P98194 (AT2C1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 129.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Calcium-transporting ATPase type 2C member 1 Short name=ATPase 2C1 EC=3.6.3.8 Alternative name(s): ATP-dependent Ca(2+) pump PMR1 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 919 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of the calcium. |
| Catalytic activity | ATP + H2O + Ca2+[side 1] = ADP + phosphate + Ca2+[side 2]. |
| Subcellular location | Golgi apparatus membrane; Multi-pass membrane protein Ref.3. |
| Tissue specificity | Found in most tissues except colon, thymus, spleen and leukocytes. Most abundant in keratinocytes and kidney. |
| Involvement in disease | Defects in ATP2C1 are the cause of Hailey-Hailey disease (HHD) [MIM:169600]; also known as benign familial pemphigus. HHD is an autosomal dominant disorder characterized by persistent blisters and suprabasal cell separation (acantholysis) of the epidermis, due to impaired keratinocyte adhesion. Patients lacking all isoforms except isoform 2 have HHD. Ref.1 Ref.2 Ref.9 Ref.10 |
| Sequence similarities | Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIA subfamily. [View classification] |
| Sequence caution | The sequence BAA92585.1 differs from that shown. Reason: Frameshift at position 8. The sequence BAC11142.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] Note: Isoform 1 and isoform 2 are expressed in the same tissues. | ||||||
| Isoform 1 (identifier: P98194-1) Also known as: ATP2C1A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P98194-2) Also known as: ATP2C1B; ATP2C1C; The sequence of this isoform differs from the canonical sequence as follows: 877-919: DLLFLLGLTSSVCIVAEIIKKVERSREKIQKHVSSTSSSFLEV → GLALGEEWTAAG | ||||||
| Isoform 3 (identifier: P98194-3) Also known as: ATP2C1B; The sequence of this isoform differs from the canonical sequence as follows: 1-16: Missing. 910-919: SSTSSSFLEV → WLWERSGQQLVEIHPHLETGLPLTEDVSCV | ||||||
| Isoform 4 (identifier: P98194-4) Also known as: ATP2C1A; The sequence of this isoform differs from the canonical sequence as follows: 1-16: Missing. | ||||||
| Isoform 5 (identifier: P98194-5) Also known as: ATP2C1B; The sequence of this isoform differs from the canonical sequence as follows: 910-919: SSTSSSFLEV → WLWERSGQQLVEIHPHLETGLPLTEDVSCV | ||||||
| Isoform 6 (identifier: P98194-6) Also known as: ATP2C1D; The sequence of this isoform differs from the canonical sequence as follows: 919-919: V → VSSTSSSFLEVWLWERSGQQLVEIHPHLETGLPLTEDVSCV |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 919 | 919 | Calcium-transporting ATPase type 2C member 1 | PRO_0000046223 | |||||
Regions | |||||||||
| Topological domain | 1 – 70 | 70 | Cytoplasmic By similarity | ||||||
| Transmembrane | 71 – 91 | 21 | Helical; Name=1; By similarity | ||||||
| Topological domain | 92 – 104 | 13 | Lumenal By similarity | ||||||
| Transmembrane | 105 – 123 | 19 | Helical; Name=2; By similarity | ||||||
| Topological domain | 124 – 262 | 139 | Cytoplasmic By similarity | ||||||
| Transmembrane | 263 – 282 | 20 | Helical; Name=3; By similarity | ||||||
| Topological domain | 283 – 294 | 12 | Lumenal By similarity | ||||||
| Transmembrane | 295 – 312 | 18 | Helical; Name=4; By similarity | ||||||
| Topological domain | 313 – 699 | 387 | Cytoplasmic By similarity | ||||||
| Transmembrane | 700 – 719 | 20 | Helical; Name=5; By similarity | ||||||
| Topological domain | 720 – 729 | 10 | Lumenal By similarity | ||||||
| Transmembrane | 730 – 750 | 21 | Helical; Name=6; By similarity | ||||||
