Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Armadillo repeat protein deleted in velo-cardio-facial syndrome homolog

Gene

Arvcf

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Involved in protein-protein interactions at adherens junctions.By similarity

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Names & Taxonomyi

Protein namesi
Recommended name:
Armadillo repeat protein deleted in velo-cardio-facial syndrome homolog
Gene namesi
Name:Arvcf
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 16

Organism-specific databases

MGIiMGI:109620. Arvcf.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: MGI
  • nucleus Source: MGI
  • plasma membrane Source: MGI
Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000642951 – 962Armadillo repeat protein deleted in velo-cardio-facial syndrome homologAdd BLAST962

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei103PhosphothreonineBy similarity1
Modified residuei105PhosphothreonineBy similarity1
Modified residuei171Omega-N-methylarginineCombined sources1
Modified residuei269PhosphoserineCombined sources1
Modified residuei334PhosphoserineCombined sources1
Modified residuei337PhosphoserineCombined sources1
Modified residuei345PhosphoserineBy similarity1
Modified residuei347PhosphoserineBy similarity1
Modified residuei607PhosphoserineBy similarity1
Modified residuei643PhosphothreonineCombined sources1
Modified residuei864PhosphoserineBy similarity1
Modified residuei871PhosphoserineBy similarity1
Modified residuei872PhosphothreonineBy similarity1

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

MaxQBiP98203.
PaxDbiP98203.
PeptideAtlasiP98203.
PRIDEiP98203.

PTM databases

iPTMnetiP98203.
PhosphoSitePlusiP98203.
SwissPalmiP98203.

Expressioni

Gene expression databases

BgeeiENSMUSG00000000325.
ExpressionAtlasiP98203. baseline and differential.
GenevisibleiP98203. MM.

Interactioni

Subunit structurei

Interacts (via the extreme C-terminus) with FRMPD2 (via the PDZ 2 domain).

Protein-protein interaction databases

BioGridi198214. 3 interactors.
IntActiP98203. 1 interactor.
MINTiMINT-4123053.
STRINGi10090.ENSMUSP00000087562.

Structurei

3D structure databases

ProteinModelPortaliP98203.
SMRiP98203.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati350 – 389ARM 1Add BLAST40
Repeati392 – 431ARM 2Add BLAST40
Repeati435 – 469ARM 3Add BLAST35
Repeati470 – 510ARM 4Add BLAST41
Repeati528 – 567ARM 5Add BLAST40
Repeati577 – 623ARM 6Add BLAST47
Repeati647 – 687ARM 7Add BLAST41
Repeati700 – 739ARM 8Add BLAST40
Repeati740 – 782ARM 9Add BLAST43
Repeati783 – 827ARM 10Add BLAST45

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili11 – 46Sequence analysisAdd BLAST36

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi608 – 624Nuclear localization signalSequence analysisAdd BLAST17

Sequence similaritiesi

Belongs to the beta-catenin family.Curated
Contains 10 ARM repeats.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

eggNOGiKOG1048. Eukaryota.
ENOG410Y21Q. LUCA.
GeneTreeiENSGT00760000119167.
HOVERGENiHBG004284.
InParanoidiP98203.
OMAiHEVIVPH.
OrthoDBiEOG091G018V.
PhylomeDBiP98203.
TreeFamiTF321877.

