Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P98095

- FBLN2_HUMAN

UniProt

P98095 - FBLN2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Fibulin-2

Gene

FBLN2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Its binding to fibronectin and some other ligands is calcium dependent.

GO - Molecular functioni

  1. calcium ion binding Source: ProtInc
  2. extracellular matrix binding Source: Ensembl
  3. extracellular matrix structural constituent Source: ProtInc

GO - Biological processi

  1. extracellular matrix organization Source: Reactome
  2. positive regulation of cell-substrate adhesion Source: Ensembl
Complete GO annotation...

Keywords - Ligandi

Calcium

Enzyme and pathway databases

ReactomeiREACT_150331. Molecules associated with elastic fibres.

Names & Taxonomyi

Protein namesi
Recommended name:
Fibulin-2
Short name:
FIBL-2
Gene namesi
Name:FBLN2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 3

Organism-specific databases

HGNCiHGNC:3601. FBLN2.

Subcellular locationi

GO - Cellular componenti

  1. extracellular matrix Source: UniProtKB
  2. extracellular region Source: Reactome
  3. extracellular vesicular exosome Source: UniProt
  4. proteinaceous extracellular matrix Source: ProtInc
  5. vesicle Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Extracellular matrix, Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA28014.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2727Sequence AnalysisAdd
BLAST
Chaini28 – 11841157Fibulin-2PRO_0000007568Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi180 – 1801N-linked (GlcNAc...)Sequence Analysis
Modified residuei277 – 2771Phosphoserine1 Publication
Glycosylationi347 – 3471O-linked (GalNAc...); or Ser-3481 Publication
Glycosylationi348 – 3481O-linked (GalNAc...); or Thr-3471 Publication
Disulfide bondi445 ↔ 472By similarity
Disulfide bondi446 ↔ 479By similarity
Disulfide bondi459 ↔ 480By similarity
Disulfide bondi489 ↔ 518By similarity
Disulfide bondi502 ↔ 519By similarity
Glycosylationi507 – 5071N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi521 ↔ 545By similarity
Disulfide bondi522 ↔ 552By similarity
Disulfide bondi535 ↔ 553By similarity
Disulfide bondi608 ↔ 620By similarity
Disulfide bondi616 ↔ 629By similarity
Disulfide bondi631 ↔ 644By similarity
Disulfide bondi683 ↔ 693By similarity
Disulfide bondi689 ↔ 702By similarity
Disulfide bondi704 ↔ 717By similarity
Disulfide bondi723 ↔ 736By similarity
Disulfide bondi730 ↔ 745By similarity
Disulfide bondi751 ↔ 762By similarity
Disulfide bondi768 ↔ 781By similarity
Disulfide bondi775 ↔ 790By similarity
Disulfide bondi796 ↔ 808By similarity
Disulfide bondi814 ↔ 827By similarity
Disulfide bondi821 ↔ 836By similarity
Disulfide bondi843 ↔ 856By similarity
Disulfide bondi862 ↔ 875By similarity
Disulfide bondi869 ↔ 884By similarity
Disulfide bondi886 ↔ 899By similarity
Disulfide bondi905 ↔ 917By similarity
Disulfide bondi913 ↔ 926By similarity
Disulfide bondi928 ↔ 941By similarity
Disulfide bondi947 ↔ 956By similarity
Disulfide bondi952 ↔ 965By similarity
Disulfide bondi967 ↔ 980By similarity
Disulfide bondi986 ↔ 998By similarity
Disulfide bondi994 ↔ 1007By similarity
Disulfide bondi1009 ↔ 1023By similarity
Disulfide bondi1029 ↔ 1042By similarity
Glycosylationi1035 – 10351N-linked (GlcNAc...)1 Publication
Disulfide bondi1036 ↔ 1051By similarity
Disulfide bondi1056 ↔ 1068By similarity

Post-translational modificationi

O-glycosylated with core 1 or possibly core 8 glycans. It is unsure if the O-glycosylation is on Thr-347 or Ser-348.2 Publications

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiP98095.
PaxDbiP98095.
PRIDEiP98095.

PTM databases

PhosphoSiteiP98095.

