Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P98198

- AT8B2_HUMAN

UniProt

P98198 - AT8B2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Phospholipid-transporting ATPase ID

Gene

ATP8B2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Catalytic component of a P4-ATPase flippase complex which catalyzes the hydrolysis of ATP coupled to the transport of aminophospholipids from the outer to the inner leaflet of various membranes and ensures the maintenance of asymmetric distribution of phospholipids. Phospholipid translocation seems also to be implicated in vesicle formation and in uptake of lipid signaling molecules (Probable).Curated

Catalytic activityi

ATP + H2O + phospholipid(Side 1) = ADP + phosphate + phospholipid(Side 2).

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei411 – 41114-aspartylphosphate intermediateBy similarity
Metal bindingi833 – 8331MagnesiumBy similarity
Metal bindingi837 – 8371MagnesiumBy similarity

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. cation-transporting ATPase activity Source: InterPro
  3. magnesium ion binding Source: InterPro
  4. phospholipid-translocating ATPase activity Source: UniProtKB-EC

GO - Biological processi

  1. ion transmembrane transport Source: Reactome
  2. transmembrane transport Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Biological processi

Lipid transport, Transport

Keywords - Ligandi

ATP-binding, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiREACT_25149. Ion transport by P-type ATPases.

Names & Taxonomyi

Protein namesi
Recommended name:
Phospholipid-transporting ATPase ID (EC:3.6.3.1)
Alternative name(s):
ATPase class I type 8B member 2
P4-ATPase flippase complex alpha subunit ATP8B2
Gene namesi
Name:ATP8B2
Synonyms:ATPID, KIAA1137
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:13534. ATP8B2.

Subcellular locationi

Membrane Curated; Multi-pass membrane protein. Cell membrane
Note: TMEM30A, but not TMEM30B, is required for its export from ER to the plasma membrane.

GO - Cellular componenti

  1. Golgi apparatus Source: UniProtKB
  2. integral component of membrane Source: UniProtKB-KW
  3. plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA25167.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 12091209Phospholipid-transporting ATPase IDPRO_0000046365Add
BLAST

Proteomic databases

MaxQBiP98198.
PaxDbiP98198.
PRIDEiP98198.

PTM databases

PhosphoSiteiP98198.

Expressioni

Tissue specificityi

Isoform 3 is ubiquitous, with highest expression in aorta, cerebellum and uterus.1 Publication

Gene expression databases

BgeeiP98198.
CleanExiHS_ATP8B2.
ExpressionAtlasiP98198. baseline and differential.
GenevestigatoriP98198.

Organism-specific databases

HPAiHPA046680.

Interactioni

Subunit structurei

Component of a P4-ATPase flippase complex which consists of a catalytic alpha subunit and an accessory beta subunit (Probable). The probable flippase ATP8B2:TMEM30A complex can form an intermediate phosphoenzyme in vitro. The interaction with TMEM30B is reported conflictingly.Curated

Protein-protein interaction databases

BioGridi121445. 5 interactions.
IntActiP98198. 2 interactions.
STRINGi9606.ENSP00000357475.

Structurei

3D structure databases

ProteinModelPortaliP98198.
SMRiP98198. Positions 790-956.
ModBaseiSearch...
MobiDBiSearch...

