Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P98198

- AT8B2_HUMAN

UniProt

P98198 - AT8B2_HUMAN

Protein

Phospholipid-transporting ATPase ID

Gene

ATP8B2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 132 (01 Oct 2014)
      Sequence version 2 (30 Apr 2003)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Catalytic component of a P4-ATPase flippase complex which catalyzes the hydrolysis of ATP coupled to the transport of aminophospholipids from the outer to the inner leaflet of various membranes and ensures the maintenance of asymmetric distribution of phospholipids. Phospholipid translocation seems also to be implicated in vesicle formation and in uptake of lipid signaling molecules Probable.Curated

    Catalytic activityi

    ATP + H2O + phospholipid(Side 1) = ADP + phosphate + phospholipid(Side 2).

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei411 – 41114-aspartylphosphate intermediateBy similarity
    Metal bindingi833 – 8331MagnesiumBy similarity
    Metal bindingi837 – 8371MagnesiumBy similarity

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW
    2. cation-transporting ATPase activity Source: InterPro
    3. magnesium ion binding Source: InterPro
    4. phospholipid-translocating ATPase activity Source: UniProtKB-EC

    GO - Biological processi

    1. ion transmembrane transport Source: Reactome
    2. transmembrane transport Source: Reactome

    Keywords - Molecular functioni

    Hydrolase

    Keywords - Biological processi

    Lipid transport, Transport

    Keywords - Ligandi

    ATP-binding, Magnesium, Metal-binding, Nucleotide-binding

    Enzyme and pathway databases

    ReactomeiREACT_25149. Ion transport by P-type ATPases.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Phospholipid-transporting ATPase ID (EC:3.6.3.1)
    Alternative name(s):
    ATPase class I type 8B member 2
    P4-ATPase flippase complex alpha subunit ATP8B2
    Gene namesi
    Name:ATP8B2
    Synonyms:ATPID, KIAA1137
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:13534. ATP8B2.

    Subcellular locationi

    Membrane Curated; Multi-pass membrane protein. Cell membrane
    Note: TMEM30A, but not TMEM30B, is required for its export from ER to the plasma membrane.

    GO - Cellular componenti

    1. Golgi apparatus Source: UniProtKB
    2. integral component of membrane Source: UniProtKB-KW
    3. plasma membrane Source: UniProtKB

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA25167.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 12091209Phospholipid-transporting ATPase IDPRO_0000046365Add
    BLAST

    Proteomic databases

    MaxQBiP98198.
    PaxDbiP98198.
    PRIDEiP98198.

    PTM databases

    PhosphoSiteiP98198.

    Expressioni

    Tissue specificityi

    Isoform 3 is ubiquitous, with highest expression in aorta, cerebellum and uterus.1 Publication

    Gene expression databases

    ArrayExpressiP98198.
    BgeeiP98198.
    CleanExiHS_ATP8B2.
    GenevestigatoriP98198.

    Organism-specific databases

    HPAiHPA046680.

    Interactioni

    Subunit structurei

    Component of a P4-ATPase flippase complex which consists of a catalytic alpha subunit and an accessory beta subunit Probable. The probable flippase ATP8B2:TMEM30A complex can form an intermediate phosphoenzyme in vitro. The interaction with TMEM30B is reported conflictingly.Curated

    Protein-protein interaction databases

    BioGridi121445. 1 interaction.
    IntActiP98198. 2 interactions.
    STRINGi9606.ENSP00000357475.