Expressioni

Tissue specificityi

Component of both basement membranes and other connective tissues. Expressed in heart, placenta and ovary.

Developmental stagei

Widely expressed during embryonic development. Primarily detected within the neuropithelium, spinal ganglia and peripheral nerves.1 Publication

Gene expression databases

BgeeiP98095.
CleanExiHS_FBLN2.
ExpressionAtlasiP98095. baseline and differential.
GenevestigatoriP98095.

Organism-specific databases

HPAiCAB018622.
HPA001934.

Interactioni

Subunit structurei

Homotrimer; disulfide-linked. Interacts with LAMA2 By similarity.By similarity

Protein-protein interaction databases

BioGridi108493. 15 interactions.
IntActiP98095. 6 interactions.
MINTiMINT-1518617.
STRINGi9606.ENSP00000384169.

Structurei

3D structure databases

ProteinModelPortaliP98095.
SMRiP98095. Positions 603-1069.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini445 – 48036Anaphylatoxin-like 1PROSITE-ProRule annotationAdd
BLAST
Domaini488 – 51932Anaphylatoxin-like 2PROSITE-ProRule annotationAdd
BLAST
Domaini521 – 55333Anaphylatoxin-like 3PROSITE-ProRule annotationAdd
BLAST
Domaini604 – 64542EGF-like 1; calcium-bindingPROSITE-ProRule annotationAdd
BLAST
Domaini679 – 71840EGF-like 2PROSITE-ProRule annotationAdd
BLAST
Domaini719 – 76345EGF-like 3; calcium-bindingPROSITE-ProRule annotationAdd
BLAST
Domaini764 – 80946EGF-like 4; calcium-bindingPROSITE-ProRule annotationAdd
BLAST
Domaini810 – 85748EGF-like 5; calcium-bindingPROSITE-ProRule annotationAdd
BLAST
Domaini858 – 90043EGF-like 6; calcium-bindingPROSITE-ProRule annotationAdd
BLAST
Domaini901 – 94242EGF-like 7; calcium-bindingPROSITE-ProRule annotationAdd
BLAST
Domaini943 – 98139EGF-like 8; calcium-bindingPROSITE-ProRule annotationAdd
BLAST
Domaini982 – 102443EGF-like 9; calcium-bindingPROSITE-ProRule annotationAdd
BLAST
Domaini1025 – 106945EGF-like 10; calcium-bindingPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni28 – 444417NAdd
BLAST
Regioni28 – 177150Subdomain NA (Cys-rich)Add
BLAST
Regioni178 – 444267Subdomain NB (Cys-free)Add
BLAST
Regioni1070 – 1184115Domain IIIAdd
BLAST

Sequence similaritiesi

Belongs to the fibulin family.Curated
Contains 3 anaphylatoxin-like domains.PROSITE-ProRule annotation
Contains 10 EGF-like domains.PROSITE-ProRule annotation

Keywords - Domaini

EGF-like domain, Repeat, Signal

Phylogenomic databases

eggNOGiNOG12793.
GeneTreeiENSGT00760000118806.
HOGENOMiHOG000007079.
HOVERGENiHBG051559.
InParanoidiP98095.
KOiK17307.
OMAiSETKCER.
OrthoDBiEOG7P5T0C.
PhylomeDBiP98095.
TreeFamiTF317514.

