SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P98171

- RHG04_HUMAN

UniProt

P98171 - RHG04_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Rho GTPase-activating protein 4
Gene
ARHGAP4, KIAA0131, RGC1, RHOGAP4
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Inhibitory effect on stress fiber organization. May down-regulate Rho-like GTPase in hematopoietic cells.

GO - Molecular functioni

  1. Rho GTPase activator activity Source: ProtInc
  2. SH3/SH2 adaptor activity Source: ProtInc
  3. protein binding Source: UniProtKB

GO - Biological processi

  1. Rho protein signal transduction Source: ProtInc
  2. apoptotic signaling pathway Source: Reactome
  3. cytoskeleton organization Source: ProtInc
  4. negative regulation of axon extension Source: Ensembl
  5. negative regulation of fibroblast migration Source: Ensembl
  6. neurotrophin TRK receptor signaling pathway Source: Reactome
  7. positive regulation of apoptotic process Source: Reactome
  8. positive regulation of signal transduction Source: GOC
  9. regulation of small GTPase mediated signal transduction Source: Reactome
  10. small GTPase mediated signal transduction Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

GTPase activation

Enzyme and pathway databases

ReactomeiREACT_11051. Rho GTPase cycle.
REACT_13638. NRAGE signals death through JNK.
REACT_18407. G alpha (12/13) signalling events.

Names & Taxonomyi

Protein namesi
Recommended name:
Rho GTPase-activating protein 4
Alternative name(s):
Rho-GAP hematopoietic protein C1
Rho-type GTPase-activating protein 4
p115
Gene namesi
Name:ARHGAP4
Synonyms:KIAA0131, RGC1, RHOGAP4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome X

Organism-specific databases

HGNCiHGNC:674. ARHGAP4.

Subcellular locationi

Cytoplasm
Note: Just below the plasma membrane.

GO - Cellular componenti

  1. cytoplasm Source: LIFEdb
  2. cytosol Source: Reactome
  3. growth cone Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA24958.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 946946Rho GTPase-activating protein 4
PRO_0000056701Add
BLAST

Proteomic databases

MaxQBiP98171.
PaxDbiP98171.
PRIDEiP98171.

PTM databases

PhosphoSiteiP98171.

Miscellaneous databases

PMAP-CutDBP98171.

Expressioni

Tissue specificityi

Predominantly in hematopoietic cells (spleen, thymus and leukocytes); low levels in placenta, lung and various fetal tissues.

Gene expression databases

ArrayExpressiP98171.
BgeeiP98171.
CleanExiHS_ARHGAP4.
GenevestigatoriP98171.

Organism-specific databases

HPAiHPA001012.
HPA001083.

Interactioni

Protein-protein interaction databases

BioGridi106886. 4 interactions.
IntActiP98171. 3 interactions.
MINTiMINT-4717773.
STRINGi9606.ENSP00000203786.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi749 – 7557
Beta strandi772 – 7809
Beta strandi783 – 7886
Beta strandi791 – 80111

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2EPDNMR-A746-814[»]
ProteinModelPortaliP98171.
SMRiP98171. Positions 502-695, 751-814.

Miscellaneous databases

EvolutionaryTraceiP98171.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini15 – 8874FCH
Add
BLAST
Domaini507 – 695189Rho-GAP
Add
BLAST
Domaini746 – 80560SH3
Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili128 – 19568 Reviewed prediction
Add
BLAST

Sequence similaritiesi

Contains 1 FCH domain.
Contains 1 Rho-GAP domain.
Contains 1 SH3 domain.

Keywords - Domaini

Coiled coil, SH3 domain

Phylogenomic databases

eggNOGiNOG264793.
HOGENOMiHOG000039980.
HOVERGENiHBG051637.
OMAiWTQYTQR.
PhylomeDBiP98171.
TreeFamiTF315892.

