P98095 (FBLN2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
December 14, 2011.
Version 109.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Fibulin-2 Short name=FIBL-2 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1184 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Its binding to fibronectin and some other ligands is calcium dependent. |
| Subunit structure | Homotrimer; disulfide-linked. Interacts with LAMA2 By similarity. |
| Subcellular location | |
| Tissue specificity | Component of both basement membranes and other connective tissues. Expressed in heart, placenta and ovary. |
| Developmental stage | Widely expressed during embryonic development. Primarily detected within the neuropithelium, spinal ganglia and peripheral nerves. Ref.5 |
| Sequence similarities | Belongs to the fibulin family. Contains 3 anaphylatoxin-like domains. Contains 11 EGF-like domains. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Extracellular matrix Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | EGF-like domain Repeat Signal |
| Ligand | Calcium |
| PTM | Disulfide bond Glycoprotein Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | proteinaceous extracellular matrix Traceable author statement. Source: ProtInc |
| Molecular function | calcium ion binding Traceable author statement. Source: ProtInc extracellular matrix structural constituentTraceable author statement. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P98095-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P98095-2) The sequence of this isoform differs from the canonical sequence as follows: 718-718: E → EDQDECLMGAHDCSRRQFCVNTLGSFYCVNHTVLCADGYILNAHRKCV |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 27 | 27 | Potential | ||||||||
| Chain | 28 – 1184 | 1157 | Fibulin-2 | PRO_0000007568 | |||||||
Regions | |||||||||||
| Domain | 445 – 480 | 36 | Anaphylatoxin-like 1 | ||||||||
| Domain | 488 – 519 | 32 | Anaphylatoxin-like 2 | ||||||||
| Domain | 521 – 553 | 33 | Anaphylatoxin-like 3 | ||||||||
| Domain | 604 – 645 | 42 | EGF-like 1; calcium-binding | ||||||||
| Domain | 679 – 718 | 40 | EGF-like 2 | ||||||||
| Domain | 719 – 763 | 45 | EGF-like 3; calcium-binding | ||||||||
| Domain | 764 – 809 | 46 | EGF-like 4; calcium-binding | ||||||||
| Domain | 810 – 857 | 48 | EGF-like 5; calcium-binding | ||||||||
| Domain | 858 – 900 | 43 | EGF-like 6; calcium-binding | ||||||||
| Domain | 901 – 942 | 42 | EGF-like 7; calcium-binding | ||||||||
| Domain | 943 – 981 | 39 | EGF-like 8; calcium-binding | ||||||||
| Domain | 982 – 1024 | 43 | EGF-like 9; calcium-binding | ||||||||
| Domain | 1025 – 1069 | 45 | EGF-like 10; calcium-binding | ||||||||
| Region | 28 – 444 | 417 | N | ||||||||
| Region | 28 – 177 | 150 | Subdomain NA (Cys-rich) | ||||||||
| Region | 178 – 444 | 267 | Subdomain NB (Cys-free) | ||||||||
| Region | 1070 – 1184 | 115 | Domain III | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 277 | 1 | Phosphoserine Ref.6 | ||||||||
| Glycosylation | 180 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 507 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 1035 | 1 | N-linked (GlcNAc...) Ref.7 | ||||||||
| Disulfide bond | 445 ↔ 472 | By similarity | |||||||||
| Disulfide bond | 446 ↔ 479 | By similarity | |||||||||
| Disulfide bond | 459 ↔ 480 | By similarity | |||||||||
| Disulfide bond | 489 ↔ 518 | By similarity | |||||||||
| Disulfide bond | 502 ↔ 519 | By similarity | |||||||||
| Disulfide bond | 521 ↔ 545 | By similarity | |||||||||
