Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P98171

- RHG04_HUMAN

UniProt

P98171 - RHG04_HUMAN

Protein

Rho GTPase-activating protein 4

Gene

ARHGAP4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 141 (01 Oct 2014)
      Sequence version 2 (17 Oct 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Inhibitory effect on stress fiber organization. May down-regulate Rho-like GTPase in hematopoietic cells.

    GO - Molecular functioni

    1. protein binding Source: UniProtKB
    2. Rho GTPase activator activity Source: ProtInc
    3. SH3/SH2 adaptor activity Source: ProtInc

    GO - Biological processi

    1. apoptotic signaling pathway Source: Reactome
    2. cytoskeleton organization Source: ProtInc
    3. negative regulation of axon extension Source: Ensembl
    4. negative regulation of fibroblast migration Source: Ensembl
    5. neurotrophin TRK receptor signaling pathway Source: Reactome
    6. positive regulation of apoptotic process Source: Reactome
    7. positive regulation of signal transduction Source: GOC
    8. regulation of small GTPase mediated signal transduction Source: Reactome
    9. Rho protein signal transduction Source: ProtInc
    10. small GTPase mediated signal transduction Source: Reactome

    Keywords - Molecular functioni

    GTPase activation

    Enzyme and pathway databases

    ReactomeiREACT_11051. Rho GTPase cycle.
    REACT_13638. NRAGE signals death through JNK.
    REACT_18407. G alpha (12/13) signalling events.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Rho GTPase-activating protein 4
    Alternative name(s):
    Rho-GAP hematopoietic protein C1
    Rho-type GTPase-activating protein 4
    p115
    Gene namesi
    Name:ARHGAP4
    Synonyms:KIAA0131, RGC1, RHOGAP4
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome X

    Organism-specific databases

    HGNCiHGNC:674. ARHGAP4.

    Subcellular locationi

    Cytoplasm
    Note: Just below the plasma membrane.

    GO - Cellular componenti

    1. cytoplasm Source: LIFEdb
    2. cytosol Source: Reactome
    3. growth cone Source: Ensembl

    Keywords - Cellular componenti

    Cytoplasm

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA24958.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 946946Rho GTPase-activating protein 4PRO_0000056701Add
    BLAST

    Proteomic databases

    MaxQBiP98171.
    PaxDbiP98171.
    PRIDEiP98171.

    PTM databases

    PhosphoSiteiP98171.

    Miscellaneous databases

    PMAP-CutDBP98171.

    Expressioni

    Tissue specificityi

    Predominantly in hematopoietic cells (spleen, thymus and leukocytes); low levels in placenta, lung and various fetal tissues.

    Gene expression databases

    ArrayExpressiP98171.
    BgeeiP98171.
    CleanExiHS_ARHGAP4.
    GenevestigatoriP98171.

    Organism-specific databases

    HPAiHPA001012.
    HPA001083.

    Interactioni

    Protein-protein interaction databases

    BioGridi106886. 4 interactions.
    IntActiP98171. 3 interactions.
    MINTiMINT-4717773.
    STRINGi9606.ENSP00000203786.

    Structurei

    Secondary structure

    1
    946
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi749 – 7557
    Beta strandi772 – 7809
    Beta strandi783 – 7886
    Beta strandi791 – 80111

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2EPDNMR-A746-814[»]
    ProteinModelPortaliP98171.
    SMRiP98171. Positions 502-695, 751-814.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiP98171.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini15 – 8874FCHPROSITE-ProRule annotationAdd
    BLAST
    Domaini507 – 695189Rho-GAPPROSITE-ProRule annotationAdd
    BLAST
    Domaini746 – 80560SH3PROSITE-ProRule annotationAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili128 – 19568Sequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Contains 1 FCH domain.PROSITE-ProRule annotation
    Contains 1 Rho-GAP domain.PROSITE-ProRule annotation
    Contains 1 SH3 domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Coiled coil, SH3 domain

    Phylogenomic databases

    eggNOGiNOG264793.
    HOGENOMiHOG000039980.
    HOVERGENiHBG051637.
    OMAiWTQYTQR.
    PhylomeDBiP98171.
    TreeFamiTF315892.

