Reviewed,
UniProtKB/Swiss-Prot P98198 (AT8B2_HUMAN)
Last modified
February 9, 2010.
Version 89.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Probable phospholipid-transporting ATPase ID EC=3.6.3.1 Alternative name(s): ATPase class I type 8B member 2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1209 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Catalytic activity | ATP + H2O + phospholipid(In) = ADP + phosphate + phospholipid(Out). |
| Subcellular location | |
| Tissue specificity | |
| Sequence similarities | Belongs to the cation transport ATPase (P-type) family. Type IV subfamily. |
| Sequence caution | The sequence BAB70822.1 differs from that shown. Reason: Frameshift at position 364. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane |
| Ligand | ATP-binding Magnesium Metal-binding Nucleotide-binding |
| Molecular function | Hydrolase |
| PTM | Phosphoprotein |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | ATP biosynthetic process Inferred from electronic annotation. Source: InterPro phospholipid transportInferred from electronic annotation. Source: InterPro |
| Molecular function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanismInferred from electronic annotation. Source: InterPro magnesium ion bindingInferred from electronic annotation. Source: UniProtKB-KW phospholipid-translocating ATPase activityInferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P98198-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 2 (identifier: P98198-2) The sequence of this isoform differs from the canonical sequence as follows: 434-461: GDVFDVLGHKAELGERPEPVDFSFNPLA → VGSEGPRRKGPSWPGTVAHAYSHSTLGG 462-1209: Missing. | ||||||
| Isoform 3 (identifier: P98198-3) The sequence of this isoform differs from the canonical sequence as follows: 1-29: MTVPKEMPEKWARAQAPPSWSRKKPSWGT → MDTLRAVPLFSISGLFSFPYRVSHGIAGILLGEMAVCAKKRPP | ||||||
| Isoform 4 (identifier: P98198-4) The sequence of this isoform differs from the canonical sequence as follows: 1-29: MTVPKEMPEKWARAQAPPSWSRKKPSWGT → MAVCAKKRPP 364-406: SVEVIRLGHS...TLNEELGQVE → RYVPSLTWGL...KSSSSCTVNI 407-1209: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1209 | 1209 | Probable phospholipid-transporting ATPase ID | PRO_0000046365 | |||||
Regions | |||||||||
| Topological domain | 1 – 64 | 64 | Cytoplasmic Potential | ||||||
| Transmembrane | 65 – 86 | 22 | Potential | ||||||
| Topological domain | 87 – 92 | 6 | Extracellular Potential | ||||||
| Transmembrane | 93 – 112 | 20 | Potential | ||||||
| Topological domain | 113 – 295 | 183 | Cytoplasmic Potential | ||||||
| Transmembrane | 296 – 317 | 22 | Potential | ||||||
| Topological domain | 318 – 346 | 29 | Extracellular Potential | ||||||
| Transmembrane | 347 – 368 | 22 | Potential | ||||||
| Topological domain | 369 – 889 | 521 | Cytoplasmic Potential | ||||||
| Transmembrane | 890 – 910 | 21 | Potential | ||||||
| Topological domain | 911 – 922 | 12 | Extracellular Potential | ||||||
| Transmembrane | 923 – 942 | 20 | Potential | ||||||
| Topological domain | 943 – 972 | 30 | Cytoplasmic Potential | ||||||
| Transmembrane | 973 – 994 | 22 | Potential | ||||||
| Topological domain | 995 – 1008 | 14 | Extracellular Potential | ||||||
| Transmembrane | 1009 – 1031 | 23 | Potential | ||||||
| Topological domain | 1032 – 1037 | 6 | Cytoplasmic Potential | ||||||
| Transmembrane | 1038 – 1058 | 21 | Potential | ||||||
| Topological domain | 1059 – 1078 | 20 | Extracellular Potential | ||||||
| Transmembrane | 1079 – 1103 | 25 | Potential | ||||||
| Topological domain | 1104 – 1209 | 106 | Cytoplasmic Potential | ||||||
Sites | |||||||||
| Active site | 411 | 1 | 4-aspartylphosphate intermediate By similarity | ||||||
| Metal binding | 833 | 1 | Magnesium By similarity | ||||||
| Metal binding | 837 | 1 | Magnesium By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 1117 | 1 | Phosphothreonine Ref.8 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 29 | 29 | MTVPK…PSWGT → MDTLRAVPLFSISGLFSFPY RVSHGIAGILLGEMAVCAKK RPP in isoform 3. | VSP_037147 | |||||