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 6464CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini87 – 926Exoplasmic loopSequence Analysis
Topological domaini113 – 295183CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini318 – 34629Exoplasmic loopSequence AnalysisAdd
BLAST
Topological domaini369 – 889521CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini911 – 92212Exoplasmic loopSequence AnalysisAdd
BLAST
Topological domaini943 – 97230CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini995 – 100814Exoplasmic loopSequence AnalysisAdd
BLAST
Topological domaini1032 – 10376CytoplasmicSequence Analysis
Topological domaini1059 – 107820Exoplasmic loopSequence AnalysisAdd
BLAST
Topological domaini1104 – 1209106CytoplasmicSequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei65 – 8622HelicalSequence AnalysisAdd
BLAST
Transmembranei93 – 11220HelicalSequence AnalysisAdd
BLAST
Transmembranei296 – 31722HelicalSequence AnalysisAdd
BLAST
Transmembranei347 – 36822HelicalSequence AnalysisAdd
BLAST
Transmembranei890 – 91021HelicalSequence AnalysisAdd
BLAST
Transmembranei923 – 94220HelicalSequence AnalysisAdd
BLAST
Transmembranei973 – 99422HelicalSequence AnalysisAdd
BLAST
Transmembranei1009 – 103123HelicalSequence AnalysisAdd
BLAST
Transmembranei1038 – 105821HelicalSequence AnalysisAdd
BLAST
Transmembranei1079 – 110325HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0474.
GeneTreeiENSGT00760000119246.
HOGENOMiHOG000202528.
HOVERGENiHBG050601.
InParanoidiP98198.
KOiK01530.
OMAiWKESKFP.
OrthoDBiEOG7RRF68.
PhylomeDBiP98198.
TreeFamiTF300654.

Family and domain databases

Gene3Di2.70.150.10. 2 hits.
3.40.1110.10. 1 hit.
3.40.50.1000. 2 hits.
InterProiIPR023299. ATPase_P-typ_cyto_domN.
IPR018303. ATPase_P-typ_P_site.
IPR006539. ATPase_P-typ_Plipid-transp.
IPR008250. ATPase_P-typ_transduc_dom_A.
IPR001757. Cation_transp_P_typ_ATPase.
IPR023214. HAD-like_dom.
[Graphical view]
PANTHERiPTHR24092. PTHR24092. 1 hit.
PfamiPF00122. E1-E2_ATPase. 1 hit.
[Graphical view]
PRINTSiPR00119. CATATPASE.
SUPFAMiSSF56784. SSF56784. 3 hits.
SSF81660. SSF81660. 1 hit.
TIGRFAMsiTIGR01652. ATPase-Plipid. 1 hit.
TIGR01494. ATPase_P-type. 1 hit.
PROSITEiPS00154. ATPASE_E1_E2. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P98198-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTVPKEMPEK WARAQAPPSW SRKKPSWGTE EERRARANDR EYNEKFQYAS
60 70 80 90 100
NCIKTSKYNI LTFLPVNLFE QFQEVANTYF LFLLILQLIP QISSLSWFTT
110 120 130 140 150
IVPLVLVLTI TAVKDATDDY FRHKSDNQVN NRQSQVLING ILQQEQWMNV
160 170 180 190 200
CVGDIIKLEN NQFVAADLLL LSSSEPHGLC YIETAELDGE TNMKVRQAIP
210 220 230 240 250
VTSELGDISK LAKFDGEVIC EPPNNKLDKF SGTLYWKENK FPLSNQNMLL
260 270 280 290 300
RGCVLRNTEW CFGLVIFAGP DTKLMQNSGR TKFKRTSIDR LMNTLVLWIF
310 320 330 340 350
GFLVCMGVIL AIGNAIWEHE VGMRFQVYLP WDEAVDSAFF SGFLSFWSYI
360 370 380 390 400
IILNTVVPIS LYVSVEVIRL GHSYFINWDK KMFCMKKRTP AEARTTTLNE
410 420 430 440 450
ELGQVEYIFS DKTGTLTQNI MVFNKCSING HSYGDVFDVL GHKAELGERP
460 470 480 490 500
EPVDFSFNPL ADKKFLFWDP SLLEAVKIGD PHTHEFFRLL SLCHTVMSEE
510 520 530 540 550
KNEGELYYKA QSPDEGALVT AARNFGFVFR SRTPKTITVH EMGTAITYQL
560 570 580 590 600
LAILDFNNIR KRMSVIVRNP EGKIRLYCKG ADTILLDRLH HSTQELLNTT
610 620 630 640 650
MDHLNEYAGE GLRTLVLAYK DLDEEYYEEW AERRLQASLA QDSREDRLAS
660 670 680 690 700
IYEEVENNMM LLGATAIEDK LQQGVPETIA LLTLANIKIW VLTGDKQETA
710 720 730 740 750
VNIGYSCKML TDDMTEVFIV TGHTVLEVRE ELRKAREKMM DSSRSVGNGF
760 770 780 790 800
TYQDKLSSSK LTSVLEAVAG EYALVINGHS LAHALEADME LEFLETACAC
810 820 830 840 850
KAVICCRVTP LQKAQVVELV KKYKKAVTLA IGDGANDVSM IKTAHIGVGI
860 870 880 890 900
SGQEGIQAVL ASDYSFSQFK FLQRLLLVHG RWSYLRMCKF LCYFFYKNFA
910 920 930 940 950
FTMVHFWFGF FCGFSAQTVY DQYFITLYNI VYTSLPVLAM GVFDQDVPEQ
960 970 980 990 1000
RSMEYPKLYE PGQLNLLFNK REFFICIAQG IYTSVLMFFI PYGVFADATR
1010 1020 1030 1040 1050
DDGTQLADYQ SFAVTVATSL VIVVSVQIGL DTGYWTAINH FFIWGSLAVY
1060 1070 1080 1090 1100
FAILFAMHSN GLFDMFPNQF RFVGNAQNTL AQPTVWLTIV LTTVVCIMPV
1110 1120 1130 1140 1150
VAFRFLRLNL KPDLSDTVRY TQLVRKKQKA QHRCMRRVGR TGSRRSGYAF
1160 1170 1180 1190 1200
SHQEGFGELI MSGKNMRLSS LALSSFTTRS SSSWIESLRR KKSDSASSPS