| Disulfide bond | 522 ↔ 552 | By similarity | |||||||||
| Disulfide bond | 535 ↔ 553 | By similarity | |||||||||
| Disulfide bond | 608 ↔ 620 | By similarity | |||||||||
| Disulfide bond | 616 ↔ 629 | By similarity | |||||||||
| Disulfide bond | 631 ↔ 644 | By similarity | |||||||||
| Disulfide bond | 683 ↔ 693 | By similarity | |||||||||
| Disulfide bond | 689 ↔ 702 | By similarity | |||||||||
| Disulfide bond | 704 ↔ 717 | By similarity | |||||||||
| Disulfide bond | 723 ↔ 736 | By similarity | |||||||||
| Disulfide bond | 730 ↔ 745 | By similarity | |||||||||
| Disulfide bond | 751 ↔ 762 | By similarity | |||||||||
| Disulfide bond | 768 ↔ 781 | By similarity | |||||||||
| Disulfide bond | 775 ↔ 790 | By similarity | |||||||||
| Disulfide bond | 796 ↔ 808 | By similarity | |||||||||
| Disulfide bond | 814 ↔ 827 | By similarity | |||||||||
| Disulfide bond | 821 ↔ 836 | By similarity | |||||||||
| Disulfide bond | 843 ↔ 856 | By similarity | |||||||||
| Disulfide bond | 862 ↔ 875 | By similarity | |||||||||
| Disulfide bond | 869 ↔ 884 | By similarity | |||||||||
| Disulfide bond | 886 ↔ 899 | By similarity | |||||||||
| Disulfide bond | 905 ↔ 917 | By similarity | |||||||||
| Disulfide bond | 913 ↔ 926 | By similarity | |||||||||
| Disulfide bond | 928 ↔ 941 | By similarity | |||||||||
| Disulfide bond | 947 ↔ 956 | By similarity | |||||||||
| Disulfide bond | 952 ↔ 965 | By similarity | |||||||||
| Disulfide bond | 967 ↔ 980 | By similarity | |||||||||
| Disulfide bond | 986 ↔ 998 | By similarity | |||||||||
| Disulfide bond | 994 ↔ 1007 | By similarity | |||||||||
| Disulfide bond | 1009 ↔ 1023 | By similarity | |||||||||
| Disulfide bond | 1029 ↔ 1042 | By similarity | |||||||||
| Disulfide bond | 1036 ↔ 1051 | By similarity | |||||||||
| Disulfide bond | 1056 ↔ 1068 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 718 | 1 | E → EDQDECLMGAHDCSRRQFCV NTLGSFYCVNHTVLCADGYI LNAHRKCV in isoform 2. | VSP_041404 | |||||||
| Natural variant | 45 | 1 | I → V. Corresponds to variant rs60850813 [ dbSNP | Ensembl ]. | VAR_061159 | |||||||
| Natural variant | 144 | 1 | H → R. Corresponds to variant rs28587534 [ dbSNP | Ensembl ]. | VAR_061160 | |||||||
| Natural variant | 361 | 1 | S → G. Corresponds to variant rs3732666 [ dbSNP | Ensembl ]. | VAR_059266 | |||||||
| Natural variant | 387 | 1 | N → T. Corresponds to variant rs3796318 [ dbSNP | Ensembl ]. | VAR_059267 | |||||||
| Natural variant | 854 | 1 | T → A. Ref.1 Corresponds to variant rs9843344 [ dbSNP | Ensembl ]. | VAR_059268 | |||||||
| Natural variant | 1114 | 1 | G → R. Corresponds to variant rs1061375 [ dbSNP | Ensembl ]. | VAR_055722 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 145 | 1 | K → E in CAA57876. Ref.1 | ||||||||
| Sequence conflict | 145 | 1 | K → E in AAN05436. Ref.2 | ||||||||
| Sequence conflict | 664 | 1 | E → G in BAH14261. Ref.3 | ||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Fibulin-2 (FBLN2): human cDNA sequence, mRNA expression, and mapping of the gene on human and mouse chromosomes." Zhang R.-Z., Pan T.-C., Zhang Z.-Y., Mattei M.-G., Timpl R., Chu M.-L. Genomics 22:425-430(1994) [PubMed: 7806230] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ALA-854. Tissue: Fibroblast. |
| [2] | "Identification of a novel alternatively spliced isoform of human fibulin-2 gene abundantly expressed in heart and genetic evaluation in patients with ARVD." Li D., Marian A.J., Roberts R. Submitted (JUL-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 2), ALTERNATIVE SPLICING. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Uterus. |