Family and domain databases

InterProiIPR000020. Anaphylatoxin/fibulin.
IPR026823. cEGF.
IPR000742. EG-like_dom.
IPR001881. EGF-like_Ca-bd_dom.
IPR013032. EGF-like_CS.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR018097. EGF_Ca-bd_CS.
IPR009030. Growth_fac_rcpt_N_dom.
[Graphical view]
PfamiPF01821. ANATO. 2 hits.
PF12662. cEGF. 2 hits.
PF07645. EGF_CA. 5 hits.
[Graphical view]
SMARTiSM00104. ANATO. 3 hits.
SM00181. EGF. 1 hit.
SM00179. EGF_CA. 9 hits.
[Graphical view]
SUPFAMiSSF57184. SSF57184. 5 hits.
PROSITEiPS01177. ANAPHYLATOXIN_1. 3 hits.
PS01178. ANAPHYLATOXIN_2. 3 hits.
PS00010. ASX_HYDROXYL. 5 hits.
PS01186. EGF_2. 5 hits.
PS50026. EGF_3. 4 hits.
PS01187. EGF_CA. 9 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P98095-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVLLWEPAGA WLALGLALAL GPSVAAAAPR QDCTGVECPP LENCIEEALE
60 70 80 90 100
PGACCATCVQ QGCACEGYQY YDCLQGGFVR GRVPAGQSYF VDFGSTECSC
110 120 130 140 150
PPGGGKISCQ FMLCPELPPN CIEAVVVADS CPQCGQVGCV HAGHKYAAGH
160 170 180 190 200
TVHLPPCRAC HCPDAGGELI CYQLPGCHGN FSDAEEGDPE RHYEDPYSYD
210 220 230 240 250
QEVAEVEAAT ALGGEVQAGA VQAGAGGPPA ALGGGSQPLS TIQAPPWPAV
260 270 280 290 300
LPRPTAAAAL GPPAPVQAKA RRVTEDSEEE EEEEEEREEM AVTEQLAAGG
310 320 330 340 350
HRGLDGLPTT APAGPSLPIQ EERAEAGARA EAGARPEENL ILDAQATSRS
360 370 380 390 400
TGPEGVTHAP SLGKAALVPT QAVPGSPRDP VKPSPHNILS TSLPDAAWIP
410 420 430 440 450
PTREVPRKPQ VLPHSHVEED TDPNSVHSIP RSSPEGSTKD LIETCCAAGQ
460 470 480 490 500
QWAIDNDECL EIPESGTEDN VCRTAQRHCC VSYLQEKSCM AGVLGAKEGE
510 520 530 540 550
TCGAEDNDSC GISLYKQCCD CCGLGLRVRA EGQSCESNPN LGYPCNHVML
560 570 580 590 600
SCCEGEEPLI VPEVRRPPEP AAAPRRVSEA EMAGREALSL GTEAELPNSL
610 620 630 640 650
PGDDQDECLL LPGELCQHLC INTVGSYHCA CFPGFSLQDD GRTCRPEGHP
660 670 680 690 700
PQPEAPQEPA LKSEFSQVAS NTIPLPLPQP NTCKDNGPCK QVCSTVGGSA
710 720 730 740 750
ICSCFPGYAI MADGVSCEDI NECVTDLHTC SRGEHCVNTL GSFHCYKALT
760 770 780 790 800
CEPGYALKDG ECEDVDECAM GTHTCQPGFL CQNTKGSFYC QARQRCMDGF
810 820 830 840 850
LQDPEGNCVD INECTSLSEP CRPGFSCINT VGSYTCQRNP LICARGYHAS
860 870 880 890 900
DDGTKCVDVN ECETGVHRCG EGQVCHNLPG SYRCDCKAGF QRDAFGRGCI
910 920 930 940 950
DVNECWASPG RLCQHTCENT LGSYRCSCAS GFLLAADGKR CEDVNECEAQ
960 970 980 990 1000
RCSQECANIY GSYQCYCRQG YQLAEDGHTC TDIDECAQGA GILCTFRCLN
1010 1020 1030 1040 1050
VPGSYQCACP EQGYTMTANG RSCKDVDECA LGTHNCSEAE TCHNIQGSFR
1060 1070 1080 1090 1100
CLRFECPPNY VQVSKTKCER TTCHDFLECQ NSPARITHYQ LNFQTGLLVP
1110 1120 1130 1140 1150
AHIFRIGPAP AFTGDTIALN IIKGNEEGYF GTRRLNAYTG VVYLQRAVLE
1160 1170 1180
PRDFALDVEM KLWRQGSVTT FLAKMHIFFT TFAL
Length:1,184
Mass (Da):126,573
Last modified:March 3, 2009 - v2
Checksum:iD46890D93518B343
GO
Isoform 2 (identifier: P98095-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     718-718: E → EDQDECLMGAHDCSRRQFCVNTLGSFYCVNHTVLCADGYILNAHRKCV

