Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Fibulin-2

Gene

FBLN2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Its binding to fibronectin and some other ligands is calcium dependent. May act as an adapter that mediates the interaction between FBN1 and ELN (PubMed:17255108).1 Publication

GO - Molecular functioni

  • calcium ion binding Source: ProtInc
  • extracellular matrix binding Source: Ensembl
  • extracellular matrix structural constituent Source: ProtInc

GO - Biological processi

Complete GO annotation...

Keywords - Ligandi

Calcium

Enzyme and pathway databases

BioCyciZFISH:ENSG00000163520-MONOMER.
ReactomeiR-HSA-2129379. Molecules associated with elastic fibres.

Names & Taxonomyi

Protein namesi
Recommended name:
Fibulin-2
Short name:
FIBL-2
Gene namesi
Name:FBLN2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:3601. FBLN2.

Subcellular locationi

GO - Cellular componenti

  • extracellular exosome Source: UniProtKB
  • extracellular matrix Source: UniProtKB
  • extracellular region Source: Reactome
  • extracellular vesicle Source: UniProtKB
  • proteinaceous extracellular matrix Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Extracellular matrix, Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi2199.
OpenTargetsiENSG00000163520.
PharmGKBiPA28014.

Polymorphism and mutation databases

BioMutaiFBLN2.
DMDMi224471827.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 27Sequence analysisAdd BLAST27
ChainiPRO_000000756828 – 1184Fibulin-2Add BLAST1157

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi180N-linked (GlcNAc...)Sequence analysis1
Modified residuei277PhosphoserineCombined sources1
Glycosylationi347O-linked (GalNAc...); or Ser-3481 Publication1
Glycosylationi348O-linked (GalNAc...); or Thr-3471 Publication1
Disulfide bondi445 ↔ 472By similarity
Disulfide bondi446 ↔ 479By similarity
Disulfide bondi459 ↔ 480By similarity
Disulfide bondi489 ↔ 518By similarity
Disulfide bondi502 ↔ 519By similarity
Glycosylationi507N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi521 ↔ 545By similarity
Disulfide bondi522 ↔ 552By similarity
Disulfide bondi535 ↔ 553By similarity
Disulfide bondi608 ↔ 620By similarity
Disulfide bondi616 ↔ 629By similarity
Disulfide bondi631 ↔ 644By similarity
Disulfide bondi683 ↔ 693By similarity
Disulfide bondi689 ↔ 702By similarity
Disulfide bondi704 ↔ 717By similarity
Disulfide bondi723 ↔ 736By similarity
Disulfide bondi730 ↔ 745By similarity
Disulfide bondi751 ↔ 762By similarity
Disulfide bondi768 ↔ 781By similarity
Disulfide bondi775 ↔ 790By similarity
Disulfide bondi796 ↔ 808By similarity
Disulfide bondi814 ↔ 827By similarity
Disulfide bondi821 ↔ 836By similarity
Disulfide bondi843 ↔ 856By similarity
Disulfide bondi862 ↔ 875By similarity
Disulfide bondi869 ↔ 884By similarity
Disulfide bondi886 ↔ 899By similarity
Disulfide bondi905 ↔ 917By similarity
Disulfide bondi913 ↔ 926By similarity
Disulfide bondi928 ↔ 941By similarity
Disulfide bondi947 ↔ 956By similarity
Disulfide bondi952 ↔ 965By similarity
Disulfide bondi967 ↔ 980By similarity
Disulfide bondi986 ↔ 998By similarity
Disulfide bondi994 ↔ 1007By similarity
Disulfide bondi1009 ↔ 1023By similarity
Disulfide bondi1029 ↔ 1042By similarity
Glycosylationi1035N-linked (GlcNAc...)1 Publication1
Disulfide bondi1036 ↔ 1051By similarity
Disulfide bondi1056 ↔ 1068By similarity

Post-translational modificationi

O-glycosylated with core 1 or possibly core 8 glycans. It is unsure if the O-glycosylation is on Thr-347 or Ser-348.2 Publications

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiP98095.
PaxDbiP98095.
PeptideAtlasiP98095.
PRIDEiP98095.

PTM databases

iPTMnetiP98095.
PhosphoSitePlusiP98095.
UniCarbKBiP98095.

Expressioni

Tissue specificityi

Component of both basement membranes and other connective tissues. Expressed in heart, placenta and ovary.

Developmental stagei

Widely expressed during embryonic development. Primarily detected within the neuropithelium, spinal ganglia and peripheral nerves.1 Publication

Gene expression databases

BgeeiENSG00000163520.
CleanExiHS_FBLN2.
ExpressionAtlasiP98095. baseline and differential.
GenevisibleiP98095. HS.

