P98171 (RHG04_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 128.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Rho GTPase-activating protein 4 Alternative name(s): Rho-GAP hematopoietic protein C1 Rho-type GTPase-activating protein 4 p115 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 946 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Inhibitory effect on stress fiber organization. May down-regulate Rho-like GTPase in hematopoietic cells. |
| Subcellular location | Cytoplasm. Note: Just below the plasma membrane. |
| Tissue specificity | Predominantly in hematopoietic cells (spleen, thymus and leukocytes); low levels in placenta, lung and various fetal tissues. |
| Sequence similarities | Contains 1 FCH domain. Contains 1 Rho-GAP domain. Contains 1 SH3 domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Coiled coil SH3 domain |
| Molecular function | GTPase activation |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | Rho protein signal transduction Traceable author statement Ref.1. Source: ProtInc apoptotic processTraceable author statement. Source: Reactome cytoskeleton organizationTraceable author statement Ref.1. Source: ProtInc nerve growth factor receptor signaling pathwayTraceable author statement. Source: Reactome |
| Cellular_component | cytosol Traceable author statement. Source: Reactome focal adhesionInferred from direct assay. Source: HPA nucleusInferred from direct assay. Source: HPA |
| Molecular_function | Rho GTPase activator activity Traceable author statement Ref.1. Source: ProtInc SH3/SH2 adaptor activityTraceable author statement Ref.1. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P98171-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P98171-2) The sequence of this isoform differs from the canonical sequence as follows: 227-227: K → KLWPPQRPVAASSCAPVCWLQAGFLVHPPWWGAMCAPSTHQ | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||
Molecule processing | |||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 946 | 946 | Rho GTPase-activating protein 4 | PRO_0000056701 | |||||||||||||
Regions | |||||||||||||||||
| Domain | 15 – 88 | 74 | FCH | ||||||||||||||
| Domain | 507 – 695 | 189 | Rho-GAP | ||||||||||||||
| Domain | 746 – 805 | 60 | SH3 | ||||||||||||||
| Coiled coil | 128 – 195 | 68 | Potential | ||||||||||||||
Natural variations | |||||||||||||||||
| Alternative sequence | 227 | 1 | K → KLWPPQRPVAASSCAPVCWL QAGFLVHPPWWGAMCAPSTH Q in isoform 2. | VSP_042902 | |||||||||||||
| Natural variant | 104 | 1 | A → V. Corresponds to variant rs5987182 [ dbSNP | Ensembl ]. | VAR_028413 | |||||||||||||
Experimental info | |||||||||||||||||
| Sequence conflict | 609 | 1 | A → D in CAA55394. Ref.1 | ||||||||||||||
| Sequence conflict | 731 | 1 | E → D in CAA55394. Ref.1 | ||||||||||||||
Secondary structure | |||||||||||||||||
Helix Strand Turn | |||||||||||||||||
| Beta strand | 749 – 755 | 7 | |||||||||||||||
| Beta strand | 772 – 780 | 9 | |||||||||||||||
| Beta strand | 783 – 788 | 6 | |||||||||||||||
| Beta strand | 791 – 801 | 11 | |||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "An X chromosome-linked gene encoding a protein with characteristics of a rhoGAP predominantly expressed in hematopoietic cells." Tribioli C., Droetto S., Bione S., Cesareni G., Torrisi M.R., Lotti L.V., Lanfrancone L., Toniolo D., Pelicci P.-G. Proc. Natl. Acad. Sci. U.S.A. 93:695-699(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Embryo. |
| [2] | "The DNA sequence of the human X chromosome." Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. Bentley D.R.Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Pancreas. |
| [5] | "Prediction of the coding sequences of unidentified human genes. IV. The coding sequences of 40 new genes (KIAA0121-KIAA0160) deduced by analysis of cDNA clones from human cell line KG-1." Nagase T., Seki N., Tanaka A., Ishikawa K., Nomura N. DNA Res. 2:167-174(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 5-946 (ISOFORM 1). Tissue: Bone marrow. |