| Alternative sequence | 1 – 29 | 29 | MTVPK…PSWGT → MAVCAKKRPP in isoform 4. | VSP_037148 | |||||
| Alternative sequence | 364 – 406 | 43 | SVEVI…LGQVE → RYVPSLTWGLSRESGGPIEL FFSMKMKSLRSNEKSSSSCT VNI in isoform 4. | VSP_037149 | |||||
| Alternative sequence | 407 – 1209 | 803 | Missing in isoform 4. | VSP_037150 | |||||
| Alternative sequence | 434 – 461 | 28 | GDVFD…FNPLA → VGSEGPRRKGPSWPGTVAHA YSHSTLGG in isoform 2. | VSP_007302 | |||||
| Alternative sequence | 462 – 1209 | 748 | Missing in isoform 2. | VSP_007303 | |||||
Experimental info | |||||||||
| Sequence conflict | 834 | 1 | G → E in BAA86451. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| [1] | "FIC1, a P-type ATPase linked to cholestatic liver disease, has homologues (ATP8B2 and ATP8B3) expressed throughout the body." Harris M.J., Arias I.M. Biochim. Biophys. Acta 1633:127-131(2003) [PubMed: 12880872] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), ALTERNATIVE SPLICING (ISOFORM 4), TISSUE SPECIFICITY. Tissue: Colon. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 671-1209 (ISOFORMS 1/3). Tissue: Cerebellum and Uterus. |
| [3] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed: 16710414] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 447-1209 (ISOFORMS 1/3). Tissue: Lung, Mammary gland and Muscle. |
| [6] | "Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain." Hirosawa M., Nagase T., Ishikawa K., Kikuno R., Nomura N., Ohara O. DNA Res. 6:329-336(1999) [PubMed: 10574461] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 277-1209 (ISOFORMS 1/3). Tissue: Brain. |
| [7] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1112-1209 (ISOFORM 1). Tissue: Testis. |
| [8] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed: 18691976] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-1117, MASS SPECTROMETRY. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY302537 mRNA. Translation: AAQ19027.1. AK054886 mRNA. Translation: BAB70822.1. Frameshift. AK304806 mRNA. Translation: BAG65556.1. Different initiation. AL162591 Genomic DNA. Translation: CAH72858.1. CH471121 Genomic DNA. Translation: EAW53205.1. BC007837 mRNA. Translation: AAH07837.2. BC030288 mRNA. Translation: AAH30288.1. Different initiation. BC069264 mRNA. Translation: AAH69264.1. AB032963 mRNA. Translation: BAA86451.1. AL137537 mRNA. Translation: CAB70799.1. |
| IPI | IPI00258027. IPI00396074. IPI00431800. IPI00844415. |
| PIR | T46381. |
| RefSeq | NP_001005855.1. NP_065185.1. |
| UniGene | Hs.435700 |
3D structure databases | |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | P98198. |
Proteomic databases | |
| PRIDE | P98198. |
Genome annotation databases | |
| Ensembl | ENST00000341831; ENSP00000344124; ENSG00000143515; Homo sapiens. [Genome view] |
| GeneID | 57198. |
| KEGG | hsa:57198. |
Organism-specific databases | |
| CTD | 57198. |
| GeneCards | GC01P152564. |
| HGNC | HGNC:13534. ATP8B2. |
| MIM | 605867. gene. |
| PharmGKB | PA25167. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG14894. |
| HOVERGEN | P98198. |
| OMA | TTVVCIM. |
| PhylomeDB | P98198. |
Enzyme and pathway databases | |
| BRENDA | 3.6.3.1. 247. |
Gene expression databases | |
| ArrayExpress | P98198. |
| Bgee | P98198. |
| CleanEx | HS_ATP8B2. |
| Genevestigator | P98198. |
| GermOnline | ENSG00000143515. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR008250. ATPase_P-typ_ATPase-assoc-dom. IPR001757. ATPase_P-typ_ion-transptr. IPR018303. ATPase_P-typ_P_site. IPR006539. ATPase_P-typ_Plipid-transl. [Graphical view] |
| PANTHER | PTHR11939. ATPase_P. 1 hit. |
| Pfam | PF00122. E1-E2_ATPase. 1 hit. [Graphical view] |
| PRINTS | PR00119. CATATPASE. |
| TIGRFAMs | TIGR01652. ATPase-Plipid. 1 hit. TIGR01494. ATPase_P-type. 4 hits. |
| PROSITE | PS00154. ATPASE_E1_E2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| SOURCE | Search... |
Entry information
| Entry name | AT8B2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P98198 Secondary accession number(s): B4E3P4 Q96NQ7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


