Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Phospholipid-transporting ATPase ID

Gene

ATP8B2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Catalytic component of a P4-ATPase flippase complex which catalyzes the hydrolysis of ATP coupled to the transport of aminophospholipids from the outer to the inner leaflet of various membranes and ensures the maintenance of asymmetric distribution of phospholipids. Phospholipid translocation seems also to be implicated in vesicle formation and in uptake of lipid signaling molecules (Probable).Curated

Catalytic activityi

ATP + H2O + phospholipid(Side 1) = ADP + phosphate + phospholipid(Side 2).

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei4114-aspartylphosphate intermediateBy similarity1
Metal bindingi833MagnesiumBy similarity1
Metal bindingi837MagnesiumBy similarity1

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Biological processi

Lipid transport, Transport

Keywords - Ligandi

ATP-binding, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyciZFISH:HS07068-MONOMER.
ReactomeiR-HSA-936837. Ion transport by P-type ATPases.

Names & Taxonomyi

Protein namesi
Recommended name:
Phospholipid-transporting ATPase ID (EC:3.6.3.1)
Alternative name(s):
ATPase class I type 8B member 2
P4-ATPase flippase complex alpha subunit ATP8B2
Gene namesi
Name:ATP8B2
Synonyms:ATPID, KIAA1137
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:13534. ATP8B2.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 64CytoplasmicSequence analysisAdd BLAST64
Transmembranei65 – 86HelicalSequence analysisAdd BLAST22
Topological domaini87 – 92Exoplasmic loopSequence analysis6
Transmembranei93 – 112HelicalSequence analysisAdd BLAST20
Topological domaini113 – 295CytoplasmicSequence analysisAdd BLAST183
Transmembranei296 – 317HelicalSequence analysisAdd BLAST22
Topological domaini318 – 346Exoplasmic loopSequence analysisAdd BLAST29
Transmembranei347 – 368HelicalSequence analysisAdd BLAST22
Topological domaini369 – 889CytoplasmicSequence analysisAdd BLAST521
Transmembranei890 – 910HelicalSequence analysisAdd BLAST21
Topological domaini911 – 922Exoplasmic loopSequence analysisAdd BLAST12
Transmembranei923 – 942HelicalSequence analysisAdd BLAST20
Topological domaini943 – 972CytoplasmicSequence analysisAdd BLAST30
Transmembranei973 – 994HelicalSequence analysisAdd BLAST22
Topological domaini995 – 1008Exoplasmic loopSequence analysisAdd BLAST14
Transmembranei1009 – 1031HelicalSequence analysisAdd BLAST23
Topological domaini1032 – 1037CytoplasmicSequence analysis6
Transmembranei1038 – 1058HelicalSequence analysisAdd BLAST21
Topological domaini1059 – 1078Exoplasmic loopSequence analysisAdd BLAST20
Transmembranei1079 – 1103HelicalSequence analysisAdd BLAST25
Topological domaini1104 – 1209CytoplasmicSequence analysisAdd BLAST106

GO - Cellular componenti

  • endoplasmic reticulum membrane Source: UniProtKB-SubCell
  • Golgi apparatus Source: UniProtKB
  • integral component of membrane Source: UniProtKB-KW
  • plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Endoplasmic reticulum, Membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000143515.
PharmGKBiPA25167.

Polymorphism and mutation databases

BioMutaiATP8B2.
DMDMi30316371.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000463651 – 1209Phospholipid-transporting ATPase IDAdd BLAST1209

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1175PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiP98198.
PaxDbiP98198.
PeptideAtlasiP98198.
PRIDEiP98198.

PTM databases

iPTMnetiP98198.
PhosphoSitePlusiP98198.

Expressioni

Tissue specificityi

Isoform 3 is ubiquitous, with highest expression in aorta, cerebellum and uterus.1 Publication

Gene expression databases

BgeeiENSG00000143515.
CleanExiHS_ATP8B2.
GenevisibleiP98198. HS.

Organism-specific databases

HPAiHPA046680.

Interactioni

Subunit structurei

Component of a P4-ATPase flippase complex which consists of a catalytic alpha subunit and an accessory beta subunit (Probable). The probable flippase ATP8B2:TMEM30A complex can form an intermediate phosphoenzyme in vitro. The interaction with TMEM30B is reported conflictingly.Curated

Protein-protein interaction databases

BioGridi121445. 13 interactors.
IntActiP98198. 2 interactors.
STRINGi9606.ENSP00000357475.