| [4] | "The DNA sequence, annotation and analysis of human chromosome 3." Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. Gibbs R.A.Nature 440:1194-1198(2006) [PubMed: 16641997] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The extracellular matrix proteins fibulin-1 and fibulin-2 in the early human embryo." Miosge N., Gotz W., Sasaki T., Chu M.-L., Timpl R., Herken R. Histochem. J. 28:109-116(1996) [PubMed: 8737292] [Abstract] Cited for: DEVELOPMENTAL STAGE. |
| [6] | "Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography." Han G., Ye M., Zhou H., Jiang X., Feng S., Jiang X., Tian R., Wan D., Zou H., Gu J. Proteomics 8:1346-1361(2008) [PubMed: 18318008] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-277, MASS SPECTROMETRY. Tissue: Liver. |
| [7] | "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry." Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H. J. Proteome Res. 8:651-661(2009) [PubMed: 19159218] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-1035, MASS SPECTROMETRY. Tissue: Liver. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | X82494 mRNA. Translation: CAA57876.1. AY130458, AY130456, AY130457 Genomic DNA. Translation: AAN05435.1. AY130459 mRNA. Translation: AAN05436.1. AK304827 mRNA. Translation: BAH14261.1. AC090509 Genomic DNA. No translation available. |
| IPI | IPI00465038. IPI01010639. |
| PIR | A55184. |
| RefSeq | NP_001004019.1. NM_001004019.1. NP_001158507.1. NM_001165035.1. NP_001989.2. NM_001998.2. |
| UniGene | Hs.198862. |
3D structure databases | |
| ProteinModelPortal | P98095. |
| SMR | P98095. Positions 470-502, 598-1084. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P98095. 3 interactions. |
| MINT | MINT-1518617. |
| STRING | P98095. |
PTM databases | |
| PhosphoSite | P98095. |
Polymorphism databases | |
| DMDM | 224471827. |
Proteomic databases | |
| PRIDE | P98095. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000295760; ENSP00000295760; ENSG00000163520. |
| GeneID | 2199. |
| KEGG | hsa:2199. |
Organism-specific databases | |
| CTD | 2199. |
| GeneCards | GC03P013565. |
| H-InvDB | HIX0003076. |
| HGNC | HGNC:3601. FBLN2. |
| HPA | CAB018622. HPA001934. |
| MIM | 135821. gene. |
| neXtProt | NX_P98095. |
| PharmGKB | PA28014. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG05607. |
| HOVERGEN | HBG051559. |
Gene expression databases | |
| ArrayExpress | P98095. |
| Bgee | P98095. |
| CleanEx | HS_FBLN2. |
| Genevestigator | P98095. |
| GermOnline | ENSG00000163520. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000020. Anaphylatoxin/fibulin. IPR006210. EGF-like. IPR001881. EGF-like_Ca-bd. IPR013032. EGF-like_reg_CS. IPR000152. EGF-type_Asp/Asn_hydroxyl_site. IPR000742. EGF_3. IPR018097. EGF_Ca-bd_CS. [Graphical view] |
| Pfam | PF01821. ANATO. 2 hits. PF07645. EGF_CA. 6 hits. [Graphical view] |
| SMART | SM00104. ANATO. 3 hits. SM00181. EGF. 1 hit. SM00179. EGF_CA. 9 hits. [Graphical view] |
| PROSITE | PS01177. ANAPHYLATOXIN_1. 3 hits. PS01178. ANAPHYLATOXIN_2. 3 hits. PS00010. ASX_HYDROXYL. 5 hits. PS00022. EGF_1. False negative. PS01186. EGF_2. 5 hits. PS50026. EGF_3. 4 hits. PS01187. EGF_CA. 9 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| SOURCE | Search... |
Entry information
| Entry name | FBLN2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P98095 Secondary accession number(s): B7Z9C5, Q8IUI0, Q8IUI1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with