Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Rho GTPase-activating protein 4

Gene

ARHGAP4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Inhibitory effect on stress fiber organization. May down-regulate Rho-like GTPase in hematopoietic cells.

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

GTPase activation

Enzyme and pathway databases

BioCyciZFISH:ENSG00000089820-MONOMER.
ReactomeiR-HSA-194840. Rho GTPase cycle.

Names & Taxonomyi

Protein namesi
Recommended name:
Rho GTPase-activating protein 4
Alternative name(s):
Rho-GAP hematopoietic protein C1
Rho-type GTPase-activating protein 4
p115
Gene namesi
Name:ARHGAP4
Synonyms:KIAA0131, RGC1, RHOGAP4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

HGNCiHGNC:674. ARHGAP4.

Subcellular locationi

  • Cytoplasm

  • Note: Just below the plasma membrane.

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi393.
OpenTargetsiENSG00000089820.
PharmGKBiPA24958.

Polymorphism and mutation databases

BioMutaiARHGAP4.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000567011 – 946Rho GTPase-activating protein 4Add BLAST946

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei860PhosphoserineCombined sources1
Modified residuei901PhosphoserineCombined sources1
Modified residuei906PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiP98171.
MaxQBiP98171.
PaxDbiP98171.
PeptideAtlasiP98171.
PRIDEiP98171.

PTM databases

iPTMnetiP98171.
PhosphoSitePlusiP98171.

Miscellaneous databases

PMAP-CutDBP98171.

Expressioni

Tissue specificityi

Predominantly in hematopoietic cells (spleen, thymus and leukocytes); low levels in placenta, lung and various fetal tissues.

Gene expression databases

BgeeiENSG00000089820.
CleanExiHS_ARHGAP4.
ExpressionAtlasiP98171. baseline and differential.
GenevisibleiP98171. HS.

Organism-specific databases

HPAiHPA001012.
HPA001083.

Interactioni

GO - Molecular functioni

  • Rac GTPase binding Source: GO_Central
  • SH3/SH2 adaptor activity Source: ProtInc

Protein-protein interaction databases

BioGridi106886. 5 interactors.
DIPiDIP-41592N.
IntActiP98171. 3 interactors.
MINTiMINT-4717773.
STRINGi9606.ENSP00000359045.

Structurei

Secondary structure

1946
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi749 – 755Combined sources7
Beta strandi772 – 780Combined sources9
Beta strandi783 – 788Combined sources6
Beta strandi791 – 801Combined sources11

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2EPDNMR-A746-814[»]
ProteinModelPortaliP98171.
SMRiP98171.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP98171.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini19 – 317F-BARPROSITE-ProRule annotationAdd BLAST299
Domaini507 – 695Rho-GAPPROSITE-ProRule annotationAdd BLAST189
Domaini746 – 805SH3PROSITE-ProRule annotationAdd BLAST60

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili128 – 195Sequence analysisAdd BLAST68

Sequence similaritiesi

Contains 1 F-BAR domain.PROSITE-ProRule annotation
Contains 1 Rho-GAP domain.PROSITE-ProRule annotation
Contains 1 SH3 domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, SH3 domain

Phylogenomic databases

eggNOGiENOG410INNV. Eukaryota.
ENOG410YF76. LUCA.
GeneTreeiENSGT00760000118863.
HOGENOMiHOG000039980.
HOVERGENiHBG051637.
InParanoidiP98171.
KOiK20122.
OMAiWTQYTQR.
OrthoDBiEOG091G0113.
PhylomeDBiP98171.
TreeFamiTF315892.

Family and domain databases

Gene3Di1.10.555.10. 1 hit.
InterProiIPR031160. F_BAR.
IPR001060. FCH_dom.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
IPR001452. SH3_domain.
[Graphical view]
PfamiPF00611. FCH. 1 hit.
PF00620. RhoGAP. 1 hit.
PF00018. SH3_1. 1 hit.
[Graphical view]
SMARTiSM00055. FCH. 1 hit.
SM00324. RhoGAP. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF48350. SSF48350. 1 hit.
SSF50044. SSF50044. 1 hit.
PROSITEiPS51741. F_BAR. 1 hit.
PS50238. RHOGAP. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P98171-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAHGKLRRE RGLQAEYETQ VKEMRWQLSE QLRCLELQGE LRRELLQELA
60 70 80 90 100
EFMRRRAEVE LEYSRGLEKL AERFSSRGGR LGSSREHQSF RKEPSLLSPL
110 120 130 140 150
HCWAVLLQHT RQQSRESAAL SEVLAGPLAQ RLSHIAEDVG RLVKKSRDLE
160 170 180 190 200
QQLQDELLEV VSELQTAKKT YQAYHMESVN AEAKLREAER QEEKRAGRSV
210 220 230 240 250
PTTTAGATEA GPLRKSSLKK GGRLVEKRQA KFMEHKLKCT KARNEYLLSL
260 270 280 290 300
ASVNAAVSNY YLHDVLDLMD CCDTGFHLAL GQVLRSYTAA ESRTQASQVQ
310 320 330 340 350
GLGSLEEAVE ALDPPGDKAK VLEVHATVFC PPLRFDYHPH DGDEVAEICV
360 370 380 390 400
EMELRDEILP RAQNIQSRLD RQTIETEEVN KTLKATLQAL LEVVASDDGD
410 420 430 440 450
VLDSFQTSPS TESLKSTSSD PGSRQAGRRR GQQQETETFY LTKLQEYLSG
460 470 480 490 500
RSILAKLQAK HEKLQEALQR GDKEEQEVSW TQYTQRKFQK SRQPRPSSQY
510 520 530 540 550
NQRLFGGDME KFIQSSGQPV PLVVESCIRF INLNGLQHEG IFRVSGAQLR
560 570 580 590 600
VSEIRDAFER GEDPLVEGCT AHDLDSVAGV LKLYFRSLEP PLFPPDLFGE
610 620 630 640 650
LLASSELEAT AERVEHVSRL LWRLPAPVLV VLRYLFTFLN HLAQYSDENM
660 670 680 690 700
MDPYNLAVCF GPTLLPVPAG QDPVALQGRV NQLVQTLIVQ PDRVFPPLTS
710 720 730 740 750
LPGPVYEKCM APPSASCLGD AQLESLGADN EPELEAEMPA QEDDLEGVVE
760 770 780 790 800
AVACFAYTGR TAQELSFRRG DVLRLHERAS SDWWRGEHNG MRGLIPHKYI
810 820 830 840 850
TLPAGTEKQV VGAGLQTAGE SGSSPEGLLA SELVHRPEPC TSPEAMGPSG
860 870 880 890 900
HRRRCLVPAS PEQHVEVDKA VAQNMDSVFK ELLGKTSVRQ GLGPASTTSP
910 920 930 940
SPGPRSPKAP PSSRLGRNKG FSRGPGAPAS PSASHPQGLD TTPKPH
Length:946
Mass (Da):105,026
Last modified:October 17, 2006 - v2
Checksum:iED3D48C5DAA24969
GO
Isoform 2 (identifier: P98171-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     227-227: K → KLWPPQRPVAASSCAPVCWLQAGFLVHPPWWGAMCAPSTHQ

Note: No experimental confirmation available.
Show »
Length:986
Mass (Da):109,393
Checksum:i7098B225673075FB
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti609A → D in CAA55394 (PubMed:8570618).Curated1
Sequence conflicti731E → D in CAA55394 (PubMed:8570618).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_028413104A → V.Corresponds to variant rs5987182dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_042902227K → KLWPPQRPVAASSCAPVCWL QAGFLVHPPWWGAMCAPSTH Q in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X78817 mRNA. Translation: CAA55394.1.
U52112 Genomic DNA. No translation available.
CH471172 Genomic DNA. Translation: EAW72778.1.
BC052303 mRNA. Translation: AAH52303.1.
D50921 mRNA. Translation: BAA09480.1.
CCDSiCCDS14736.1. [P98171-1]
CCDS55540.1. [P98171-2]
PIRiI38100.
RefSeqiNP_001158213.1. NM_001164741.1. [P98171-2]
NP_001657.3. NM_001666.4. [P98171-1]
UniGeneiHs.701324.