Family and domain databases

Gene3Di1.10.555.10. 1 hit.
InterProiIPR001060. FCH_dom.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
IPR001452. SH3_domain.
[Graphical view]
PfamiPF00611. FCH. 1 hit.
PF00620. RhoGAP. 1 hit.
PF00018. SH3_1. 1 hit.
[Graphical view]
SMARTiSM00055. FCH. 1 hit.
SM00324. RhoGAP. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF48350. SSF48350. 1 hit.
SSF50044. SSF50044. 1 hit.
PROSITEiPS50133. FCH. 1 hit.
PS50238. RHOGAP. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P98171-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAAHGKLRRE RGLQAEYETQ VKEMRWQLSE QLRCLELQGE LRRELLQELA    50
EFMRRRAEVE LEYSRGLEKL AERFSSRGGR LGSSREHQSF RKEPSLLSPL 100
HCWAVLLQHT RQQSRESAAL SEVLAGPLAQ RLSHIAEDVG RLVKKSRDLE 150
QQLQDELLEV VSELQTAKKT YQAYHMESVN AEAKLREAER QEEKRAGRSV 200
PTTTAGATEA GPLRKSSLKK GGRLVEKRQA KFMEHKLKCT KARNEYLLSL 250
ASVNAAVSNY YLHDVLDLMD CCDTGFHLAL GQVLRSYTAA ESRTQASQVQ 300
GLGSLEEAVE ALDPPGDKAK VLEVHATVFC PPLRFDYHPH DGDEVAEICV 350
EMELRDEILP RAQNIQSRLD RQTIETEEVN KTLKATLQAL LEVVASDDGD 400
VLDSFQTSPS TESLKSTSSD PGSRQAGRRR GQQQETETFY LTKLQEYLSG 450
RSILAKLQAK HEKLQEALQR GDKEEQEVSW TQYTQRKFQK SRQPRPSSQY 500
NQRLFGGDME KFIQSSGQPV PLVVESCIRF INLNGLQHEG IFRVSGAQLR 550
VSEIRDAFER GEDPLVEGCT AHDLDSVAGV LKLYFRSLEP PLFPPDLFGE 600
LLASSELEAT AERVEHVSRL LWRLPAPVLV VLRYLFTFLN HLAQYSDENM 650
MDPYNLAVCF GPTLLPVPAG QDPVALQGRV NQLVQTLIVQ PDRVFPPLTS 700
LPGPVYEKCM APPSASCLGD AQLESLGADN EPELEAEMPA QEDDLEGVVE 750
AVACFAYTGR TAQELSFRRG DVLRLHERAS SDWWRGEHNG MRGLIPHKYI 800
TLPAGTEKQV VGAGLQTAGE SGSSPEGLLA SELVHRPEPC TSPEAMGPSG 850
HRRRCLVPAS PEQHVEVDKA VAQNMDSVFK ELLGKTSVRQ GLGPASTTSP 900
SPGPRSPKAP PSSRLGRNKG FSRGPGAPAS PSASHPQGLD TTPKPH 946
Length:946
Mass (Da):105,026
Last modified:October 17, 2006 - v2
Checksum:iED3D48C5DAA24969
GO
Isoform 2 (identifier: P98171-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     227-227: K → KLWPPQRPVAASSCAPVCWLQAGFLVHPPWWGAMCAPSTHQ

Note: No experimental confirmation available.

Show »
Length:986
Mass (Da):109,393
Checksum:i7098B225673075FB
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti104 – 1041A → V.
Corresponds to variant rs5987182 [ dbSNP | Ensembl ].
VAR_028413

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei227 – 2271K → KLWPPQRPVAASSCAPVCWL QAGFLVHPPWWGAMCAPSTH Q in isoform 2.
VSP_042902

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti609 – 6091A → D in CAA55394. 1 Publication
Sequence conflicti731 – 7311E → D in CAA55394. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X78817 mRNA. Translation: CAA55394.1.
U52112 Genomic DNA. No translation available.
CH471172 Genomic DNA. Translation: EAW72778.1.
BC052303 mRNA. Translation: AAH52303.1.
D50921 mRNA. Translation: BAA09480.1.
CCDSiCCDS14736.1. [P98171-1]
CCDS55540.1. [P98171-2]
PIRiI38100.
RefSeqiNP_001158213.1. NM_001164741.1. [P98171-2]
NP_001657.3. NM_001666.4. [P98171-1]
UniGeneiHs.701324.

Genome annotation databases

EnsembliENST00000350060; ENSP00000203786; ENSG00000089820. [P98171-1]
ENST00000370028; ENSP00000359045; ENSG00000089820. [P98171-2]
ENST00000596481; ENSP00000469103; ENSG00000268876. [P98171-1]
ENST00000602200; ENSP00000472759; ENSG00000268876. [P98171-2]
GeneIDi393.
KEGGihsa:393.
UCSCiuc004fjk.2. human. [P98171-1]
uc004fjl.2. human. [P98171-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X78817 mRNA. Translation: CAA55394.1 .
U52112 Genomic DNA. No translation available.
CH471172 Genomic DNA. Translation: EAW72778.1 .
BC052303 mRNA. Translation: AAH52303.1 .
D50921 mRNA. Translation: BAA09480.1 .
CCDSi CCDS14736.1. [P98171-1 ]
CCDS55540.1. [P98171-2 ]
PIRi I38100.
RefSeqi NP_001158213.1. NM_001164741.1. [P98171-2 ]
NP_001657.3. NM_001666.4. [P98171-1 ]
UniGenei Hs.701324.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2EPD NMR - A 746-814 [» ]
ProteinModelPortali P98171.
SMRi P98171. Positions 502-695, 751-814.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 106886. 4 interactions.
IntActi P98171. 3 interactions.
MINTi MINT-4717773.
STRINGi 9606.ENSP00000203786.