Family and domain databases

Gene3Di1.25.10.10. 2 hits.
InterProiIPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR000225. Armadillo.
IPR028444. ARVCF.
IPR028435. Plakophilin/d_Catenin.
[Graphical view]
PANTHERiPTHR10372. PTHR10372. 1 hit.
PTHR10372:SF5. PTHR10372:SF5. 1 hit.
PfamiPF00514. Arm. 4 hits.
[Graphical view]
SMARTiSM00185. ARM. 6 hits.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 2 hits.
PROSITEiPS50176. ARM_REPEAT. 3 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P98203-1) [UniParc]FASTAAdd to basket
Also known as: A1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEDCNVHSAA SILASVKEQE ARFERLTRAL EQERRHVALQ LERAQQPGMS
60 70 80 90 100
SGGMVGSGQP LPMAWQQLVL QEQSPGSQAS LATMPEAPEV LEETVTVEED
110 120 130 140 150
PGTPTSHVSI VTSEDGTTRR TETKVTKTVK TVTTRTVRQV PLGPDGLPLL
160 170 180 190 200
DGGPPLGSFA DGPLDRHYLL RGGGGPAATL SRTYHSSGGG FPDGPESRDI
210 220 230 240 250
PSYGSLSRGL GVRPPRTGLL GPGPGDGCFT LPGRREAFPM GSESGPPSGR
260 270 280 290 300
SLPEHFQAEP YGLEDDTRSL AADDEGGPDL EPDYSTATRR RPEYGRGLRA
310 320 330 340 350
RAFEDTADDA GELIEERPPF PAATAPLAQP ERGSLGSLDR VVRRSPSVDS
360 370 380 390 400
TRKEPRWRDP ELPEVLAMLR HPVDPVKANA AAYLQHLCFE NEGIKRRVRQ
410 420 430 440 450
LRGLPLLVAL LDHPRAEVRR RACGALRNLS YGRDTDNKAA IRDCGGVPAL
460 470 480 490 500
VRLLRAARDN EVRELVTGTL WNLSSYEPLK MVIIDHGLQT LTHEVIVPHS
510 520 530 540 550
GWEREPNEDS KPRDAEWTTV FKNTSGCLRN VSSDGAEARR RLRECEGLVD
560 570 580 590 600
ALLHALQSAV GRKDTDNKSV ENCVCIMRNL SYHVHKEVPG ADRYQEAEPG
610 620 630 640 650
IPGSTTSQRR RKDDASCFGG KKAKEEWFHQ GKKDAEMDRN FDTLDLPKRT
660 670 680 690 700
EAAKGFELLY QPEVVRLYLS LLTESRNFNT LEAAAGALQN LSAGNWTWAT
710 720 730 740 750
YIRATVRKER GLPVLVELLQ SETDKVVRAV AIALRNLSLD QRNKDLIGSY
760 770 780 790 800
AMTELVRNVR NAQAPAHPSA HLEEDTVVAV LNTIHEIVSD SLDNARSLLQ
810 820 830 840 850
ARGVPALVAL VASSQSVREA KAASHVLQTV WSYKELRGAL QRDGWTKSRF
860 870 880 890 900
QSASTAKGPK GTPSSGGFDD STLPLVDKSL DGEKSNTRDV IPMDTLGPDG
910 920 930 940 950
YATVDRRERR TLGSDSTGDT SEKELLRPDP GRKAPPPGPS RPSVRLVDAV
960
GDTKPQPVDS WV
Length:962
Mass (Da):105,066
Last modified:August 2, 2005 - v2
Checksum:i8F43E9DC34709406
GO
Isoform 2 (identifier: P98203-2) [UniParc]FASTAAdd to basket
Also known as: A2

The sequence of this isoform differs from the canonical sequence as follows:
     625-630: Missing.

Show »
Length:956
Mass (Da):104,209
Checksum:i11BA42849409059E
GO
Isoform 3 (identifier: P98203-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     625-630: Missing.
     928-962: PDPGRKAPPPGPSRPSVRLVDAVGDTKPQPVDSWV → VYGQGVYCGP...AGRGPEGPPS

Note: No experimental confirmation available.
Show »
Length:976
Mass (Da):106,241
Checksum:i6C65E0F505F8AF08
GO
Isoform 4 (identifier: P98203-4) [UniParc]FASTAAdd to basket
Also known as: B2

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: MEDCNVHSAA...LPMAWQQLVL → MPAELR
     625-630: Missing.

Show »
Length:892
Mass (Da):97,165
Checksum:i937AA47D6064ED90
GO
Isoform 5 (identifier: P98203-5) [UniParc]FASTAAdd to basket
Also known as: B1

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: MEDCNVHSAA...LPMAWQQLVL → MPAELR

Show »
Length:898
Mass (Da):98,022
Checksum:i0876464C4BF836C6
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti72E → G in AAH56980 (PubMed:15489334).Curated1
Sequence conflicti372P → T in BAC39302 (PubMed:16141072).Curated1
Sequence conflicti504R → L in AAK64214 (Ref. 1) Curated1
Sequence conflicti504R → L in AAK64215 (Ref. 1) Curated1
Sequence conflicti504R → L in AAK64216 (Ref. 1) Curated1
Sequence conflicti504R → L in AAK64217 (Ref. 1) Curated1
Sequence conflicti560V → E in BAC39302 (PubMed:16141072).Curated1
Sequence conflicti761N → K in BAC39302 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0149221 – 70MEDCN…QQLVL → MPAELR in isoform 4 and isoform 5. 2 PublicationsAdd BLAST70
Alternative sequenceiVSP_014923625 – 630Missing in isoform 2, isoform 3 and isoform 4. 3 Publications6
Alternative sequenceiVSP_014924928 – 962PDPGR…VDSWV → VYGQGVYCGPLEKAASTTCV PVSWLHVPASGALAQLFVLR DRIEVAGRGPEGPPS in isoform 3. 1 PublicationAdd BLAST35

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF286212 mRNA. Translation: AAK64214.1.
AF286213 mRNA. Translation: AAK64215.1.
AF286214 mRNA. Translation: AAK64216.1.
AF286215 mRNA. Translation: AAK64217.1.
AK044982 mRNA. Translation: BAC32169.1.
AK051627 mRNA. Translation: BAC34696.1.
AK084886 mRNA. Translation: BAC39302.1.
BC056980 mRNA. Translation: AAH56980.1.
AJ243418 mRNA. No translation available.
CCDSiCCDS28020.1. [P98203-1]
CCDS70693.1. [P98203-2]
CCDS70694.1. [P98203-4]
RefSeqiNP_001258957.1. NM_001272028.1. [P98203-1]
NP_001258958.1. NM_001272029.1. [P98203-2]
NP_001258959.1. NM_001272030.1. [P98203-2]
NP_001258960.1. NM_001272031.1. [P98203-5]
NP_001258961.1. NM_001272032.1. [P98203-4]
NP_258435.2. NM_033474.3. [P98203-1]
UniGeneiMm.293599.