| Topological domain | 751 – 770 | 20 | Cytoplasmic By similarity | ||||||
| Transmembrane | 771 – 793 | 23 | Helical; Name=7; By similarity | ||||||
| Topological domain | 794 – 808 | 15 | Lumenal By similarity | ||||||
| Transmembrane | 809 – 828 | 20 | Helical; Name=8; By similarity | ||||||
| Topological domain | 829 – 841 | 13 | Cytoplasmic By similarity | ||||||
| Transmembrane | 842 – 860 | 19 | Helical; Name=9; By similarity | ||||||
| Topological domain | 861 – 875 | 15 | Lumenal By similarity | ||||||
| Transmembrane | 876 – 896 | 21 | Helical; Name=10; By similarity | ||||||
| Topological domain | 897 – 919 | 23 | Cytoplasmic By similarity | ||||||
Sites | |||||||||
| Active site | 350 | 1 | 4-aspartylphosphate intermediate By similarity | ||||||
| Metal binding | 303 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||
| Metal binding | 304 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||
| Metal binding | 306 | 1 | Calcium 2; via carbonyl oxygen By similarity | ||||||
| Metal binding | 308 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 644 | 1 | Magnesium By similarity | ||||||
| Metal binding | 648 | 1 | Magnesium By similarity | ||||||
| Metal binding | 738 | 1 | Calcium 2 By similarity | ||||||
| Metal binding | 742 | 1 | Calcium 2 By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 16 | 16 | Missing in isoform 3 and isoform 4. | VSP_000408 | |||||
| Alternative sequence | 877 – 919 | 43 | DLLFL…SFLEV → GLALGEEWTAAG in isoform 2. | VSP_000409 | |||||
| Alternative sequence | 910 – 919 | 10 | SSTSSSFLEV → WLWERSGQQLVEIHPHLETG LPLTEDVSCV in isoform 3 and isoform 5. | VSP_000410 | |||||
| Alternative sequence | 919 | 1 | V → VSSTSSSFLEVWLWERSGQQ LVEIHPHLETGLPLTEDVSC V in isoform 6. | VSP_014102 | |||||
| Natural variant | 201 | 1 | P → L in HHD. Ref.2 | VAR_010130 | |||||
| Natural variant | 304 | 1 | A → T in HHD. Ref.1 | VAR_008803 | |||||
| Natural variant | 309 | 1 | G → C in HHD; unable to bind manganese, reduced affinity for calcium. Ref.9 | VAR_022672 | |||||
| Natural variant | 318 | 1 | L → P in HHD. Ref.1 | VAR_008804 | |||||
| Natural variant | 341 | 1 | L → P in HHD; unstable protein. Ref.9 | VAR_022673 | |||||
| Natural variant | 344 | 1 | C → Y in HDD; unstable protein. Ref.2 | VAR_010131 | |||||
| Natural variant | 411 | 1 | C → R in HDD; unstable protein. Ref.9 | VAR_022674 | |||||
| Natural variant | 450 | 1 | A → T. Corresponds to variant rs41434650 [ dbSNP | Ensembl ]. | VAR_048373 | |||||
| Natural variant | 490 | 1 | C → F in HHD. Ref.10 | VAR_019523 | |||||
| Natural variant | 570 | 1 | T → I in HDD; unstable protein. Ref.2 | VAR_010132 | |||||
| Natural variant | 580 | 1 | I → V in HDD; unable to undergo conformational change necessary for ion transport. Ref.9 | VAR_022675 | |||||
| Natural variant | 584 | 1 | L → P in HHD. Ref.10 | VAR_019524 | |||||
| Natural variant | 641 | 1 | M → R in HHD. Ref.1 | VAR_008805 | |||||
| Natural variant | 645 | 1 | G → R in HHD. Ref.1 | VAR_008806 | |||||
| Natural variant | 709 | 1 | T → M in HHD. Ref.1 | VAR_008807 | |||||
| Natural variant | 742 | 1 | D → Y in HDD; unable to bind calcium or manganese. Ref.9 | VAR_022676 | |||||
| Natural variant | 744 | 1 | P → R in HHD. Ref.1 | VAR_008808 | |||||
| Natural variant | 789 | 1 | G → R in HDD; unstable protein. Ref.9 | VAR_022677 | |||||
Experimental info | |||||||||
| Sequence conflict | 62 | 1 | E → K in AAF26295. Ref.1 | ||||||
| Sequence conflict | 62 | 1 | E → K in AAF26296. Ref.1 | ||||||
| Sequence conflict | 112 | 1 | I → F in AAF35375. Ref.2 | ||||||