PTM databases

PhosphoSitei P98171.

Proteomic databases

MaxQBi P98171.
PaxDbi P98171.
PRIDEi P98171.

Protocols and materials databases

DNASUi 393.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000350060 ; ENSP00000203786 ; ENSG00000089820 . [P98171-1 ]
ENST00000370028 ; ENSP00000359045 ; ENSG00000089820 . [P98171-2 ]
ENST00000596481 ; ENSP00000469103 ; ENSG00000268876 . [P98171-1 ]
ENST00000602200 ; ENSP00000472759 ; ENSG00000268876 . [P98171-2 ]
GeneIDi 393.
KEGGi hsa:393.
UCSCi uc004fjk.2. human. [P98171-1 ]
uc004fjl.2. human. [P98171-2 ]

Organism-specific databases

CTDi 393.
GeneCardsi GC0XM153172.
HGNCi HGNC:674. ARHGAP4.
HPAi HPA001012.
HPA001083.
MIMi 300023. gene.
neXtProti NX_P98171.
PharmGKBi PA24958.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG264793.
HOGENOMi HOG000039980.
HOVERGENi HBG051637.
OMAi WTQYTQR.
PhylomeDBi P98171.
TreeFami TF315892.

Enzyme and pathway databases

Reactomei REACT_11051. Rho GTPase cycle.
REACT_13638. NRAGE signals death through JNK.
REACT_18407. G alpha (12/13) signalling events.

Miscellaneous databases

EvolutionaryTracei P98171.
GeneWikii ARHGAP4.
GenomeRNAii 393.
NextBioi 1639.
PMAP-CutDB P98171.
PROi P98171.
SOURCEi Search...

Gene expression databases

ArrayExpressi P98171.
Bgeei P98171.
CleanExi HS_ARHGAP4.
Genevestigatori P98171.

Family and domain databases

Gene3Di 1.10.555.10. 1 hit.
InterProi IPR001060. FCH_dom.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
IPR001452. SH3_domain.
[Graphical view ]
Pfami PF00611. FCH. 1 hit.
PF00620. RhoGAP. 1 hit.
PF00018. SH3_1. 1 hit.
[Graphical view ]
SMARTi SM00055. FCH. 1 hit.
SM00324. RhoGAP. 1 hit.
SM00326. SH3. 1 hit.
[Graphical view ]
SUPFAMi SSF48350. SSF48350. 1 hit.
SSF50044. SSF50044. 1 hit.
PROSITEi PS50133. FCH. 1 hit.
PS50238. RHOGAP. 1 hit.
PS50002. SH3. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "An X chromosome-linked gene encoding a protein with characteristics of a rhoGAP predominantly expressed in hematopoietic cells."
    Tribioli C., Droetto S., Bione S., Cesareni G., Torrisi M.R., Lotti L.V., Lanfrancone L., Toniolo D., Pelicci P.-G.
    Proc. Natl. Acad. Sci. U.S.A. 93:695-699(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Embryo.
  2. "The DNA sequence of the human X chromosome."
    Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
    , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
    Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Pancreas.
  5. "Prediction of the coding sequences of unidentified human genes. IV. The coding sequences of 40 new genes (KIAA0121-KIAA0160) deduced by analysis of cDNA clones from human cell line KG-1."
    Nagase T., Seki N., Tanaka A., Ishikawa K., Nomura N.
    DNA Res. 2:167-174(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 5-946 (ISOFORM 1).
    Tissue: Bone marrow.
  6. "Isolation of new genes in distal Xq28: transcriptional map and identification of a human homologue of the ARD1 N-acetyl transferase of Saccharomyces cerevisiae."
    Tribioli C., Mancini M., Plassart E., Bione S., Rivella S., Sala C., Torri G., Toniolo D.
    Hum. Mol. Genet. 3:1061-1068(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-103 (ISOFORM 1).
    Tissue: Embryo.
  7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  9. "Solution structure of SH3 domain in Rho-GTPase-activating protein 4."
    RIKEN structural genomics initiative (RSGI)
    Submitted (OCT-2007) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 746-814.

Entry informationi

Entry nameiRHG04_HUMAN
AccessioniPrimary (citable) accession number: P98171
Secondary accession number(s): Q14144, Q86UY3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 17, 2006
Last modified: September 3, 2014
This is version 140 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi