR LIQFEKVTEE PMGITLKLNE KQSCTVARIL
110 120 130 140 150
HGGMIHRQGS LHVGDEILEI NGTNVTNHSV DQLQKAMKET KGMISLKVIP
160 170 180 190 200
NQQSRLPALQ MFMRAQFDYD PKKDNLIPCK EAGLKFATGD IIQIINKDDS
210 220 230 240 250
NWWQGRVEGS SKESAGLIPS PELQEWRVAS MAQSAPSEAP SCSPFGKKKK
260 270 280 290 300
YKDKYLAKHS SIFDQLDVVS YEEVVRLPAF KRKTLVLIGA SGVGRSHIKN
310 320 330 340 350
ALLSQNPEKF VYPVPYTTRP PRKSEEDGKE YHFISTEEMT RNISANEFLE
360 370 380 390 400
FGSYQGNMFG TKFETVHQIH KQNKIAILDI EPQTLKIVRT AELSPFIVFI
410 420 430 440 450
APTDQGTQTE ALQQLQKDSE AIRSQYAHYF DLSLVNNGVD ETLKKLQEAF
460
DQACSSPQWV PVSWVY
Length:466
Mass (Da):52,296
Last modified:February 1, 1996 - v2
Checksum:iDC68AA68EF48A26E
GO
Isoform 2 (identifier: Q00013-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MTLKASEGESGGSMHTALSDLYLEHLLQKRSRPE → MESW

Note: No experimental confirmation available.
Show »
Length:436
Mass (Da):49,075
Checksum:iD70881879A5C497A
GO
Isoform 3 (identifier: Q00013-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     161-180: Missing.

Note: No experimental confirmation available.
Show »
Length:446
Mass (Da):49,854
Checksum:iC935FBFA6E563CE1
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti204Q → R in AAV35469 (Ref. 5) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_011914448E → Q. Corresponds to variant dbSNP:rs14092Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0426751 – 34MTLKA…RSRPE → MESW in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_044634161 – 180Missing in isoform 3. 1 PublicationAdd BLAST20

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
M64925 mRNA Translation: AAA60059.1
M87059 Genomic DNA Translation: AAA60060.1
U39611 Genomic DNA Translation: AAD14835.1
AY423731 mRNA Translation: AAS00494.1
AK290246 mRNA Translation: BAF82935.1
AK303111 mRNA Translation: BAG64217.1
AK312296 mRNA Translation: BAG35223.1
AK315957 mRNA Translation: BAH14328.1
AY634686 mRNA Translation: AAV35469.1
AC109993 Genomic DNA No translation available.
CH471172 Genomic DNA Translation: EAW72655.1
CH471172 Genomic DNA Translation: EAW72656.1
CH471172 Genomic DNA Translation: EAW72660.1
BC002392 mRNA Translation: AAH02392.1
CCDSiCCDS14762.1 [Q00013-1]
CCDS55544.1 [Q00013-2]
CCDS55545.1 [Q00013-3]
PIRiA39599
RefSeqiNP_001159932.1, NM_001166460.1
NP_001159933.1, NM_001166461.1 [Q00013-3]
NP_001159934.1, NM_001166462.1 [Q00013-2]
NP_002427.1, NM_002436.3 [Q00013-1]
UniGeneiHs.496984

Genome annotation databases

EnsembliENST00000369534; ENSP00000358547; ENSG00000130830 [Q00013-1]
ENST00000393531; ENSP00000377165; ENSG00000130830 [Q00013-3]
ENST00000413259; ENSP00000400155; ENSG00000130830 [Q00013-2]
GeneIDi4354
KEGGihsa:4354
UCSCiuc004fmp.3 human [Q00013-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiEM55_HUMAN
AccessioniPrimary (citable) accession number: Q00013
Secondary accession number(s): B4DZV5
, G3XAI1, Q2TSB6, Q5J7V5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 1992
Last sequence update: February 1, 1996
Last modified: May 23, 2018
This is version 188 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health