    Structurei

    3D structure databases

    ProteinModelPortaliP98198.
    SMRiP98198. Positions 790-956.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 6464CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini87 – 926Exoplasmic loopSequence Analysis
    Topological domaini113 – 295183CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini318 – 34629Exoplasmic loopSequence AnalysisAdd
    BLAST
    Topological domaini369 – 889521CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini911 – 92212Exoplasmic loopSequence AnalysisAdd
    BLAST
    Topological domaini943 – 97230CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini995 – 100814Exoplasmic loopSequence AnalysisAdd
    BLAST
    Topological domaini1032 – 10376CytoplasmicSequence Analysis
    Topological domaini1059 – 107820Exoplasmic loopSequence AnalysisAdd
    BLAST
    Topological domaini1104 – 1209106CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei65 – 8622HelicalSequence AnalysisAdd
    BLAST
    Transmembranei93 – 11220HelicalSequence AnalysisAdd
    BLAST
    Transmembranei296 – 31722HelicalSequence AnalysisAdd
    BLAST
    Transmembranei347 – 36822HelicalSequence AnalysisAdd
    BLAST
    Transmembranei890 – 91021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei923 – 94220HelicalSequence AnalysisAdd
    BLAST
    Transmembranei973 – 99422HelicalSequence AnalysisAdd
    BLAST
    Transmembranei1009 – 103123HelicalSequence AnalysisAdd
    BLAST
    Transmembranei1038 – 105821HelicalSequence AnalysisAdd
    BLAST
    Transmembranei1079 – 110325HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG0474.
    HOGENOMiHOG000202528.
    HOVERGENiHBG050601.
    KOiK01530.
    OMAiWKESKFP.
    OrthoDBiEOG7RRF68.
    PhylomeDBiP98198.
    TreeFamiTF300654.

    Family and domain databases

    Gene3Di2.70.150.10. 2 hits.
    3.40.1110.10. 1 hit.
    3.40.50.1000. 2 hits.
    InterProiIPR023299. ATPase_P-typ_cyto_domN.
    IPR018303. ATPase_P-typ_P_site.
    IPR006539. ATPase_P-typ_Plipid-transp.
    IPR008250. ATPase_P-typ_transduc_dom_A.
    IPR001757. Cation_transp_P_typ_ATPase.
    IPR023214. HAD-like_dom.
    [Graphical view]
    PANTHERiPTHR24092. PTHR24092. 1 hit.
    PfamiPF00122. E1-E2_ATPase. 1 hit.
    [Graphical view]
    PRINTSiPR00119. CATATPASE.
    SUPFAMiSSF56784. SSF56784. 3 hits.
    SSF81660. SSF81660. 1 hit.
    TIGRFAMsiTIGR01652. ATPase-Plipid. 1 hit.
    TIGR01494. ATPase_P-type. 1 hit.
    PROSITEiPS00154. ATPASE_E1_E2. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P98198-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MTVPKEMPEK WARAQAPPSW SRKKPSWGTE EERRARANDR EYNEKFQYAS     50
    NCIKTSKYNI LTFLPVNLFE QFQEVANTYF LFLLILQLIP QISSLSWFTT 100
    IVPLVLVLTI TAVKDATDDY FRHKSDNQVN NRQSQVLING ILQQEQWMNV 150
    CVGDIIKLEN NQFVAADLLL LSSSEPHGLC YIETAELDGE TNMKVRQAIP 200
    VTSELGDISK LAKFDGEVIC EPPNNKLDKF SGTLYWKENK FPLSNQNMLL 250
    RGCVLRNTEW CFGLVIFAGP DTKLMQNSGR TKFKRTSIDR LMNTLVLWIF 300
    GFLVCMGVIL AIGNAIWEHE VGMRFQVYLP WDEAVDSAFF SGFLSFWSYI 350
    IILNTVVPIS LYVSVEVIRL GHSYFINWDK KMFCMKKRTP AEARTTTLNE 400
    ELGQVEYIFS DKTGTLTQNI MVFNKCSING HSYGDVFDVL GHKAELGERP 450
    EPVDFSFNPL ADKKFLFWDP SLLEAVKIGD PHTHEFFRLL SLCHTVMSEE 500
    KNEGELYYKA QSPDEGALVT AARNFGFVFR SRTPKTITVH EMGTAITYQL 550
    LAILDFNNIR KRMSVIVRNP EGKIRLYCKG ADTILLDRLH HSTQELLNTT 600
    MDHLNEYAGE GLRTLVLAYK DLDEEYYEEW AERRLQASLA QDSREDRLAS 650
    IYEEVENNMM LLGATAIEDK LQQGVPETIA LLTLANIKIW VLTGDKQETA 700
    VNIGYSCKML TDDMTEVFIV TGHTVLEVRE ELRKAREKMM DSSRSVGNGF 750
    TYQDKLSSSK LTSVLEAVAG EYALVINGHS LAHALEADME LEFLETACAC 800
    KAVICCRVTP LQKAQVVELV KKYKKAVTLA IGDGANDVSM IKTAHIGVGI 850
    SGQEGIQAVL ASDYSFSQFK FLQRLLLVHG RWSYLRMCKF LCYFFYKNFA 900
    FTMVHFWFGF FCGFSAQTVY DQYFITLYNI VYTSLPVLAM GVFDQDVPEQ 950
    RSMEYPKLYE PGQLNLLFNK REFFICIAQG IYTSVLMFFI PYGVFADATR 1000
    DDGTQLADYQ SFAVTVATSL VIVVSVQIGL DTGYWTAINH FFIWGSLAVY 1050
    FAILFAMHSN GLFDMFPNQF RFVGNAQNTL AQPTVWLTIV LTTVVCIMPV 1100
    VAFRFLRLNL KPDLSDTVRY TQLVRKKQKA QHRCMRRVGR TGSRRSGYAF 1150
    SHQEGFGELI MSGKNMRLSS LALSSFTTRS SSSWIESLRR KKSDSASSPS 1200
    GGADKPLKG 1209

