Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Armadillo repeat protein deleted in velo-cardio-facial syndrome homolog

Gene

Arvcf

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Involved in protein-protein interactions at adherens junctions.By similarity

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Names & Taxonomyi

Protein namesi
Recommended name:
Armadillo repeat protein deleted in velo-cardio-facial syndrome homolog
Gene namesi
Name:Arvcf
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 16

Organism-specific databases

MGIiMGI:109620. Arvcf.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: MGI
  • nucleus Source: MGI
  • plasma membrane Source: MGI
Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 962962Armadillo repeat protein deleted in velo-cardio-facial syndrome homologPRO_0000064295Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei103 – 1031PhosphothreonineBy similarity
Modified residuei105 – 1051PhosphothreonineBy similarity
Modified residuei269 – 2691PhosphoserineCombined sources
Modified residuei334 – 3341PhosphoserineCombined sources
Modified residuei337 – 3371PhosphoserineCombined sources
Modified residuei345 – 3451PhosphoserineBy similarity
Modified residuei347 – 3471PhosphoserineBy similarity
Modified residuei607 – 6071PhosphoserineBy similarity
Modified residuei643 – 6431PhosphothreonineCombined sources
Modified residuei864 – 8641PhosphoserineBy similarity
Modified residuei871 – 8711PhosphoserineBy similarity
Modified residuei872 – 8721PhosphothreonineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiP98203.
PaxDbiP98203.
PRIDEiP98203.

PTM databases

iPTMnetiP98203.
PhosphoSiteiP98203.
SwissPalmiP98203.

Expressioni

Gene expression databases

BgeeiP98203.
ExpressionAtlasiP98203. baseline and differential.
GenevisibleiP98203. MM.

Interactioni

Subunit structurei

Interacts (via the extreme C-terminus) with FRMPD2 (via the PDZ 2 domain).

Protein-protein interaction databases

BioGridi198214. 3 interactions.
IntActiP98203. 1 interaction.
MINTiMINT-4123053.
STRINGi10090.ENSMUSP00000087562.

Structurei

3D structure databases

ProteinModelPortaliP98203.
SMRiP98203. Positions 355-834.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati350 – 38940ARM 1Add
BLAST
Repeati392 – 43140ARM 2Add
BLAST
Repeati435 – 46935ARM 3Add
BLAST
Repeati470 – 51041ARM 4Add
BLAST
Repeati528 – 56740ARM 5Add
BLAST
Repeati577 – 62347ARM 6Add
BLAST
Repeati647 – 68741ARM 7Add
BLAST
Repeati700 – 73940ARM 8Add
BLAST
Repeati740 – 78243ARM 9Add
BLAST
Repeati783 – 82745ARM 10Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili11 – 4636Sequence analysisAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi608 – 62417Nuclear localization signalSequence analysisAdd
BLAST

Sequence similaritiesi

Belongs to the beta-catenin family.Curated
Contains 10 ARM repeats.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

eggNOGiKOG1048. Eukaryota.
ENOG410Y21Q. LUCA.
GeneTreeiENSGT00760000119167.
HOVERGENiHBG004284.
InParanoidiP98203.
OMAiHEVIVPH.
OrthoDBiEOG7Z69BM.
PhylomeDBiP98203.
TreeFamiTF321877.

Family and domain databases

Gene3Di1.25.10.10. 2 hits.
InterProiIPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR000225. Armadillo.
IPR028444. ARVCF.
IPR028435. Plakophilin/d_Catenin.
[Graphical view]
PANTHERiPTHR10372. PTHR10372. 1 hit.
PTHR10372:SF5. PTHR10372:SF5. 1 hit.
PfamiPF00514. Arm. 4 hits.
[Graphical view]
SMARTiSM00185. ARM. 6 hits.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 2 hits.
PROSITEiPS50176. ARM_REPEAT. 3 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P98203-1) [UniParc]FASTAAdd to basket