Genome annotation databases

EnsembliENSMUST00000090103; ENSMUSP00000087562; ENSMUSG00000000325. [P98203-1]
ENSMUST00000115610; ENSMUSP00000111273; ENSMUSG00000000325. [P98203-4]
ENSMUST00000115612; ENSMUSP00000111275; ENSMUSG00000000325. [P98203-2]
ENSMUST00000115613; ENSMUSP00000111276; ENSMUSG00000000325. [P98203-1]
ENSMUST00000115614; ENSMUSP00000111278; ENSMUSG00000000325. [P98203-2]
ENSMUST00000184717; ENSMUSP00000139078; ENSMUSG00000098615. [P98203-1]
GeneIDi11877.
KEGGimmu:11877.
UCSCiuc007ynl.2. mouse. [P98203-1]
uc007ynm.2. mouse. [P98203-2]
uc007ynq.2. mouse. [P98203-5]
uc007yns.2. mouse. [P98203-4]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF286212 mRNA. Translation: AAK64214.1.
AF286213 mRNA. Translation: AAK64215.1.
AF286214 mRNA. Translation: AAK64216.1.
AF286215 mRNA. Translation: AAK64217.1.
AK044982 mRNA. Translation: BAC32169.1.
AK051627 mRNA. Translation: BAC34696.1.
AK084886 mRNA. Translation: BAC39302.1.
BC056980 mRNA. Translation: AAH56980.1.
AJ243418 mRNA. No translation available.
CCDSiCCDS28020.1. [P98203-1]
CCDS70693.1. [P98203-2]
CCDS70694.1. [P98203-4]
RefSeqiNP_001258957.1. NM_001272028.1. [P98203-1]
NP_001258958.1. NM_001272029.1. [P98203-2]
NP_001258959.1. NM_001272030.1. [P98203-2]
NP_001258960.1. NM_001272031.1. [P98203-5]
NP_001258961.1. NM_001272032.1. [P98203-4]
NP_258435.2. NM_033474.3. [P98203-1]
UniGeneiMm.293599.

3D structure databases

ProteinModelPortaliP98203.
SMRiP98203.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi198214. 3 interactors.
IntActiP98203. 1 interactor.
MINTiMINT-4123053.
STRINGi10090.ENSMUSP00000087562.

PTM databases

iPTMnetiP98203.
PhosphoSitePlusiP98203.
SwissPalmiP98203.

Proteomic databases

MaxQBiP98203.
PaxDbiP98203.
PeptideAtlasiP98203.
PRIDEiP98203.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000090103; ENSMUSP00000087562; ENSMUSG00000000325. [P98203-1]
ENSMUST00000115610; ENSMUSP00000111273; ENSMUSG00000000325. [P98203-4]
ENSMUST00000115612; ENSMUSP00000111275; ENSMUSG00000000325. [P98203-2]
ENSMUST00000115613; ENSMUSP00000111276; ENSMUSG00000000325. [P98203-1]
ENSMUST00000115614; ENSMUSP00000111278; ENSMUSG00000000325. [P98203-2]
ENSMUST00000184717; ENSMUSP00000139078; ENSMUSG00000098615. [P98203-1]
GeneIDi11877.
KEGGimmu:11877.
UCSCiuc007ynl.2. mouse. [P98203-1]
uc007ynm.2. mouse. [P98203-2]
uc007ynq.2. mouse. [P98203-5]
uc007yns.2. mouse. [P98203-4]

Organism-specific databases

CTDi421.
MGIiMGI:109620. Arvcf.

Phylogenomic databases

eggNOGiKOG1048. Eukaryota.
ENOG410Y21Q. LUCA.
GeneTreeiENSGT00760000119167.
HOVERGENiHBG004284.
InParanoidiP98203.
OMAiHEVIVPH.
OrthoDBiEOG091G018V.
PhylomeDBiP98203.
TreeFamiTF321877.

Miscellaneous databases

PROiP98203.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000000325.
ExpressionAtlasiP98203. baseline and differential.
GenevisibleiP98203. MM.

Family and domain databases

Gene3Di1.25.10.10. 2 hits.
InterProiIPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR000225. Armadillo.
IPR028444. ARVCF.
IPR028435. Plakophilin/d_Catenin.
[Graphical view]
PANTHERiPTHR10372. PTHR10372. 1 hit.
PTHR10372:SF5. PTHR10372:SF5. 1 hit.
PfamiPF00514. Arm. 4 hits.
[Graphical view]
SMARTiSM00185. ARM. 6 hits.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 2 hits.
PROSITEiPS50176. ARM_REPEAT. 3 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiARVC_MOUSE
AccessioniPrimary (citable) accession number: P98203
Secondary accession number(s): Q6PGJ6
, Q8BQ36, Q8BRF2, Q8C3U7, Q924L2, Q924L3, Q924L4, Q924L5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: August 2, 2005
Last modified: November 2, 2016
This is version 126 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.