GGADKPLKG

Note: No experimental confirmation available.

Length:1,209
Mass (Da):137,440
Last modified:April 30, 2003 - v2
Checksum:iD905A97E9D9724BD
GO
Isoform 2 (identifier: P98198-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     434-461: GDVFDVLGHKAELGERPEPVDFSFNPLA → VGSEGPRRKGPSWPGTVAHAYSHSTLGG
     462-1209: Missing.

Show »
Length:461
Mass (Da):52,624
Checksum:i15CAABEAAE6862DC
GO
Isoform 3 (identifier: P98198-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-29: MTVPKEMPEKWARAQAPPSWSRKKPSWGT → MDTLRAVPLFSISGLFSFPYRVSHGIAGILLGEMAVCAKKRPP

Show »
Length:1,223
Mass (Da):138,719
Checksum:i61AF805A0511A143
GO
Isoform 4 (identifier: P98198-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-29: MTVPKEMPEKWARAQAPPSWSRKKPSWGT → MAVCAKKRPP
     364-406: SVEVIRLGHS...TLNEELGQVE → RYVPSLTWGL...KSSSSCTVNI
     407-1209: Missing.

Show »
Length:387
Mass (Da):44,213
Checksum:iB4C17CA615F4F952
GO

Sequence cautioni

The sequence BAB70822.1 differs from that shown. Reason: Frameshift at position 364.
The sequence AAH30288.1 differs from that shown. Reason: Erroneous initiation.
The sequence BAG65556.1 differs from that shown. Reason: Erroneous initiation.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti834 – 8341G → E in BAA86451. (PubMed:15489334)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 2929MTVPK…PSWGT → MDTLRAVPLFSISGLFSFPY RVSHGIAGILLGEMAVCAKK RPP in isoform 3. 1 PublicationVSP_037147Add
BLAST
Alternative sequencei1 – 2929MTVPK…PSWGT → MAVCAKKRPP in isoform 4. 1 PublicationVSP_037148Add
BLAST
Alternative sequencei364 – 40643SVEVI…LGQVE → RYVPSLTWGLSRESGGPIEL FFSMKMKSLRSNEKSSSSCT VNI in isoform 4. 1 PublicationVSP_037149Add
BLAST
Alternative sequencei407 – 1209803Missing in isoform 4. 1 PublicationVSP_037150Add
BLAST
Alternative sequencei434 – 46128GDVFD…FNPLA → VGSEGPRRKGPSWPGTVAHA YSHSTLGG in isoform 2. 1 PublicationVSP_007302Add
BLAST
Alternative sequencei462 – 1209748Missing in isoform 2. 1 PublicationVSP_007303Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY302537 mRNA. Translation: AAQ19027.1.
AK054886 mRNA. Translation: BAB70822.1. Frameshift.
AK304806 mRNA. Translation: BAG65556.1. Different initiation.
AL162591 Genomic DNA. Translation: CAH72858.1.
CH471121 Genomic DNA. Translation: EAW53205.1.
BC007837 mRNA. Translation: AAH07837.2.
BC030288 mRNA. Translation: AAH30288.1. Different initiation.
BC069264 mRNA. Translation: AAH69264.1.
AB032963 mRNA. Translation: BAA86451.1.