    Family and domain databases

    Gene3Di1.10.555.10. 1 hit.
    InterProiIPR001060. FCH_dom.
    IPR008936. Rho_GTPase_activation_prot.
    IPR000198. RhoGAP_dom.
    IPR001452. SH3_domain.
    [Graphical view]
    PfamiPF00611. FCH. 1 hit.
    PF00620. RhoGAP. 1 hit.
    PF00018. SH3_1. 1 hit.
    [Graphical view]
    SMARTiSM00055. FCH. 1 hit.
    SM00324. RhoGAP. 1 hit.
    SM00326. SH3. 1 hit.
    [Graphical view]
    SUPFAMiSSF48350. SSF48350. 1 hit.
    SSF50044. SSF50044. 1 hit.
    PROSITEiPS50133. FCH. 1 hit.
    PS50238. RHOGAP. 1 hit.
    PS50002. SH3. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P98171-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAAHGKLRRE RGLQAEYETQ VKEMRWQLSE QLRCLELQGE LRRELLQELA    50
    EFMRRRAEVE LEYSRGLEKL AERFSSRGGR LGSSREHQSF RKEPSLLSPL 100
    HCWAVLLQHT RQQSRESAAL SEVLAGPLAQ RLSHIAEDVG RLVKKSRDLE 150
    QQLQDELLEV VSELQTAKKT YQAYHMESVN AEAKLREAER QEEKRAGRSV 200
    PTTTAGATEA GPLRKSSLKK GGRLVEKRQA KFMEHKLKCT KARNEYLLSL 250
    ASVNAAVSNY YLHDVLDLMD CCDTGFHLAL GQVLRSYTAA ESRTQASQVQ 300
    GLGSLEEAVE ALDPPGDKAK VLEVHATVFC PPLRFDYHPH DGDEVAEICV 350
    EMELRDEILP RAQNIQSRLD RQTIETEEVN KTLKATLQAL LEVVASDDGD 400
    VLDSFQTSPS TESLKSTSSD PGSRQAGRRR GQQQETETFY LTKLQEYLSG 450
    RSILAKLQAK HEKLQEALQR GDKEEQEVSW TQYTQRKFQK SRQPRPSSQY 500
    NQRLFGGDME KFIQSSGQPV PLVVESCIRF INLNGLQHEG IFRVSGAQLR 550
    VSEIRDAFER GEDPLVEGCT AHDLDSVAGV LKLYFRSLEP PLFPPDLFGE 600
    LLASSELEAT AERVEHVSRL LWRLPAPVLV VLRYLFTFLN HLAQYSDENM 650
    MDPYNLAVCF GPTLLPVPAG QDPVALQGRV NQLVQTLIVQ PDRVFPPLTS 700
    LPGPVYEKCM APPSASCLGD AQLESLGADN EPELEAEMPA QEDDLEGVVE 750
    AVACFAYTGR TAQELSFRRG DVLRLHERAS SDWWRGEHNG MRGLIPHKYI 800
    TLPAGTEKQV VGAGLQTAGE SGSSPEGLLA SELVHRPEPC TSPEAMGPSG 850
    HRRRCLVPAS PEQHVEVDKA VAQNMDSVFK ELLGKTSVRQ GLGPASTTSP 900
    SPGPRSPKAP PSSRLGRNKG FSRGPGAPAS PSASHPQGLD TTPKPH 946
    Length:946
    Mass (Da):105,026
    Last modified:October 17, 2006 - v2
    Checksum:iED3D48C5DAA24969
    GO
    Isoform 2 (identifier: P98171-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         227-227: K → KLWPPQRPVAASSCAPVCWLQAGFLVHPPWWGAMCAPSTHQ

    Note: No experimental confirmation available.

    Show »
    Length:986
    Mass (Da):109,393
    Checksum:i7098B225673075FB
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti609 – 6091A → D in CAA55394. (PubMed:8570618)Curated
    Sequence conflicti731 – 7311E → D in CAA55394. (PubMed:8570618)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti104 – 1041A → V.
    Corresponds to variant rs5987182 [ dbSNP | Ensembl ].
    VAR_028413

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei227 – 2271K → KLWPPQRPVAASSCAPVCWL QAGFLVHPPWWGAMCAPSTH Q in isoform 2. 1 PublicationVSP_042902

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X78817 mRNA. Translation: CAA55394.1.
    U52112 Genomic DNA. No translation available.
    CH471172 Genomic DNA. Translation: EAW72778.1.
    BC052303 mRNA. Translation: AAH52303.1.
    D50921 mRNA. Translation: BAA09480.1.
    CCDSiCCDS14736.1. [P98171-1]
    CCDS55540.1. [P98171-2]
    PIRiI38100.
    RefSeqiNP_001158213.1. NM_001164741.1. [P98171-2]
    NP_001657.3. NM_001666.4. [P98171-1]
    UniGeneiHs.701324.

    Genome annotation databases

    EnsembliENST00000350060; ENSP00000203786; ENSG00000089820. [P98171-1]
    ENST00000370028; ENSP00000359045; ENSG00000089820. [P98171-2]
    GeneIDi393.
    KEGGihsa:393.
    UCSCiuc004fjk.2. human. [P98171-1]
    uc004fjl.2. human. [P98171-2]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    X78817 mRNA. Translation: CAA55394.1 .
    U52112 Genomic DNA. No translation available.
    CH471172 Genomic DNA. Translation: EAW72778.1 .
    BC052303 mRNA. Translation: AAH52303.1 .
    D50921 mRNA. Translation: BAA09480.1 .
    CCDSi CCDS14736.1. [P98171-1 ]
    CCDS55540.1. [P98171-2 ]
    PIRi I38100.
    RefSeqi NP_001158213.1. NM_001164741.1. [P98171-2 ]
    NP_001657.3. NM_001666.4. [P98171-1 ]
    UniGenei Hs.701324.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2EPD NMR - A 746-814 [» ]
    ProteinModelPortali P98171.
    SMRi P98171. Positions 502-695, 751-814.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 106886. 4 interactions.
    IntActi P98171. 3 interactions.
    MINTi MINT-4717773.
    STRINGi 9606.ENSP00000203786.