| [6] | "Isolation of new genes in distal Xq28: transcriptional map and identification of a human homologue of the ARD1 N-acetyl transferase of Saccharomyces cerevisiae." Tribioli C., Mancini M., Plassart E., Bione S., Rivella S., Sala C., Torri G., Toniolo D. Hum. Mol. Genet. 3:1061-1068(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-103 (ISOFORM 1). Tissue: Embryo. |
| [7] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [8] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Leukemic T-cell. |
| [9] | "Solution structure of SH3 domain in Rho-GTPase-activating protein 4." RIKEN structural genomics initiative (RSGI) Submitted (OCT-2007) to the PDB data bank Cited for: STRUCTURE BY NMR OF 746-814. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | X78817 mRNA. Translation: CAA55394.1. U52112 Genomic DNA. No translation available. CH471172 Genomic DNA. Translation: EAW72778.1. BC052303 mRNA. Translation: AAH52303.1. D50921 mRNA. Translation: BAA09480.1. | ||||||||||||
| IPI | IPI00328842. IPI00398854. | ||||||||||||
| PIR | I38100. | ||||||||||||
| RefSeq | NP_001158213.1. NM_001164741.1. NP_001657.3. NM_001666.4. | ||||||||||||
| UniGene | Hs.701324. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | P98171. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | P98171. 2 interactions. | ||||||||||||
| STRING | 9606.ENSP00000203786. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | P98171. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 116242759. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | P98171. | ||||||||||||
| PRIDE | P98171. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 393. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000350060; ENSP00000203786; ENSG00000089820. ENST00000370028; ENSP00000359045; ENSG00000089820. ENST00000596481; ENSP00000469103; ENSG00000268876. ENST00000602200; ENSP00000472759; ENSG00000268876. | ||||||||||||
| GeneID | 393. | ||||||||||||
| KEGG | hsa:393. | ||||||||||||
| UCSC | uc004fjk.2. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 393. | ||||||||||||
| GeneCards | GC0XM153172. | ||||||||||||
| HGNC | HGNC:674. ARHGAP4. | ||||||||||||
| HPA | HPA001012. HPA001083. | ||||||||||||
| MIM | 300023. gene. | ||||||||||||
| neXtProt | NX_P98171. | ||||||||||||
| PharmGKB | PA24958. | ||||||||||||
| HUGE | Search... | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG264793. | ||||||||||||
| HOGENOM | HOG000039980. | ||||||||||||
| HOVERGEN | HBG051637. | ||||||||||||
| OMA | GSSREHQ. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Reactome | REACT_111102. Signal Transduction. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | P98171. | ||||||||||||
| Bgee | P98171. | ||||||||||||
| CleanEx | HS_ARHGAP4. | ||||||||||||
| Genevestigator | P98171. | ||||||||||||
| GermOnline | ENSG00000089820. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 1.10.555.10. 1 hit. | ||||||||||||
| InterPro | IPR001060. FCH_dom. IPR008936. Rho_GTPase_activation_prot. IPR000198. RhoGAP_dom. IPR001452. SH3_domain. [Graphical view] | ||||||||||||
| Pfam | PF00611. FCH. 1 hit. PF00620. RhoGAP. 1 hit. PF00018. SH3_1. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00055. FCH. 1 hit. SM00324. RhoGAP. 1 hit. SM00326. SH3. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF48350. Rho_GAP. 1 hit. SSF50044. SH3. 1 hit. | ||||||||||||
| PROSITE | PS50133. FCH. 1 hit. PS50238. RHOGAP. 1 hit. PS50002. SH3. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| EvolutionaryTrace | P98171. | ||||||||||||
| GenomeRNAi | 393. | ||||||||||||
| NextBio | 1639. | ||||||||||||
| PMAP-CutDB | P98171. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | RHG04_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P98171 Secondary accession number(s): Q14144, Q86UY3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