AL137537 mRNA. Translation: CAB70799.1.
CCDSiCCDS1066.1. [P98198-3]
CCDS41405.1. [P98198-4]
PIRiT46381.
RefSeqiNP_001005855.1. NM_001005855.1. [P98198-4]
NP_065185.1. NM_020452.3. [P98198-3]
XP_005245412.1. XM_005245355.1. [P98198-1]
UniGeneiHs.435700.

Genome annotation databases

EnsembliENST00000368487; ENSP00000357472; ENSG00000143515. [P98198-4]
ENST00000368489; ENSP00000357475; ENSG00000143515. [P98198-3]
GeneIDi57198.
KEGGihsa:57198.
UCSCiuc001few.3. human. [P98198-4]
uc001fex.3. human. [P98198-3]
uc001fey.1. human. [P98198-2]

Polymorphism databases

DMDMi30316371.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY302537 mRNA. Translation: AAQ19027.1 .
AK054886 mRNA. Translation: BAB70822.1 . Frameshift.
AK304806 mRNA. Translation: BAG65556.1 . Different initiation.
AL162591 Genomic DNA. Translation: CAH72858.1 .
CH471121 Genomic DNA. Translation: EAW53205.1 .
BC007837 mRNA. Translation: AAH07837.2 .
BC030288 mRNA. Translation: AAH30288.1 . Different initiation.
BC069264 mRNA. Translation: AAH69264.1 .
AB032963 mRNA. Translation: BAA86451.1 .
AL137537 mRNA. Translation: CAB70799.1 .
CCDSi CCDS1066.1. [P98198-3 ]
CCDS41405.1. [P98198-4 ]
PIRi T46381.
RefSeqi NP_001005855.1. NM_001005855.1. [P98198-4 ]
NP_065185.1. NM_020452.3. [P98198-3 ]
XP_005245412.1. XM_005245355.1. [P98198-1 ]
UniGenei Hs.435700.

3D structure databases

ProteinModelPortali P98198.
SMRi P98198. Positions 790-956.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 121445. 5 interactions.
IntActi P98198. 2 interactions.
STRINGi 9606.ENSP00000357475.

PTM databases

PhosphoSitei P98198.

Polymorphism databases

DMDMi 30316371.

Proteomic databases

MaxQBi P98198.
PaxDbi P98198.
PRIDEi P98198.

Protocols and materials databases

DNASUi 57198.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000368487 ; ENSP00000357472 ; ENSG00000143515 . [P98198-4 ]
ENST00000368489 ; ENSP00000357475 ; ENSG00000143515 . [P98198-3 ]
GeneIDi 57198.
KEGGi hsa:57198.
UCSCi uc001few.3. human. [P98198-4 ]
uc001fex.3. human. [P98198-3 ]
uc001fey.1. human. [P98198-2 ]

Organism-specific databases

CTDi 57198.
GeneCardsi GC01P154298.
HGNCi HGNC:13534. ATP8B2.
HPAi HPA046680.
MIMi 605867. gene.
neXtProti NX_P98198.
PharmGKBi PA25167.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0474.
GeneTreei ENSGT00760000119246.
HOGENOMi HOG000202528.
HOVERGENi HBG050601.
InParanoidi P98198.
KOi K01530.
OMAi WKESKFP.
OrthoDBi EOG7RRF68.
PhylomeDBi P98198.
TreeFami TF300654.