Also known as: A1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEDCNVHSAA SILASVKEQE ARFERLTRAL EQERRHVALQ LERAQQPGMS
60 70 80 90 100
SGGMVGSGQP LPMAWQQLVL QEQSPGSQAS LATMPEAPEV LEETVTVEED
110 120 130 140 150
PGTPTSHVSI VTSEDGTTRR TETKVTKTVK TVTTRTVRQV PLGPDGLPLL
160 170 180 190 200
DGGPPLGSFA DGPLDRHYLL RGGGGPAATL SRTYHSSGGG FPDGPESRDI
210 220 230 240 250
PSYGSLSRGL GVRPPRTGLL GPGPGDGCFT LPGRREAFPM GSESGPPSGR
260 270 280 290 300
SLPEHFQAEP YGLEDDTRSL AADDEGGPDL EPDYSTATRR RPEYGRGLRA
310 320 330 340 350
RAFEDTADDA GELIEERPPF PAATAPLAQP ERGSLGSLDR VVRRSPSVDS
360 370 380 390 400
TRKEPRWRDP ELPEVLAMLR HPVDPVKANA AAYLQHLCFE NEGIKRRVRQ
410 420 430 440 450
LRGLPLLVAL LDHPRAEVRR RACGALRNLS YGRDTDNKAA IRDCGGVPAL
460 470 480 490 500
VRLLRAARDN EVRELVTGTL WNLSSYEPLK MVIIDHGLQT LTHEVIVPHS
510 520 530 540 550
GWEREPNEDS KPRDAEWTTV FKNTSGCLRN VSSDGAEARR RLRECEGLVD
560 570 580 590 600
ALLHALQSAV GRKDTDNKSV ENCVCIMRNL SYHVHKEVPG ADRYQEAEPG
610 620 630 640 650
IPGSTTSQRR RKDDASCFGG KKAKEEWFHQ GKKDAEMDRN FDTLDLPKRT
660 670 680 690 700
EAAKGFELLY QPEVVRLYLS LLTESRNFNT LEAAAGALQN LSAGNWTWAT
710 720 730 740 750
YIRATVRKER GLPVLVELLQ SETDKVVRAV AIALRNLSLD QRNKDLIGSY
760 770 780 790 800
AMTELVRNVR NAQAPAHPSA HLEEDTVVAV LNTIHEIVSD SLDNARSLLQ
810 820 830 840 850
ARGVPALVAL VASSQSVREA KAASHVLQTV WSYKELRGAL QRDGWTKSRF
860 870 880 890 900
QSASTAKGPK GTPSSGGFDD STLPLVDKSL DGEKSNTRDV IPMDTLGPDG
910 920 930 940 950
YATVDRRERR TLGSDSTGDT SEKELLRPDP GRKAPPPGPS RPSVRLVDAV
960
GDTKPQPVDS WV
Length:962
Mass (Da):105,066
Last modified:August 2, 2005 - v2
Checksum:i8F43E9DC34709406
GO
Isoform 2 (identifier: P98203-2) [UniParc]FASTAAdd to basket

Also known as: A2

The sequence of this isoform differs from the canonical sequence as follows:
     625-630: Missing.

Show »
Length:956
Mass (Da):104,209
Checksum:i11BA42849409059E
GO
Isoform 3 (identifier: P98203-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     625-630: Missing.
     928-962: PDPGRKAPPPGPSRPSVRLVDAVGDTKPQPVDSWV → VYGQGVYCGP...AGRGPEGPPS

Note: No experimental confirmation available.
Show »
Length:976
Mass (Da):106,241
Checksum:i6C65E0F505F8AF08
GO
Isoform 4 (identifier: P98203-4) [UniParc]FASTAAdd to basket

Also known as: B2

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: MEDCNVHSAA...LPMAWQQLVL → MPAELR
     625-630: Missing.

