Reviewed,
UniProtKB/Swiss-Prot Q00005 (2ABB_HUMAN)
Last modified
February 9, 2010.
Version 106.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform Alternative name(s): PP2A subunit B isoform beta PP2A subunit B isoform B55-beta PP2A subunit B isoform PR55-beta PP2A subunit B isoform R2-beta | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Complete proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 443 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment. Within the PP2A holoenzyme complex, isoform 2 is required to promote proapoptotic activity By similarity. Isoform 2 regulates neuronal survival through the mitochondrial fission and fusion balance By similarity. |
| Subunit structure | PP2A consists of a common heterodimeric core enzyme, composed of a 36 kDa catalytic subunit (subunit C) and a 65 kDa constant regulatory subunit (PR65 or subunit A), that associates with a variety of regulatory subunits. Proteins that associate with the core dimer include three families of regulatory subunits B (the R2/B/PR55/B55, R3/B''/PR72/PR130/PR59 and R5/B'/B56 families), the 48 kDa variable regulatory subunit, viral proteins, and cell signaling molecules. |
| Subcellular location | Isoform 1: Cytoplasm By similarity. Cytoplasm › cytoskeleton By similarity. Membrane By similarity. Isoform 2: Cytoplasm By similarity. Mitochondrion By similarity. Mitochondrion outer membrane By similarity. Note: Under basal conditions, localizes to both cytosolic and mitochondrial compartments. Relocalizes from the cytosolic to the mitochondrial compartment during apoptosis. Its targeting to the outer mitochondrial membrane (OMM) involves an association with import receptors of the TOM complex and is required to promote proapoptotic activity By similarity. |
| Tissue specificity | Brain. |
| Domain | The N-terminal 26 residues of isoform 2 constitute a cryptic mitochondrial matrix import signal with critical basic and hydrophobic residues, that is necessary and sufficient for targeting the PP2A holoenzyme to the outer mitochondrial membrane (OMM) and does not affect holoenzyme formation or catalytic activity By similarity. The last WD repeat of isoform 2 constitutes a mitochondrial stop-transfer domain that confers resistance to the unfolding step process required for import and therefore prevents PPP2R2B matrix translocation and signal sequence cleavage By similarity. |
| Involvement in disease | Defects in PPP2R2B are the cause of spinocerebellar ataxia type 12 (SCA12) [MIM:604326]. Spinocerebellar ataxia is a clinically and genetically heterogeneous group of cerebellar disorders. Patients show progressive incoordination of gait and often poor coordination of hands, speech and eye movements, due to degeneration of the cerebellum with variable involvement of the brainstem and spinal cord. SCA12 is an autosomal dominant cerebellar ataxia (ADCA). Ref.6 |
| Sequence similarities | Belongs to the phosphatase 2A regulatory subunit B family. Contains 7 WD repeats. |
| Sequence caution | The sequence BAG51642.1 differs from that shown. Reason: Erroneous termination at position 116. Translated as Lys. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Apoptosis |
| Cellular component | Cytoplasm Cytoskeleton Membrane Mitochondrion Mitochondrion outer membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Neurodegeneration Spinocerebellar ataxia |
| Domain | Repeat WD repeat |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | apoptosis Inferred from electronic annotation. Source: UniProtKB-KW signal transductionInferred from electronic annotation. Source: InterPro |
| Cellular component | cytoskeleton Inferred from electronic annotation. Source: UniProtKB-SubCell mitochondrial outer membraneInferred from sequence or structural similarity. Source: UniProtKB protein phosphatase type 2A complexInferred from electronic annotation. Source: InterPro |
| Molecular function | protein phosphatase type 2A regulator activity Ref.1 Traceable author statement. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q00005-1) Also known as: Bbeta; Bbeta1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q00005-2) Also known as: Bbeta2; The sequence of this isoform differs from the canonical sequence as follows: 1-21: MEEDIDTRKINNSFLRDHSYA → MKCFSRYLPYIFRPPNTILSSSCH | ||||||
| Note: Under basal conditions, localizes to both cytosolic and mitochondrial compartments. Relocalizes from the cytosolic to the mitochondrial compartment during apoptosis. Its targeting to the outer mitochondrial membrane (OMM) involves an association with import receptors of the TOM complex and is required to promote proapoptotic activity (By similarity). Contains a cryptic mitochondrial transit peptide at positions 1-26 (By similarity). | ||||||
| Isoform 3 (identifier: Q00005-3) The sequence of this isoform differs from the canonical sequence as follows: 1-21: MEEDIDTRKINNSFLRDHSYA → MIPGIGTLTQDTLWCFSQVKGTIEIGT | ||||||
| Isoform 4 (identifier: Q00005-4) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MVLQPSERHYRDWNHRRLGPWCSPTGSPAPLSCETGCGEGSWILVCRLLVPTQVSLLSM | ||||||