Structurei

3D structure databases

ProteinModelPortaliP98198.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0206. Eukaryota.
COG0474. LUCA.
GeneTreeiENSGT00860000133706.
HOGENOMiHOG000202528.
HOVERGENiHBG050601.
InParanoidiP98198.
KOiK01530.
OMAiEFFICIT.
OrthoDBiEOG091G0139.
PhylomeDBiP98198.
TreeFamiTF300654.

Family and domain databases

Gene3Di2.70.150.10. 2 hits.
3.40.1110.10. 1 hit.
3.40.50.1000. 2 hits.
InterProiIPR030347. ATP8B2.
IPR023299. ATPase_P-typ_cyto_domN.
IPR018303. ATPase_P-typ_P_site.
IPR008250. ATPase_P-typ_transduc_dom_A.
IPR023214. HAD-like_dom.
IPR006539. P-type_ATPase_IV.
IPR032631. P-type_ATPase_N.
IPR001757. P_typ_ATPase.
IPR032630. P_typ_ATPase_c.
[Graphical view]
PANTHERiPTHR24092. PTHR24092. 1 hit.
PTHR24092:SF46. PTHR24092:SF46. 1 hit.
PfamiPF00122. E1-E2_ATPase. 1 hit.
PF16212. PhoLip_ATPase_C. 1 hit.
PF16209. PhoLip_ATPase_N. 1 hit.
[Graphical view]
SUPFAMiSSF56784. SSF56784. 3 hits.
SSF81660. SSF81660. 1 hit.
TIGRFAMsiTIGR01652. ATPase-Plipid. 1 hit.
TIGR01494. ATPase_P-type. 1 hit.
PROSITEiPS00154. ATPASE_E1_E2. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P98198-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTVPKEMPEK WARAQAPPSW SRKKPSWGTE EERRARANDR EYNEKFQYAS
60 70 80 90 100
NCIKTSKYNI LTFLPVNLFE QFQEVANTYF LFLLILQLIP QISSLSWFTT
110 120 130 140 150
IVPLVLVLTI TAVKDATDDY FRHKSDNQVN NRQSQVLING ILQQEQWMNV
160 170 180 190 200
CVGDIIKLEN NQFVAADLLL LSSSEPHGLC YIETAELDGE TNMKVRQAIP
210 220 230 240 250
VTSELGDISK LAKFDGEVIC EPPNNKLDKF SGTLYWKENK FPLSNQNMLL
260 270 280 290 300
RGCVLRNTEW CFGLVIFAGP DTKLMQNSGR TKFKRTSIDR LMNTLVLWIF
310 320 330 340 350
GFLVCMGVIL AIGNAIWEHE VGMRFQVYLP WDEAVDSAFF SGFLSFWSYI
360 370 380 390 400
IILNTVVPIS LYVSVEVIRL GHSYFINWDK KMFCMKKRTP AEARTTTLNE
410 420 430 440 450
ELGQVEYIFS DKTGTLTQNI MVFNKCSING HSYGDVFDVL GHKAELGERP
460 470 480 490 500
EPVDFSFNPL ADKKFLFWDP SLLEAVKIGD PHTHEFFRLL SLCHTVMSEE
510 520 530 540 550
KNEGELYYKA QSPDEGALVT AARNFGFVFR SRTPKTITVH EMGTAITYQL
560 570 580 590 600
LAILDFNNIR KRMSVIVRNP EGKIRLYCKG ADTILLDRLH HSTQELLNTT
610 620 630 640 650
MDHLNEYAGE GLRTLVLAYK DLDEEYYEEW AERRLQASLA QDSREDRLAS
660 670 680 690 700
IYEEVENNMM LLGATAIEDK LQQGVPETIA LLTLANIKIW VLTGDKQETA
710 720 730 740 750
VNIGYSCKML TDDMTEVFIV TGHTVLEVRE ELRKAREKMM DSSRSVGNGF
760 770 780 790 800
TYQDKLSSSK LTSVLEAVAG EYALVINGHS LAHALEADME LEFLETACAC
810 820 830 840 850
KAVICCRVTP LQKAQVVELV KKYKKAVTLA IGDGANDVSM IKTAHIGVGI
860 870 880 890 900
SGQEGIQAVL ASDYSFSQFK FLQRLLLVHG RWSYLRMCKF LCYFFYKNFA
910 920 930 940 950
FTMVHFWFGF FCGFSAQTVY DQYFITLYNI VYTSLPVLAM GVFDQDVPEQ
960 970 980 990 1000
RSMEYPKLYE PGQLNLLFNK REFFICIAQG IYTSVLMFFI PYGVFADATR
1010 1020 1030 1040 1050
DDGTQLADYQ SFAVTVATSL VIVVSVQIGL DTGYWTAINH FFIWGSLAVY
1060 1070 1080 1090 1100
FAILFAMHSN GLFDMFPNQF RFVGNAQNTL AQPTVWLTIV LTTVVCIMPV
1110 1120 1130 1140 1150
VAFRFLRLNL KPDLSDTVRY TQLVRKKQKA QHRCMRRVGR TGSRRSGYAF
1160 1170 1180 1190 1200
SHQEGFGELI MSGKNMRLSS LALSSFTTRS SSSWIESLRR KKSDSASSPS