Enzyme and pathway databases

Reactomei REACT_25149. Ion transport by P-type ATPases.

Miscellaneous databases

GenomeRNAii 57198.
NextBioi 63288.
PROi P98198.
SOURCEi Search...

Gene expression databases

Bgeei P98198.
CleanExi HS_ATP8B2.
ExpressionAtlasi P98198. baseline and differential.
Genevestigatori P98198.

Family and domain databases

Gene3Di 2.70.150.10. 2 hits.
3.40.1110.10. 1 hit.
3.40.50.1000. 2 hits.
InterProi IPR023299. ATPase_P-typ_cyto_domN.
IPR018303. ATPase_P-typ_P_site.
IPR006539. ATPase_P-typ_Plipid-transp.
IPR008250. ATPase_P-typ_transduc_dom_A.
IPR001757. Cation_transp_P_typ_ATPase.
IPR023214. HAD-like_dom.
[Graphical view ]
PANTHERi PTHR24092. PTHR24092. 1 hit.
Pfami PF00122. E1-E2_ATPase. 1 hit.
[Graphical view ]
PRINTSi PR00119. CATATPASE.
SUPFAMi SSF56784. SSF56784. 3 hits.
SSF81660. SSF81660. 1 hit.
TIGRFAMsi TIGR01652. ATPase-Plipid. 1 hit.
TIGR01494. ATPase_P-type. 1 hit.
PROSITEi PS00154. ATPASE_E1_E2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "FIC1, a P-type ATPase linked to cholestatic liver disease, has homologues (ATP8B2 and ATP8B3) expressed throughout the body."
    Harris M.J., Arias I.M.
    Biochim. Biophys. Acta 1633:127-131(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), ALTERNATIVE SPLICING (ISOFORM 4), TISSUE SPECIFICITY.
    Tissue: Colon.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 671-1209 (ISOFORMS 1/3).
    Tissue: Cerebellum and Uterus.
  3. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 447-1209 (ISOFORMS 1/3).
    Tissue: Lung, Mammary gland and Muscle.
  6. "Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain."
    Hirosawa M., Nagase T., Ishikawa K., Kikuno R., Nomura N., Ohara O.
    DNA Res. 6:329-336(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 277-1209 (ISOFORMS 1/3).
    Tissue: Brain.
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1112-1209 (ISOFORM 1).
    Tissue: Testis.
  8. "Heteromeric interactions required for abundance and subcellular localization of human CDC50 proteins and class 1 P4-ATPases."
    van der Velden L.M., Wichers C.G., van Breevoort A.E., Coleman J.A., Molday R.S., Berger R., Klomp L.W., van de Graaf S.F.
    J. Biol. Chem. 285:40088-40096(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH TMEM30A, SUBCELLULAR LOCATION.
  9. "CDC50 proteins are critical components of the human class-1 P4-ATPase transport machinery."
    Bryde S., Hennrich H., Verhulst P.M., Devaux P.F., Lenoir G., Holthuis J.C.
    J. Biol. Chem. 285:40562-40572(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH TMEM30A AND TMEM30B, SUBCELLULAR LOCATION.

Entry informationi

Entry nameiAT8B2_HUMAN
AccessioniPrimary (citable) accession number: P98198
Secondary accession number(s): B4E3P4
, Q6NT69, Q7Z486, Q96I43, Q96NQ7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: April 30, 2003
Last modified: October 29, 2014
This is version 133 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3