    Note: No experimental confirmation available.

    Length:1,209
    Mass (Da):137,440
    Last modified:April 30, 2003 - v2
    Checksum:iD905A97E9D9724BD
    GO
    Isoform 2 (identifier: P98198-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         434-461: GDVFDVLGHKAELGERPEPVDFSFNPLA → VGSEGPRRKGPSWPGTVAHAYSHSTLGG
         462-1209: Missing.

    Show »
    Length:461
    Mass (Da):52,624
    Checksum:i15CAABEAAE6862DC
    GO
    Isoform 3 (identifier: P98198-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-29: MTVPKEMPEKWARAQAPPSWSRKKPSWGT → MDTLRAVPLFSISGLFSFPYRVSHGIAGILLGEMAVCAKKRPP

    Show »
    Length:1,223
    Mass (Da):138,719
    Checksum:i61AF805A0511A143
    GO
    Isoform 4 (identifier: P98198-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-29: MTVPKEMPEKWARAQAPPSWSRKKPSWGT → MAVCAKKRPP
         364-406: SVEVIRLGHS...TLNEELGQVE → RYVPSLTWGL...KSSSSCTVNI
         407-1209: Missing.

    Show »
    Length:387
    Mass (Da):44,213
    Checksum:iB4C17CA615F4F952
    GO

    Sequence cautioni

    The sequence BAB70822.1 differs from that shown. Reason: Frameshift at position 364.
    The sequence AAH30288.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAG65556.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti834 – 8341G → E in BAA86451. (PubMed:15489334)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 2929MTVPK…PSWGT → MDTLRAVPLFSISGLFSFPY RVSHGIAGILLGEMAVCAKK RPP in isoform 3. 1 PublicationVSP_037147Add
    BLAST
    Alternative sequencei1 – 2929MTVPK…PSWGT → MAVCAKKRPP in isoform 4. 1 PublicationVSP_037148Add
    BLAST
    Alternative sequencei364 – 40643SVEVI…LGQVE → RYVPSLTWGLSRESGGPIEL FFSMKMKSLRSNEKSSSSCT VNI in isoform 4. 1 PublicationVSP_037149Add
    BLAST
    Alternative sequencei407 – 1209803Missing in isoform 4. 1 PublicationVSP_037150Add
    BLAST
    Alternative sequencei434 – 46128GDVFD…FNPLA → VGSEGPRRKGPSWPGTVAHA YSHSTLGG in isoform 2. 1 PublicationVSP_007302Add
    BLAST
    Alternative sequencei462 – 1209748Missing in isoform 2. 1 PublicationVSP_007303Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY302537 mRNA. Translation: AAQ19027.1.
    AK054886 mRNA. Translation: BAB70822.1. Frameshift.
    AK304806 mRNA. Translation: BAG65556.1. Different initiation.
    AL162591 Genomic DNA. Translation: CAH72858.1.
    CH471121 Genomic DNA. Translation: EAW53205.1.
    BC007837 mRNA. Translation: AAH07837.2.
    BC030288 mRNA. Translation: AAH30288.1. Different initiation.
    BC069264 mRNA. Translation: AAH69264.1.
    AB032963 mRNA. Translation: BAA86451.1.
    AL137537 mRNA. Translation: CAB70799.1.
    CCDSiCCDS1066.1. [P98198-3]