GGADKPLKG
Note: No experimental confirmation available.
Length:1,209
Mass (Da):137,440
Last modified:April 30, 2003 - v2
Checksum:iD905A97E9D9724BD
GO
Isoform 2 (identifier: P98198-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     434-461: GDVFDVLGHKAELGERPEPVDFSFNPLA → VGSEGPRRKGPSWPGTVAHAYSHSTLGG
     462-1209: Missing.

Show »
Length:461
Mass (Da):52,624
Checksum:i15CAABEAAE6862DC
GO
Isoform 3 (identifier: P98198-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-29: MTVPKEMPEKWARAQAPPSWSRKKPSWGT → MDTLRAVPLFSISGLFSFPYRVSHGIAGILLGEMAVCAKKRPP

Show »
Length:1,223
Mass (Da):138,719
Checksum:i61AF805A0511A143
GO
Isoform 4 (identifier: P98198-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-29: MTVPKEMPEKWARAQAPPSWSRKKPSWGT → MAVCAKKRPP
     364-406: SVEVIRLGHS...TLNEELGQVE → RYVPSLTWGL...KSSSSCTVNI
     407-1209: Missing.

Show »
Length:387
Mass (Da):44,213
Checksum:iB4C17CA615F4F952
GO

Sequence cautioni

The sequence AAH30288 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB70822 differs from that shown. Reason: Frameshift at position 364.Curated
The sequence BAG65556 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti834G → E in BAA86451 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0371471 – 29MTVPK…PSWGT → MDTLRAVPLFSISGLFSFPY RVSHGIAGILLGEMAVCAKK RPP in isoform 3. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_0371481 – 29MTVPK…PSWGT → MAVCAKKRPP in isoform 4. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_037149364 – 406SVEVI…LGQVE → RYVPSLTWGLSRESGGPIEL FFSMKMKSLRSNEKSSSSCT VNI in isoform 4. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_037150407 – 1209Missing in isoform 4. 1 PublicationAdd BLAST803
Alternative sequenceiVSP_007302434 – 461GDVFD…FNPLA → VGSEGPRRKGPSWPGTVAHA YSHSTLGG in isoform 2. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_007303462 – 1209Missing in isoform 2. 1 PublicationAdd BLAST748

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY302537 mRNA. Translation: AAQ19027.1.
AK054886 mRNA. Translation: BAB70822.1. Frameshift.
AK304806 mRNA. Translation: BAG65556.1. Different initiation.
AL162591 Genomic DNA. Translation: CAH72858.1.
CH471121 Genomic DNA. Translation: EAW53205.1.
BC007837 mRNA. Translation: AAH07837.2.
BC030288 mRNA. Translation: AAH30288.1. Different initiation.
BC069264 mRNA. Translation: AAH69264.1.
AB032963 mRNA. Translation: BAA86451.1.
AL137537 mRNA. Translation: CAB70799.1.
CCDSiCCDS1066.1. [P98198-3]
CCDS41405.1. [P98198-4]
PIRiT46381.
RefSeqiNP_001005855.1. NM_001005855.1. [P98198-4]
NP_065185.1. NM_020452.3. [P98198-3]
XP_005245412.1. XM_005245355.2. [P98198-1]
UniGeneiHs.435700.