Show »
Length:892
Mass (Da):97,165
Checksum:i937AA47D6064ED90
GO
Isoform 5 (identifier: P98203-5) [UniParc]FASTAAdd to basket

Also known as: B1

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: MEDCNVHSAA...LPMAWQQLVL → MPAELR

Show »
Length:898
Mass (Da):98,022
Checksum:i0876464C4BF836C6
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti72 – 721E → G in AAH56980 (PubMed:15489334).Curated
Sequence conflicti372 – 3721P → T in BAC39302 (PubMed:16141072).Curated
Sequence conflicti504 – 5041R → L in AAK64214 (Ref. 1) Curated
Sequence conflicti504 – 5041R → L in AAK64215 (Ref. 1) Curated
Sequence conflicti504 – 5041R → L in AAK64216 (Ref. 1) Curated
Sequence conflicti504 – 5041R → L in AAK64217 (Ref. 1) Curated
Sequence conflicti560 – 5601V → E in BAC39302 (PubMed:16141072).Curated
Sequence conflicti761 – 7611N → K in BAC39302 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 7070MEDCN…QQLVL → MPAELR in isoform 4 and isoform 5. 2 PublicationsVSP_014922Add
BLAST
Alternative sequencei625 – 6306Missing in isoform 2, isoform 3 and isoform 4. 3 PublicationsVSP_014923
Alternative sequencei928 – 96235PDPGR…VDSWV → VYGQGVYCGPLEKAASTTCV PVSWLHVPASGALAQLFVLR DRIEVAGRGPEGPPS in isoform 3. 1 PublicationVSP_014924Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF286212 mRNA. Translation: AAK64214.1.
AF286213 mRNA. Translation: AAK64215.1.
AF286214 mRNA. Translation: AAK64216.1.
AF286215 mRNA. Translation: AAK64217.1.
AK044982 mRNA. Translation: BAC32169.1.
AK051627 mRNA. Translation: BAC34696.1.
AK084886 mRNA. Translation: BAC39302.1.
BC056980 mRNA. Translation: AAH56980.1.
AJ243418 mRNA. No translation available.
CCDSiCCDS28020.1. [P98203-1]
CCDS70693.1. [P98203-2]
CCDS70694.1. [P98203-4]
RefSeqiNP_001258957.1. NM_001272028.1. [P98203-1]
NP_001258958.1. NM_001272029.1. [P98203-2]
NP_001258959.1. NM_001272030.1. [P98203-2]
NP_001258960.1. NM_001272031.1. [P98203-5]
NP_001258961.1. NM_001272032.1. [P98203-4]
NP_258435.2. NM_033474.3. [P98203-1]
UniGeneiMm.293599.

Genome annotation databases

EnsembliENSMUST00000090103; ENSMUSP00000087562; ENSMUSG00000000325. [P98203-1]
ENSMUST00000115610; ENSMUSP00000111273; ENSMUSG00000000325. [P98203-4]
ENSMUST00000115612; ENSMUSP00000111275; ENSMUSG00000000325. [P98203-2]
ENSMUST00000115613; ENSMUSP00000111276; ENSMUSG00000000325. [P98203-1]
ENSMUST00000115614; ENSMUSP00000111278; ENSMUSG00000000325. [P98203-2]
ENSMUST00000184717; ENSMUSP00000139078; ENSMUSG00000098615. [P98203-1]
GeneIDi11877.
KEGGimmu:11877.
UCSCiuc007ynl.2. mouse. [P98203-1]
uc007ynm.2. mouse. [P98203-2]
uc007ynq.2. mouse. [P98203-5]
uc007yns.2. mouse. [P98203-4]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF286212 mRNA. Translation: AAK64214.1.
AF286213 mRNA. Translation: AAK64215.1.
AF286214 mRNA. Translation: AAK64216.1.
AF286215 mRNA. Translation: AAK64217.1.
AK044982 mRNA. Translation: BAC32169.1.
AK051627 mRNA. Translation: BAC34696.1.
AK084886 mRNA. Translation: BAC39302.1.
BC056980 mRNA. Translation: AAH56980.1.
AJ243418 mRNA. No translation available.
CCDSiCCDS28020.1. [P98203-1]
CCDS70693.1. [P98203-2]
CCDS70694.1. [P98203-4]
RefSeqiNP_001258957.1. NM_001272028.1. [P98203-1]
NP_001258958.1. NM_001272029.1. [P98203-2]
NP_001258959.1. NM_001272030.1. [P98203-2]
NP_001258960.1. NM_001272031.1. [P98203-5]
NP_001258961.1. NM_001272032.1. [P98203-4]
NP_258435.2. NM_033474.3. [P98203-1]
UniGeneiMm.293599.