| Isoform 5 (identifier: Q00005-5) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MLLSLPALHLQTSEHHPFFQLPHRRLGPWCSPTGSPAPLSCETGCGEGSWILVCRLLVPTQVSLLSM |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 443 | 443 | Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform | PRO_0000071421 | |||||
Regions | |||||||||
| Repeat | 22 – 61 | 40 | WD 1 | ||||||
| Repeat | 87 – 128 | 42 | WD 2 | ||||||
| Repeat | 171 – 209 | 39 | WD 3 | ||||||
| Repeat | 220 – 260 | 41 | WD 4 | ||||||
| Repeat | 279 – 317 | 39 | WD 5 | ||||||
| Repeat | 334 – 375 | 42 | WD 6 | ||||||
| Repeat | 410 – 442 | 33 | WD 7 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 21 | 21 | MEEDI…DHSYA → MKCFSRYLPYIFRPPNTILS SSCH in isoform 2. | VSP_037976 | |||||
| Alternative sequence | 1 – 21 | 21 | MEEDI…DHSYA → MIPGIGTLTQDTLWCFSQVK GTIEIGT in isoform 3. | VSP_037977 | |||||
| Alternative sequence | 1 | 1 | M → MVLQPSERHYRDWNHRRLGP WCSPTGSPAPLSCETGCGEG SWILVCRLLVPTQVSLLSM in isoform 4. | VSP_037978 | |||||
| Alternative sequence | 1 | 1 | M → MLLSLPALHLQTSEHHPFFQ LPHRRLGPWCSPTGSPAPLS CETGCGEGSWILVCRLLVPT QVSLLSM in isoform 5. | VSP_037979 | |||||
| Natural variant | 36 | 1 | G → V: dbSNP rs11547494. | VAR_051738 | |||||
Experimental info | |||||||||
| Sequence conflict | 22 | 1 | T → A in BAH11838. Ref.2 | ||||||
| Sequence conflict | 109 | 1 | S → F in BAH12040. Ref.2 | ||||||
| Sequence conflict | 163 | 1 | T → S in BI490027. Ref.5 | ||||||
| Sequence conflict | 164 | 1 | P → S in BAF82406. Ref.2 | ||||||
| Sequence conflict | 292 | 1 | S → R in BAH12040. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | M64930 mRNA. Translation: AAA36493.1. AK056192 mRNA. Translation: BAG51642.1. Sequence problems. AK289717 mRNA. Translation: BAF82406.1. AK294659 mRNA. Translation: BAH11838.1. AK295347 mRNA. Translation: BAH12040.1. AC008728 Genomic DNA. No translation available. AC009186 Genomic DNA. No translation available. AC010251 Genomic DNA. No translation available. AC011386 Genomic DNA. No translation available. AC011357 Genomic DNA. No translation available. AC091919 Genomic DNA. No translation available. AC091924 Genomic DNA. No translation available. BC031790 mRNA. Translation: AAH31790.1. Different initiation. BI490027 mRNA. No translation available. |
| IPI | IPI00020850. IPI00376972. IPI00376973. IPI00944548. IPI00944557. |
| PIR | B38351. |
| RefSeq | NP_001120853.1. NP_004567.1. NP_858060.1. NP_858061.1. NP_858062.1. NP_858063.1. NP_858064.1. |
| UniGene | Hs.655213 |
3D structure databases | |
| SMR | Q00005. Positions 24-437, 74-439. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q00005. 171 interactions. |
| STRING | Q00005. |
Proteomic databases | |
| PRIDE | Q00005. |
Genome annotation databases | |
| Ensembl | ENST00000336640; ENSP00000336591; ENSG00000156475; Homo sapiens. [Genome view] ENST00000356826; ENSP00000349283; ENSG00000156475; Homo sapiens. [Genome view] ENST00000394409; ENSP00000377931; ENSG00000156475; Homo sapiens. [Genome view] ENST00000394410; ENSP00000377932; ENSG00000156475; Homo sapiens. [Genome view] ENST00000394411; ENSP00000377933; ENSG00000156475; Homo sapiens. [Genome view] ENST00000394413; ENSP00000377935; ENSG00000156475; Homo sapiens. [Genome view] ENST00000394414; ENSP00000377936; ENSG00000156475; Homo sapiens. [Genome view] ENST00000453001; ENSP00000398779; ENSG00000156475; Homo sapiens. [Genome view] |
| GeneID | 5521. |
| KEGG | hsa:5521. |
| UCSC | uc003loe.1. human. |
Organism-specific databases | |
| CTD | 5521. |
| GeneCards | GC05M145949. |
| H-InvDB | HIX0021292. |
| HGNC | HGNC:9305. PPP2R2B. |
| MIM | 604325. gene. 604326. phenotype. |
| Orphanet | 98762. Ataxia, spinocerebellar, type 12. |
| PharmGKB | PA33669. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG08663. |
| HOVERGEN | Q00005. |
| InParanoid | Q00005. |
| OMA | XDIISTV. |
| OrthoDB | EOG9Q87GQ. |
| PhylomeDB | Q00005. |
Gene expression databases | |
| ArrayExpress | Q00005. |
| Bgee | Q00005. |
| CleanEx | HS_PPP2R2B. |
| Genevestigator | Q00005. |
| GermOnline | ENSG00000156475. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000009. PP2A_PR55. IPR018067. PP2A_PR55_CS. IPR015943. WD40/YVTN_repeat-like_dom. IPR001680. WD40_repeat. IPR011046. WD40_repeat-like_dom. IPR019775. WD40_repeat_CS. IPR019781. WD40_repeat_sg. [Graphical view] |
| Gene3D | G3DSA:2.130.10.10. WD40/YVTN_repeat-like. 1 hit. |
| PANTHER | PTHR11871. Pp2A_PR55. 1 hit. |
| Pfam | PF00400. WD40. 2 hits. [Graphical view] |
| PIRSF | PIRSF037309. PP2A_PR55. 1 hit. |
| PRINTS | PR00600. PP2APR55. |
| SMART | SM00320. WD40. 6 hits. [Graphical view] |
| PROSITE | PS01024. PR55_1. 1 hit. PS01025. PR55_2. 1 hit. PS00678. WD_REPEATS_1. 1 hit. PS50082. WD_REPEATS_2. False negative. PS50294. WD_REPEATS_REGION. False negative. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 21356. |
| SOURCE | Search... |
Entry information
| Entry name | 2ABB_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q00005 Secondary accession number(s): A6NEJ2 B7Z304 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