    PTM databases

    PhosphoSitei P98171.

    Proteomic databases

    MaxQBi P98171.
    PaxDbi P98171.
    PRIDEi P98171.

    Protocols and materials databases

    DNASUi 393.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000350060 ; ENSP00000203786 ; ENSG00000089820 . [P98171-1 ]
    ENST00000370028 ; ENSP00000359045 ; ENSG00000089820 . [P98171-2 ]
    GeneIDi 393.
    KEGGi hsa:393.
    UCSCi uc004fjk.2. human. [P98171-1 ]
    uc004fjl.2. human. [P98171-2 ]

    Organism-specific databases

    CTDi 393.
    GeneCardsi GC0XM153172.
    HGNCi HGNC:674. ARHGAP4.
    HPAi HPA001012.
    HPA001083.
    MIMi 300023. gene.
    neXtProti NX_P98171.
    PharmGKBi PA24958.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG264793.
    HOGENOMi HOG000039980.
    HOVERGENi HBG051637.
    OMAi WTQYTQR.
    PhylomeDBi P98171.
    TreeFami TF315892.

    Enzyme and pathway databases

    Reactomei REACT_11051. Rho GTPase cycle.
    REACT_13638. NRAGE signals death through JNK.
    REACT_18407. G alpha (12/13) signalling events.

    Miscellaneous databases

    EvolutionaryTracei P98171.
    GeneWikii ARHGAP4.
    GenomeRNAii 393.
    NextBioi 1639.
    PMAP-CutDB P98171.
    PROi P98171.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P98171.
    Bgeei P98171.
    CleanExi HS_ARHGAP4.
    Genevestigatori P98171.

    Family and domain databases

    Gene3Di 1.10.555.10. 1 hit.
    InterProi IPR001060. FCH_dom.
    IPR008936. Rho_GTPase_activation_prot.
    IPR000198. RhoGAP_dom.
    IPR001452. SH3_domain.
    [Graphical view ]
    Pfami PF00611. FCH. 1 hit.
    PF00620. RhoGAP. 1 hit.
    PF00018. SH3_1. 1 hit.
    [Graphical view ]
    SMARTi SM00055. FCH. 1 hit.
    SM00324. RhoGAP. 1 hit.
    SM00326. SH3. 1 hit.
    [Graphical view ]
    SUPFAMi SSF48350. SSF48350. 1 hit.
    SSF50044. SSF50044. 1 hit.
    PROSITEi PS50133. FCH. 1 hit.
    PS50238. RHOGAP. 1 hit.
    PS50002. SH3. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "An X chromosome-linked gene encoding a protein with characteristics of a rhoGAP predominantly expressed in hematopoietic cells."
      Tribioli C., Droetto S., Bione S., Cesareni G., Torrisi M.R., Lotti L.V., Lanfrancone L., Toniolo D., Pelicci P.-G.
      Proc. Natl. Acad. Sci. U.S.A. 93:695-699(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Embryo.
    2. "The DNA sequence of the human X chromosome."
      Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
      , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
      Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Pancreas.
    5. "Prediction of the coding sequences of unidentified human genes. IV. The coding sequences of 40 new genes (KIAA0121-KIAA0160) deduced by analysis of cDNA clones from human cell line KG-1."
      Nagase T., Seki N., Tanaka A., Ishikawa K., Nomura N.
      DNA Res. 2:167-174(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 5-946 (ISOFORM 1).
      Tissue: Bone marrow.
    6. "Isolation of new genes in distal Xq28: transcriptional map and identification of a human homologue of the ARD1 N-acetyl transferase of Saccharomyces cerevisiae."
      Tribioli C., Mancini M., Plassart E., Bione S., Rivella S., Sala C., Torri G., Toniolo D.
      Hum. Mol. Genet. 3:1061-1068(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-103 (ISOFORM 1).
      Tissue: Embryo.
    7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    8. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    9. "Solution structure of SH3 domain in Rho-GTPase-activating protein 4."
      RIKEN structural genomics initiative (RSGI)
      Submitted (OCT-2007) to the PDB data bank
      Cited for: STRUCTURE BY NMR OF 746-814.

    Entry informationi

    Entry nameiRHG04_HUMAN
    AccessioniPrimary (citable) accession number: P98171
    Secondary accession number(s): Q14144, Q86UY3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 1, 1996
    Last sequence update: October 17, 2006
    Last modified: October 1, 2014
    This is version 141 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome X
      Human chromosome X: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3