Organism-specific databases

HPAiCAB018622.
HPA001934.

Interactioni

Subunit structurei

Homotrimer; disulfide-linked. Interacts with LAMA2 (By similarity). Interacts with FBN1 (via N-terminal domain). Forms a ternary complex with ELN and FBN1 (PubMed:17255108).By similarity1 Publication

Protein-protein interaction databases

BioGridi108493. 15 interactors.
IntActiP98095. 12 interactors.
MINTiMINT-1518617.
STRINGi9606.ENSP00000384169.

Structurei

3D structure databases

ProteinModelPortaliP98095.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini445 – 480Anaphylatoxin-like 1PROSITE-ProRule annotationAdd BLAST36
Domaini488 – 519Anaphylatoxin-like 2PROSITE-ProRule annotationAdd BLAST32
Domaini521 – 553Anaphylatoxin-like 3PROSITE-ProRule annotationAdd BLAST33
Domaini604 – 645EGF-like 1; calcium-bindingPROSITE-ProRule annotationAdd BLAST42
Domaini679 – 718EGF-like 2PROSITE-ProRule annotationAdd BLAST40
Domaini719 – 763EGF-like 3; calcium-bindingPROSITE-ProRule annotationAdd BLAST45
Domaini764 – 809EGF-like 4; calcium-bindingPROSITE-ProRule annotationAdd BLAST46
Domaini810 – 857EGF-like 5; calcium-bindingPROSITE-ProRule annotationAdd BLAST48
Domaini858 – 900EGF-like 6; calcium-bindingPROSITE-ProRule annotationAdd BLAST43
Domaini901 – 942EGF-like 7; calcium-bindingPROSITE-ProRule annotationAdd BLAST42
Domaini943 – 981EGF-like 8; calcium-bindingPROSITE-ProRule annotationAdd BLAST39
Domaini982 – 1024EGF-like 9; calcium-bindingPROSITE-ProRule annotationAdd BLAST43
Domaini1025 – 1069EGF-like 10; calcium-bindingPROSITE-ProRule annotationAdd BLAST45

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni28 – 444NAdd BLAST417
Regioni28 – 177Subdomain NA (Cys-rich)Add BLAST150
Regioni178 – 444Subdomain NB (Cys-free)Add BLAST267
Regioni1070 – 1184Domain IIIAdd BLAST115

Sequence similaritiesi

Belongs to the fibulin family.Curated
Contains 3 anaphylatoxin-like domains.PROSITE-ProRule annotation
Contains 10 EGF-like domains.PROSITE-ProRule annotation

Keywords - Domaini

EGF-like domain, Repeat, Signal

Phylogenomic databases

eggNOGiENOG410IR7F. Eukaryota.
ENOG410Y194. LUCA.
GeneTreeiENSGT00760000118806.
HOGENOMiHOG000007079.
HOVERGENiHBG051559.
InParanoidiP98095.
KOiK17307.
OMAiDQDECLM.
OrthoDBiEOG091G02LJ.
PhylomeDBiP98095.
TreeFamiTF317514.