    CCDS41405.1. [P98198-4]
    PIRiT46381.
    RefSeqiNP_001005855.1. NM_001005855.1. [P98198-4]
    NP_065185.1. NM_020452.3. [P98198-3]
    XP_005245412.1. XM_005245355.1. [P98198-1]
    UniGeneiHs.435700.

    Genome annotation databases

    EnsembliENST00000368487; ENSP00000357472; ENSG00000143515. [P98198-4]
    ENST00000368489; ENSP00000357475; ENSG00000143515. [P98198-3]
    GeneIDi57198.
    KEGGihsa:57198.
    UCSCiuc001few.3. human. [P98198-4]
    uc001fex.3. human. [P98198-3]
    uc001fey.1. human. [P98198-2]

    Polymorphism databases

    DMDMi30316371.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY302537 mRNA. Translation: AAQ19027.1 .
    AK054886 mRNA. Translation: BAB70822.1 . Frameshift.
    AK304806 mRNA. Translation: BAG65556.1 . Different initiation.
    AL162591 Genomic DNA. Translation: CAH72858.1 .
    CH471121 Genomic DNA. Translation: EAW53205.1 .
    BC007837 mRNA. Translation: AAH07837.2 .
    BC030288 mRNA. Translation: AAH30288.1 . Different initiation.
    BC069264 mRNA. Translation: AAH69264.1 .
    AB032963 mRNA. Translation: BAA86451.1 .
    AL137537 mRNA. Translation: CAB70799.1 .
    CCDSi CCDS1066.1. [P98198-3 ]
    CCDS41405.1. [P98198-4 ]
    PIRi T46381.
    RefSeqi NP_001005855.1. NM_001005855.1. [P98198-4 ]
    NP_065185.1. NM_020452.3. [P98198-3 ]
    XP_005245412.1. XM_005245355.1. [P98198-1 ]
    UniGenei Hs.435700.

    3D structure databases

    ProteinModelPortali P98198.
    SMRi P98198. Positions 790-956.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 121445. 1 interaction.
    IntActi P98198. 2 interactions.
    STRINGi 9606.ENSP00000357475.

    PTM databases

    PhosphoSitei P98198.

    Polymorphism databases

    DMDMi 30316371.

    Proteomic databases

    MaxQBi P98198.
    PaxDbi P98198.
    PRIDEi P98198.

    Protocols and materials databases

    DNASUi 57198.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000368487 ; ENSP00000357472 ; ENSG00000143515 . [P98198-4 ]
    ENST00000368489 ; ENSP00000357475 ; ENSG00000143515 . [P98198-3 ]
    GeneIDi 57198.
    KEGGi hsa:57198.
    UCSCi uc001few.3. human. [P98198-4 ]
    uc001fex.3. human. [P98198-3 ]
    uc001fey.1. human. [P98198-2 ]

    Organism-specific databases

    CTDi 57198.
    GeneCardsi GC01P154298.
    HGNCi HGNC:13534. ATP8B2.
    HPAi HPA046680.
    MIMi 605867. gene.
    neXtProti NX_P98198.
    PharmGKBi PA25167.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0474.
    HOGENOMi HOG000202528.
    HOVERGENi HBG050601.
    KOi K01530.
    OMAi WKESKFP.
    OrthoDBi EOG7RRF68.
    PhylomeDBi P98198.
    TreeFami TF300654.