Genome annotation databases

EnsembliENST00000368487; ENSP00000357472; ENSG00000143515. [P98198-4]
ENST00000368489; ENSP00000357475; ENSG00000143515. [P98198-3]
GeneIDi57198.
KEGGihsa:57198.
UCSCiuc001few.4. human. [P98198-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY302537 mRNA. Translation: AAQ19027.1.
AK054886 mRNA. Translation: BAB70822.1. Frameshift.
AK304806 mRNA. Translation: BAG65556.1. Different initiation.
AL162591 Genomic DNA. Translation: CAH72858.1.
CH471121 Genomic DNA. Translation: EAW53205.1.
BC007837 mRNA. Translation: AAH07837.2.
BC030288 mRNA. Translation: AAH30288.1. Different initiation.
BC069264 mRNA. Translation: AAH69264.1.
AB032963 mRNA. Translation: BAA86451.1.
AL137537 mRNA. Translation: CAB70799.1.
CCDSiCCDS1066.1. [P98198-3]
CCDS41405.1. [P98198-4]
PIRiT46381.
RefSeqiNP_001005855.1. NM_001005855.1. [P98198-4]
NP_065185.1. NM_020452.3. [P98198-3]
XP_005245412.1. XM_005245355.2. [P98198-1]
UniGeneiHs.435700.

3D structure databases

ProteinModelPortaliP98198.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121445. 13 interactors.
IntActiP98198. 2 interactors.
STRINGi9606.ENSP00000357475.

PTM databases

iPTMnetiP98198.
PhosphoSitePlusiP98198.

Polymorphism and mutation databases

BioMutaiATP8B2.
DMDMi30316371.

Proteomic databases

MaxQBiP98198.
PaxDbiP98198.
PeptideAtlasiP98198.
PRIDEiP98198.

Protocols and materials databases

DNASUi57198.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000368487; ENSP00000357472; ENSG00000143515. [P98198-4]
ENST00000368489; ENSP00000357475; ENSG00000143515. [P98198-3]
GeneIDi57198.
KEGGihsa:57198.
UCSCiuc001few.4. human. [P98198-1]

Organism-specific databases

CTDi57198.
GeneCardsiATP8B2.
HGNCiHGNC:13534. ATP8B2.
HPAiHPA046680.
MIMi605867. gene.
neXtProtiNX_P98198.
OpenTargetsiENSG00000143515.
PharmGKBiPA25167.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0206. Eukaryota.
COG0474. LUCA.
GeneTreeiENSGT00860000133706.
HOGENOMiHOG000202528.
HOVERGENiHBG050601.
InParanoidiP98198.
KOiK01530.
OMAiEFFICIT.
OrthoDBiEOG091G0139.
PhylomeDBiP98198.
TreeFamiTF300654.

Enzyme and pathway databases

BioCyciZFISH:HS07068-MONOMER.
ReactomeiR-HSA-936837. Ion transport by P-type ATPases.

Miscellaneous databases

GenomeRNAii57198.
PROiP98198.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000143515.
CleanExiHS_ATP8B2.
GenevisibleiP98198. HS.

Family and domain databases

Gene3Di2.70.150.10. 2 hits.
3.40.1110.10. 1 hit.
3.40.50.1000. 2 hits.
InterProiIPR030347. ATP8B2.
IPR023299. ATPase_P-typ_cyto_domN.
IPR018303. ATPase_P-typ_P_site.
IPR008250. ATPase_P-typ_transduc_dom_A.
IPR023214. HAD-like_dom.
IPR006539. P-type_ATPase_IV.
IPR032631. P-type_ATPase_N.
IPR001757. P_typ_ATPase.
IPR032630. P_typ_ATPase_c.
[Graphical view]
PANTHERiPTHR24092. PTHR24092. 1 hit.
PTHR24092:SF46. PTHR24092:SF46. 1 hit.
PfamiPF00122. E1-E2_ATPase. 1 hit.
PF16212. PhoLip_ATPase_C. 1 hit.
PF16209. PhoLip_ATPase_N. 1 hit.
[Graphical view]
SUPFAMiSSF56784. SSF56784. 3 hits.
SSF81660. SSF81660. 1 hit.
TIGRFAMsiTIGR01652. ATPase-Plipid. 1 hit.
TIGR01494. ATPase_P-type. 1 hit.
PROSITEiPS00154. ATPASE_E1_E2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiAT8B2_HUMAN
AccessioniPrimary (citable) accession number: P98198
Secondary accession number(s): B4E3P4
, Q6NT69, Q7Z486, Q96I43, Q96NQ7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: April 30, 2003
Last modified: November 30, 2016
This is version 153 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.