Family and domain databases

InterProiIPR000020. Anaphylatoxin/fibulin.
IPR026823. cEGF.
IPR001881. EGF-like_Ca-bd_dom.
IPR013032. EGF-like_CS.
IPR000742. EGF-like_dom.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR018097. EGF_Ca-bd_CS.
IPR009030. Growth_fac_rcpt_.
[Graphical view]
PfamiPF01821. ANATO. 1 hit.
PF12662. cEGF. 2 hits.
PF07645. EGF_CA. 5 hits.
[Graphical view]
SMARTiSM00104. ANATO. 3 hits.
SM00181. EGF. 11 hits.
SM00179. EGF_CA. 9 hits.
[Graphical view]
SUPFAMiSSF57184. SSF57184. 5 hits.
PROSITEiPS01177. ANAPHYLATOXIN_1. 3 hits.
PS01178. ANAPHYLATOXIN_2. 3 hits.
PS00010. ASX_HYDROXYL. 5 hits.
PS01186. EGF_2. 5 hits.
PS50026. EGF_3. 4 hits.
PS01187. EGF_CA. 9 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P98095-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVLLWEPAGA WLALGLALAL GPSVAAAAPR QDCTGVECPP LENCIEEALE
60 70 80 90 100
PGACCATCVQ QGCACEGYQY YDCLQGGFVR GRVPAGQSYF VDFGSTECSC
110 120 130 140 150
PPGGGKISCQ FMLCPELPPN CIEAVVVADS CPQCGQVGCV HAGHKYAAGH
160 170 180 190 200
TVHLPPCRAC HCPDAGGELI CYQLPGCHGN FSDAEEGDPE RHYEDPYSYD
210 220 230 240 250
QEVAEVEAAT ALGGEVQAGA VQAGAGGPPA ALGGGSQPLS TIQAPPWPAV
260 270 280 290 300
LPRPTAAAAL GPPAPVQAKA RRVTEDSEEE EEEEEEREEM AVTEQLAAGG
310 320 330 340 350
HRGLDGLPTT APAGPSLPIQ EERAEAGARA EAGARPEENL ILDAQATSRS
360 370 380 390 400
TGPEGVTHAP SLGKAALVPT QAVPGSPRDP VKPSPHNILS TSLPDAAWIP
410 420 430 440 450
PTREVPRKPQ VLPHSHVEED TDPNSVHSIP RSSPEGSTKD LIETCCAAGQ
460 470 480 490 500
QWAIDNDECL EIPESGTEDN VCRTAQRHCC VSYLQEKSCM AGVLGAKEGE
510 520 530 540 550
TCGAEDNDSC GISLYKQCCD CCGLGLRVRA EGQSCESNPN LGYPCNHVML
560 570 580 590 600
SCCEGEEPLI VPEVRRPPEP AAAPRRVSEA EMAGREALSL GTEAELPNSL
610 620 630 640 650
PGDDQDECLL LPGELCQHLC INTVGSYHCA CFPGFSLQDD GRTCRPEGHP
660 670 680 690 700
PQPEAPQEPA LKSEFSQVAS NTIPLPLPQP NTCKDNGPCK QVCSTVGGSA
710 720 730 740 750
ICSCFPGYAI MADGVSCEDI NECVTDLHTC SRGEHCVNTL GSFHCYKALT
760 770 780 790 800
CEPGYALKDG ECEDVDECAM GTHTCQPGFL CQNTKGSFYC QARQRCMDGF
810 820 830 840 850
LQDPEGNCVD INECTSLSEP CRPGFSCINT VGSYTCQRNP LICARGYHAS
860 870 880 890 900
DDGTKCVDVN ECETGVHRCG EGQVCHNLPG SYRCDCKAGF QRDAFGRGCI
910 920 930 940 950
DVNECWASPG RLCQHTCENT LGSYRCSCAS GFLLAADGKR CEDVNECEAQ
960 970 980 990 1000
RCSQECANIY GSYQCYCRQG YQLAEDGHTC TDIDECAQGA GILCTFRCLN
1010 1020 1030 1040 1050
VPGSYQCACP EQGYTMTANG RSCKDVDECA LGTHNCSEAE TCHNIQGSFR
1060 1070 1080 1090 1100
CLRFECPPNY VQVSKTKCER TTCHDFLECQ NSPARITHYQ LNFQTGLLVP
1110 1120 1130 1140 1150
AHIFRIGPAP AFTGDTIALN IIKGNEEGYF GTRRLNAYTG VVYLQRAVLE
1160 1170 1180
PRDFALDVEM KLWRQGSVTT FLAKMHIFFT TFAL
Length:1,184
Mass (Da):126,573
Last modified:March 3, 2009 - v2
Checksum:iD46890D93518B343
GO
Isoform 2 (identifier: P98095-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     718-718: E → EDQDECLMGAHDCSRRQFCVNTLGSFYCVNHTVLCADGYILNAHRKCV

Show »
Length:1,231
Mass (Da):131,863
Checksum:i914C7630E2D9FC4E
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti145K → E in CAA57876 (PubMed:7806230).Curated1
Sequence conflicti145K → E in AAN05436 (Ref. 2) Curated1
Sequence conflicti664E → G in BAH14261 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06115945I → V.Corresponds to variant rs60850813dbSNPEnsembl.1
Natural variantiVAR_061160144H → R.Corresponds to variant rs28587534dbSNPEnsembl.1
Natural variantiVAR_059266361S → G.Corresponds to variant rs3732666dbSNPEnsembl.1
Natural variantiVAR_059267387N → T.Corresponds to variant rs3796318dbSNPEnsembl.1
Natural variantiVAR_059268854T → A.1 PublicationCorresponds to variant rs9843344dbSNPEnsembl.1
Natural variantiVAR_0557221114G → R.Corresponds to variant rs1061375dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_041404718E → EDQDECLMGAHDCSRRQFCV NTLGSFYCVNHTVLCADGYI LNAHRKCV in isoform 2. 2 Publications1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X82494 mRNA. Translation: CAA57876.1.
AY130458, AY130456, AY130457 Genomic DNA. Translation: AAN05435.1.
AY130459 mRNA. Translation: AAN05436.1.
AK304827 mRNA. Translation: BAH14261.1.
AC090509 Genomic DNA. No translation available.
CCDSiCCDS46761.1. [P98095-2]
CCDS46762.1. [P98095-1]
PIRiA55184.
RefSeqiNP_001004019.1. NM_001004019.1. [P98095-2]
NP_001158507.1. NM_001165035.1. [P98095-2]
NP_001989.2. NM_001998.2. [P98095-1]
UniGeneiHs.198862.