| Sequence conflict | 150 | 1 | T → I in BAC11142. Ref.5 | ||||||
| Sequence conflict | 373 | 1 | A → T in AAF26295. Ref.1 | ||||||
| Sequence conflict | 373 | 1 | A → T in AAF26296. Ref.1 | ||||||
| Sequence conflict | 516 | 1 | R → H in CAA09425. Ref.8 | ||||||
| Sequence conflict | 713 | 1 | A → T in BAC11142. Ref.5 | ||||||
| Sequence conflict | 901 | 1 | S → G in BAC11142. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Mutations in ATP2C1, encoding a calcium pump, cause Hailey-Hailey disease." Hu Z., Bonifas J.M., Beech J., Bench G., Shigihara T., Ogawa H., Ikeda S., Mauro T., Epstein E.H. Jr. Nat. Genet. 24:61-65(2000) [PubMed: 10615129] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), VARIANTS HHD THR-304; PRO-318; ARG-641; ARG-645; MET-709 AND ARG-744. |
| [2] | "Hailey-Hailey disease is caused by mutations in ATP2C1 encoding a novel Ca(2+) pump." Sudbrak R., Brown J., Dobson-Stone C., Carter S., Ramser J., White J., Healy E., Dissanayake M., Larregue M., Perrussel M., Lehrach H., Munro C.S., Strachan T., Burge S., Hovnanian A., Monaco A.P. Hum. Mol. Genet. 9:1131-1140(2000) [PubMed: 10767338] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3 AND 4), VARIANTS HHD LEU-201; TYR-344 AND ILE-570. Tissue: Keratinocyte. |
| [3] | "Effect of Hailey-Hailey Disease mutations on the function of a new variant of human secretory pathway Ca2+/Mn2+-ATPase (hSPCA1)." Fairclough R.J., Dode L., Vanoevelen J., Andersen J.P., Missiaen L., Raeymaekers L., Wuytack F., Hovnanian A. J. Biol. Chem. 278:24721-24730(2003) [PubMed: 12707275] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5 AND 6), SUBCELLULAR LOCATION, MUTAGENESIS. Tissue: Keratinocyte. |
| [4] | "Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O. DNA Res. 7:65-73(2000) [PubMed: 10718198] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 6), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 360-919 (ISOFORM 1). Tissue: Mammary gland and Neuron. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Blood. |
| [8] | "Characterization of 16 novel human genes showing high similarity to yeast sequences." Stanchi F., Bertocco E., Toppo S., Dioguardi R., Simionati B., Cannata N., Zimbello R., Lanfranchi G., Valle G. Yeast 18:69-80(2001) [PubMed: 11124703] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 424-919. |
| [9] | "Hailey-Hailey disease: molecular and clinical characterization of novel mutations in the ATP2C1 gene." Dobson-Stone C., Fairclough R., Dunne E., Brown J., Dissanayake M., Munro C.S., Strachan T., Burge S., Sudbrak R., Monaco A.P., Hovnanian A. J. Invest. Dermatol. 118:338-343(2002) [PubMed: 11841554] [Abstract] Cited for: VARIANTS HHD CYS-309; PRO-341; ARG-411; VAL-580; TYR-742 AND ARG-789. |
| [10] | "Analysis of ATP2C1 gene mutation in 10 unrelated Japanese families with Hailey-Hailey disease." Yokota K., Yasukawa K., Shimizu H. J. Invest. Dermatol. 118:550-551(2002) [PubMed: 11874499] [Abstract] Cited for: VARIANTS HHD PHE-490 AND PRO-584. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF181120 mRNA. Translation: AAF26295.1. AF181121 mRNA. Translation: AAF26296.1. AF189723 mRNA. Translation: AAF27813.2. AF225981 mRNA. Translation: AAF35375.1. AY268374 mRNA. Translation: AAP30008.1. AY268375 mRNA. Translation: AAP30009.1. AB037768 mRNA. Translation: BAA92585.1. Frameshift. AK001684 mRNA. Translation: BAA91835.1. AK074692 mRNA. Translation: BAC11142.1. Different initiation. AK314342 mRNA. Translation: BAG36984.1. CH471052 Genomic DNA. Translation: EAW79219.1. BC028139 mRNA. Translation: AAH28139.1. AJ010953 mRNA. Translation: CAA09425.1. |