3D structure databases

ProteinModelPortaliP98203.
SMRiP98203. Positions 355-834.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi198214. 3 interactions.
IntActiP98203. 1 interaction.
MINTiMINT-4123053.
STRINGi10090.ENSMUSP00000087562.

PTM databases

iPTMnetiP98203.
PhosphoSiteiP98203.
SwissPalmiP98203.

Proteomic databases

MaxQBiP98203.
PaxDbiP98203.
PRIDEiP98203.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000090103; ENSMUSP00000087562; ENSMUSG00000000325. [P98203-1]
ENSMUST00000115610; ENSMUSP00000111273; ENSMUSG00000000325. [P98203-4]
ENSMUST00000115612; ENSMUSP00000111275; ENSMUSG00000000325. [P98203-2]
ENSMUST00000115613; ENSMUSP00000111276; ENSMUSG00000000325. [P98203-1]
ENSMUST00000115614; ENSMUSP00000111278; ENSMUSG00000000325. [P98203-2]
ENSMUST00000184717; ENSMUSP00000139078; ENSMUSG00000098615. [P98203-1]
GeneIDi11877.
KEGGimmu:11877.
UCSCiuc007ynl.2. mouse. [P98203-1]
uc007ynm.2. mouse. [P98203-2]
uc007ynq.2. mouse. [P98203-5]
uc007yns.2. mouse. [P98203-4]

Organism-specific databases

CTDi421.
MGIiMGI:109620. Arvcf.

Phylogenomic databases

eggNOGiKOG1048. Eukaryota.
ENOG410Y21Q. LUCA.
GeneTreeiENSGT00760000119167.
HOVERGENiHBG004284.
InParanoidiP98203.
OMAiHEVIVPH.
OrthoDBiEOG7Z69BM.
PhylomeDBiP98203.
TreeFamiTF321877.

Miscellaneous databases

NextBioi279903.
PROiP98203.
SOURCEiSearch...

Gene expression databases

BgeeiP98203.
ExpressionAtlasiP98203. baseline and differential.
GenevisibleiP98203. MM.

Family and domain databases

Gene3Di1.25.10.10. 2 hits.
InterProiIPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR000225. Armadillo.
IPR028444. ARVCF.
IPR028435. Plakophilin/d_Catenin.
[Graphical view]
PANTHERiPTHR10372. PTHR10372. 1 hit.
PTHR10372:SF5. PTHR10372:SF5. 1 hit.
PfamiPF00514. Arm. 4 hits.
[Graphical view]
SMARTiSM00185. ARM. 6 hits.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 2 hits.
PROSITEiPS50176. ARM_REPEAT. 3 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Developmental expression analysis of Arvcf, a candidate gene for velo-cardio-facial syndrome."
    Saint-Jore B., Puech A., Merscher S., Xu H., Kucherlapati R., Skoultchi A.
    Submitted (JUL-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 4 AND 5).
    Strain: C57BL/6J.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 4 AND 5).
    Strain: C57BL/6J.
    Tissue: Embryonic ganglion and Embryonic lung.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: C57BL/6J.
    Tissue: Brain.
  4. "The armadillo repeat region targets ARVCF to cadherin-based cellular junctions."
    Kaufmann U., Zuppinger C., Waibler Z., Rudiger M., Urbich C., Martin B., Jockusch B.M., Eppenberger H., Starzinski-Powitz A.
    J. Cell Sci. 113:4121-4135(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 8-962 (ISOFORM 3).
  5. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-269, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Embryonic brain.
  6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-269, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  7. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-269; SER-334; SER-337 AND THR-643, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain, Brown adipose tissue, Heart, Kidney, Liver, Lung, Pancreas, Spleen and Testis.

Entry informationi

Entry nameiARVC_MOUSE
AccessioniPrimary (citable) accession number: P98203
Secondary accession number(s): Q6PGJ6
, Q8BQ36, Q8BRF2, Q8C3U7, Q924L2, Q924L3, Q924L4, Q924L5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: August 2, 2005
Last modified: May 11, 2016
This is version 121 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.