Genome annotation databases

EnsembliENST00000295760; ENSP00000295760; ENSG00000163520. [P98095-1]
ENST00000404922; ENSP00000384169; ENSG00000163520. [P98095-2]
ENST00000492059; ENSP00000420042; ENSG00000163520. [P98095-2]
GeneIDi2199.
KEGGihsa:2199.
UCSCiuc011ava.3. human. [P98095-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X82494 mRNA. Translation: CAA57876.1.
AY130458, AY130456, AY130457 Genomic DNA. Translation: AAN05435.1.
AY130459 mRNA. Translation: AAN05436.1.
AK304827 mRNA. Translation: BAH14261.1.
AC090509 Genomic DNA. No translation available.
CCDSiCCDS46761.1. [P98095-2]
CCDS46762.1. [P98095-1]
PIRiA55184.
RefSeqiNP_001004019.1. NM_001004019.1. [P98095-2]
NP_001158507.1. NM_001165035.1. [P98095-2]
NP_001989.2. NM_001998.2. [P98095-1]
UniGeneiHs.198862.

3D structure databases

ProteinModelPortaliP98095.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi108493. 15 interactors.
IntActiP98095. 12 interactors.
MINTiMINT-1518617.
STRINGi9606.ENSP00000384169.

PTM databases

iPTMnetiP98095.
PhosphoSitePlusiP98095.
UniCarbKBiP98095.

Polymorphism and mutation databases

BioMutaiFBLN2.
DMDMi224471827.

Proteomic databases

MaxQBiP98095.
PaxDbiP98095.
PeptideAtlasiP98095.
PRIDEiP98095.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000295760; ENSP00000295760; ENSG00000163520. [P98095-1]
ENST00000404922; ENSP00000384169; ENSG00000163520. [P98095-2]
ENST00000492059; ENSP00000420042; ENSG00000163520. [P98095-2]
GeneIDi2199.
KEGGihsa:2199.
UCSCiuc011ava.3. human. [P98095-1]

Organism-specific databases

CTDi2199.
DisGeNETi2199.
GeneCardsiFBLN2.
H-InvDBHIX0003076.
HGNCiHGNC:3601. FBLN2.
HPAiCAB018622.
HPA001934.
MIMi135821. gene.
neXtProtiNX_P98095.
OpenTargetsiENSG00000163520.
PharmGKBiPA28014.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IR7F. Eukaryota.
ENOG410Y194. LUCA.
GeneTreeiENSGT00760000118806.
HOGENOMiHOG000007079.
HOVERGENiHBG051559.
InParanoidiP98095.
KOiK17307.
OMAiDQDECLM.
OrthoDBiEOG091G02LJ.
PhylomeDBiP98095.
TreeFamiTF317514.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000163520-MONOMER.
ReactomeiR-HSA-2129379. Molecules associated with elastic fibres.

Miscellaneous databases

GeneWikiiFBLN2.
GenomeRNAii2199.
PROiP98095.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000163520.
CleanExiHS_FBLN2.
ExpressionAtlasiP98095. baseline and differential.
GenevisibleiP98095. HS.

Family and domain databases

InterProiIPR000020. Anaphylatoxin/fibulin.
IPR026823. cEGF.
IPR001881. EGF-like_Ca-bd_dom.
IPR013032. EGF-like_CS.
IPR000742. EGF-like_dom.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR018097. EGF_Ca-bd_CS.
IPR009030. Growth_fac_rcpt_.
[Graphical view]
PfamiPF01821. ANATO. 1 hit.
PF12662. cEGF. 2 hits.
PF07645. EGF_CA. 5 hits.
[Graphical view]
SMARTiSM00104. ANATO. 3 hits.
SM00181. EGF. 11 hits.
SM00179. EGF_CA. 9 hits.
[Graphical view]
SUPFAMiSSF57184. SSF57184. 5 hits.
PROSITEiPS01177. ANAPHYLATOXIN_1. 3 hits.
PS01178. ANAPHYLATOXIN_2. 3 hits.
PS00010. ASX_HYDROXYL. 5 hits.
PS01186. EGF_2. 5 hits.
PS50026. EGF_3. 4 hits.
PS01187. EGF_CA. 9 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiFBLN2_HUMAN
AccessioniPrimary (citable) accession number: P98095
Secondary accession number(s): B7Z9C5, Q8IUI0, Q8IUI1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: March 3, 2009
Last modified: November 30, 2016
This is version 157 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.