| IPI | IPI00220473. IPI00413116. IPI00419957. IPI00607568. IPI00607812. IPI00745171. |
| RefSeq | NP_001001485.1. NM_001001485.2. NP_001001486.1. NM_001001486.1. NP_001001487.1. NM_001001487.1. NP_001186108.1. NM_001199179.1. NP_001186109.1. NM_001199180.1. NP_001186110.1. NM_001199181.1. NP_001186111.1. NM_001199182.1. NP_001186112.1. NM_001199183.1. NP_001186113.1. NM_001199184.1. NP_001186114.1. NM_001199185.1. NP_055197.2. NM_014382.3. |
| UniGene | Hs.584884. |
3D structure databases | |
| ProteinModelPortal | P98194. |
| SMR | P98194. Positions 23-904. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P98194. 1 interaction. |
| STRING | P98194. |
Protein family/group databases | |
| TCDB | 3.A.3.2.5. P-type ATPase (P-ATPase) superfamily. |
PTM databases | |
| PhosphoSite | P98194. |
Polymorphism databases | |
| DMDM | 68068024. |
Proteomic databases | |
| PRIDE | P98194. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000359644; ENSP00000352665; ENSG00000017260. ENST00000428331; ENSP00000395809; ENSG00000017260. |
| GeneID | 27032. |
| KEGG | hsa:27032. |
| UCSC | uc003enk.1. human. uc003enl.1. human. uc003enm.1. human. uc003enn.1. human. |
Organism-specific databases | |
| CTD | 27032. |
| GeneCards | GC03P130613. |
| H-InvDB | HIX0003679. |
| HGNC | HGNC:13211. ATP2C1. |
| HPA | CAB010207. HPA035116. |
| MIM | 169600. phenotype. 604384. gene. |
| neXtProt | NX_P98194. |
| Orphanet | 2841. Familial benign chronic pemphigus. |
| PharmGKB | PA25111. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG17631. |
| HOVERGEN | HBG106478. |
| PhylomeDB | P98194. |
Enzyme and pathway databases | |
| BRENDA | 3.6.3.8. 2681. |
| Reactome | REACT_15518. Transmembrane transport of small molecules. |
Gene expression databases | |
| ArrayExpress | P98194. |
| Bgee | P98194. |
| CleanEx | HS_ATP2C1. |
| Genevestigator | P98194. |
| GermOnline | ENSG00000017260. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR023306. ATPase_cation_domN. IPR008250. ATPase_P-typ_ATPase-assoc-dom. IPR006413. ATPase_P-typ_Ca-transp_PMR1. IPR006068. ATPase_P-typ_cation-transptr_C. IPR004014. ATPase_P-typ_cation-transptr_N. IPR023300. ATPase_P-typ_cyto_domA. IPR023299. ATPase_P-typ_cyto_domN. IPR000695. ATPase_P-typ_H-transp. IPR001757. ATPase_P-typ_ion-transptr. IPR018303. ATPase_P-typ_P_site. IPR023298. ATPase_P-typ_TM_dom. IPR005834. Dehalogen-like_hydro. IPR023214. HAD-like_dom. [Graphical view] |
| Gene3D | G3DSA:2.70.150.10. ATPase_P-typ_cyto_domA. 2 hits. G3DSA:3.40.1110.10. ATPase_P-typ_cyto_domN. 1 hit. G3DSA:1.20.1110.10. ATPase_P-typ_TM_dom. 2 hits. |
| KO | K01537. |
| Pfam | PF00689. Cation_ATPase_C. 1 hit. PF00690. Cation_ATPase_N. 1 hit. PF00122. E1-E2_ATPase. 1 hit. PF00702. Hydrolase. 1 hit. [Graphical view] |
| PRINTS | PR00119. CATATPASE. PR00120. HATPASE. |
| SMART | SM00831. Cation_ATPase_N. 1 hit. [Graphical view] |
| SUPFAM | SSF81660. ATPase_cation_domN. 1 hit. SSF56784. HAD-like_dom. 1 hit. |
| TIGRFAMs | TIGR01522. ATPase-IIA2_Ca. 1 hit. TIGR01494. ATPase_P-type. 3 hits. |
| PROSITE | PS00154. ATPASE_E1_E2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| DrugBank | DB01169. Arsenic trioxide. DB01189. Desflurane. DB00228. Enflurane. DB01159. Halothane. DB00753. Isoflurane. DB01028. Methoxyflurane. DB01110. Miconazole. DB01236. Sevoflurane. |
| NextBio | 49568. |
| SOURCE | Search... |
Entry information
| Entry name | AT2C1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P98194 Secondary accession number(s): B2RAT7 Q8NCJ7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with