    Enzyme and pathway databases

    Reactomei REACT_25149. Ion transport by P-type ATPases.

    Miscellaneous databases

    GenomeRNAii 57198.
    NextBioi 63288.
    PROi P98198.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P98198.
    Bgeei P98198.
    CleanExi HS_ATP8B2.
    Genevestigatori P98198.

    Family and domain databases

    Gene3Di 2.70.150.10. 2 hits.
    3.40.1110.10. 1 hit.
    3.40.50.1000. 2 hits.
    InterProi IPR023299. ATPase_P-typ_cyto_domN.
    IPR018303. ATPase_P-typ_P_site.
    IPR006539. ATPase_P-typ_Plipid-transp.
    IPR008250. ATPase_P-typ_transduc_dom_A.
    IPR001757. Cation_transp_P_typ_ATPase.
    IPR023214. HAD-like_dom.
    [Graphical view ]
    PANTHERi PTHR24092. PTHR24092. 1 hit.
    Pfami PF00122. E1-E2_ATPase. 1 hit.
    [Graphical view ]
    PRINTSi PR00119. CATATPASE.
    SUPFAMi SSF56784. SSF56784. 3 hits.
    SSF81660. SSF81660. 1 hit.
    TIGRFAMsi TIGR01652. ATPase-Plipid. 1 hit.
    TIGR01494. ATPase_P-type. 1 hit.
    PROSITEi PS00154. ATPASE_E1_E2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "FIC1, a P-type ATPase linked to cholestatic liver disease, has homologues (ATP8B2 and ATP8B3) expressed throughout the body."
      Harris M.J., Arias I.M.
      Biochim. Biophys. Acta 1633:127-131(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), ALTERNATIVE SPLICING (ISOFORM 4), TISSUE SPECIFICITY.
      Tissue: Colon.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 671-1209 (ISOFORMS 1/3).
      Tissue: Cerebellum and Uterus.
    3. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 447-1209 (ISOFORMS 1/3).
      Tissue: Lung, Mammary gland and Muscle.
    6. "Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain."
      Hirosawa M., Nagase T., Ishikawa K., Kikuno R., Nomura N., Ohara O.
      DNA Res. 6:329-336(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 277-1209 (ISOFORMS 1/3).
      Tissue: Brain.
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1112-1209 (ISOFORM 1).
      Tissue: Testis.
    8. "Heteromeric interactions required for abundance and subcellular localization of human CDC50 proteins and class 1 P4-ATPases."
      van der Velden L.M., Wichers C.G., van Breevoort A.E., Coleman J.A., Molday R.S., Berger R., Klomp L.W., van de Graaf S.F.
      J. Biol. Chem. 285:40088-40096(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH TMEM30A, SUBCELLULAR LOCATION.
    9. "CDC50 proteins are critical components of the human class-1 P4-ATPase transport machinery."
      Bryde S., Hennrich H., Verhulst P.M., Devaux P.F., Lenoir G., Holthuis J.C.
      J. Biol. Chem. 285:40562-40572(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH TMEM30A AND TMEM30B, SUBCELLULAR LOCATION.

    Entry informationi

    Entry nameiAT8B2_HUMAN
    AccessioniPrimary (citable) accession number: P98198
    Secondary accession number(s): B4E3P4
    , Q6NT69, Q7Z486, Q96I43, Q96NQ7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 30, 2000
    Last sequence update: April 30, 2003
    Last modified: October 1, 2014
    This is version 132 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3