Genome annotation databases

EnsembliENST00000350060; ENSP00000203786; ENSG00000089820. [P98171-1]
ENST00000370028; ENSP00000359045; ENSG00000089820. [P98171-2]
GeneIDi393.
KEGGihsa:393.
UCSCiuc004fjk.3. human. [P98171-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X78817 mRNA. Translation: CAA55394.1.
U52112 Genomic DNA. No translation available.
CH471172 Genomic DNA. Translation: EAW72778.1.
BC052303 mRNA. Translation: AAH52303.1.
D50921 mRNA. Translation: BAA09480.1.
CCDSiCCDS14736.1. [P98171-1]
CCDS55540.1. [P98171-2]
PIRiI38100.
RefSeqiNP_001158213.1. NM_001164741.1. [P98171-2]
NP_001657.3. NM_001666.4. [P98171-1]
UniGeneiHs.701324.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2EPDNMR-A746-814[»]
ProteinModelPortaliP98171.
SMRiP98171.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi106886. 5 interactors.
DIPiDIP-41592N.
IntActiP98171. 3 interactors.
MINTiMINT-4717773.
STRINGi9606.ENSP00000359045.

PTM databases

iPTMnetiP98171.
PhosphoSitePlusiP98171.

Polymorphism and mutation databases

BioMutaiARHGAP4.

Proteomic databases

EPDiP98171.
MaxQBiP98171.
PaxDbiP98171.
PeptideAtlasiP98171.
PRIDEiP98171.

Protocols and materials databases

DNASUi393.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000350060; ENSP00000203786; ENSG00000089820. [P98171-1]
ENST00000370028; ENSP00000359045; ENSG00000089820. [P98171-2]
GeneIDi393.
KEGGihsa:393.
UCSCiuc004fjk.3. human. [P98171-1]

Organism-specific databases

CTDi393.
DisGeNETi393.
GeneCardsiARHGAP4.
HGNCiHGNC:674. ARHGAP4.
HPAiHPA001012.
HPA001083.
MIMi300023. gene.
neXtProtiNX_P98171.
OpenTargetsiENSG00000089820.
PharmGKBiPA24958.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410INNV. Eukaryota.
ENOG410YF76. LUCA.
GeneTreeiENSGT00760000118863.
HOGENOMiHOG000039980.
HOVERGENiHBG051637.
InParanoidiP98171.
KOiK20122.
OMAiWTQYTQR.
OrthoDBiEOG091G0113.
PhylomeDBiP98171.
TreeFamiTF315892.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000089820-MONOMER.
ReactomeiR-HSA-194840. Rho GTPase cycle.

Miscellaneous databases

ChiTaRSiARHGAP4. human.
EvolutionaryTraceiP98171.
GeneWikiiARHGAP4.
GenomeRNAii393.
PMAP-CutDBP98171.
PROiP98171.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000089820.
CleanExiHS_ARHGAP4.
ExpressionAtlasiP98171. baseline and differential.
GenevisibleiP98171. HS.

Family and domain databases

Gene3Di1.10.555.10. 1 hit.
InterProiIPR031160. F_BAR.
IPR001060. FCH_dom.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
IPR001452. SH3_domain.
[Graphical view]
PfamiPF00611. FCH. 1 hit.
PF00620. RhoGAP. 1 hit.
PF00018. SH3_1. 1 hit.
[Graphical view]
SMARTiSM00055. FCH. 1 hit.
SM00324. RhoGAP. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF48350. SSF48350. 1 hit.
SSF50044. SSF50044. 1 hit.
PROSITEiPS51741. F_BAR. 1 hit.
PS50238. RHOGAP. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiRHG04_HUMAN
AccessioniPrimary (citable) accession number: P98171
Secondary accession number(s): Q14144, Q86UY3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 17, 2006
Last modified: November 30, 2016
This is version 162 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.