Show »
Length:1,231
Mass (Da):131,863
Checksum:i914C7630E2D9FC4E
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti145 – 1451K → E in CAA57876. (PubMed:7806230)Curated
Sequence conflicti145 – 1451K → E in AAN05436. 1 PublicationCurated
Sequence conflicti664 – 6641E → G in BAH14261. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti45 – 451I → V.
Corresponds to variant rs60850813 [ dbSNP | Ensembl ].
VAR_061159
Natural varianti144 – 1441H → R.
Corresponds to variant rs28587534 [ dbSNP | Ensembl ].
VAR_061160
Natural varianti361 – 3611S → G.
Corresponds to variant rs3732666 [ dbSNP | Ensembl ].
VAR_059266
Natural varianti387 – 3871N → T.
Corresponds to variant rs3796318 [ dbSNP | Ensembl ].
VAR_059267
Natural varianti854 – 8541T → A.1 Publication
Corresponds to variant rs9843344 [ dbSNP | Ensembl ].
VAR_059268
Natural varianti1114 – 11141G → R.
Corresponds to variant rs1061375 [ dbSNP | Ensembl ].
VAR_055722

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei718 – 7181E → EDQDECLMGAHDCSRRQFCV NTLGSFYCVNHTVLCADGYI LNAHRKCV in isoform 2. 2 PublicationsVSP_041404

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X82494 mRNA. Translation: CAA57876.1.
AY130458, AY130456, AY130457 Genomic DNA. Translation: AAN05435.1.
AY130459 mRNA. Translation: AAN05436.1.
AK304827 mRNA. Translation: BAH14261.1.
AC090509 Genomic DNA. No translation available.
CCDSiCCDS46761.1. [P98095-2]
CCDS46762.1. [P98095-1]
PIRiA55184.
RefSeqiNP_001004019.1. NM_001004019.1. [P98095-2]
NP_001158507.1. NM_001165035.1. [P98095-2]
NP_001989.2. NM_001998.2. [P98095-1]
UniGeneiHs.198862.

Genome annotation databases

EnsembliENST00000295760; ENSP00000295760; ENSG00000163520. [P98095-1]
ENST00000404922; ENSP00000384169; ENSG00000163520. [P98095-2]
ENST00000492059; ENSP00000420042; ENSG00000163520. [P98095-2]
GeneIDi2199.
KEGGihsa:2199.
UCSCiuc011ava.2. human. [P98095-2]
uc011avb.2. human. [P98095-1]

Polymorphism databases

DMDMi224471827.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
X82494 mRNA. Translation: CAA57876.1 .
AY130458 , AY130456 , AY130457 Genomic DNA. Translation: AAN05435.1 .
AY130459 mRNA. Translation: AAN05436.1 .
AK304827 mRNA. Translation: BAH14261.1 .
AC090509 Genomic DNA. No translation available.
CCDSi CCDS46761.1. [P98095-2 ]
CCDS46762.1. [P98095-1 ]
PIRi A55184.
RefSeqi NP_001004019.1. NM_001004019.1. [P98095-2 ]
NP_001158507.1. NM_001165035.1. [P98095-2 ]
NP_001989.2. NM_001998.2. [P98095-1 ]
UniGenei Hs.198862.

3D structure databases

ProteinModelPortali P98095.
SMRi P98095. Positions 603-1069.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 108493. 15 interactions.
IntActi P98095. 6 interactions.
MINTi MINT-1518617.
STRINGi 9606.ENSP00000384169.

PTM databases

PhosphoSitei P98095.

Polymorphism databases

DMDMi 224471827.

Proteomic databases

MaxQBi P98095.
PaxDbi P98095.
PRIDEi P98095.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000295760 ; ENSP00000295760 ; ENSG00000163520 . [P98095-1 ]
ENST00000404922 ; ENSP00000384169 ; ENSG00000163520 . [P98095-2 ]
ENST00000492059 ; ENSP00000420042 ; ENSG00000163520 . [P98095-2 ]
GeneIDi 2199.
KEGGi hsa:2199.
UCSCi uc011ava.2. human. [P98095-2 ]
uc011avb.2. human. [P98095-1 ]

Organism-specific databases

CTDi 2199.
GeneCardsi GC03P013565.
H-InvDB HIX0003076.
HGNCi HGNC:3601. FBLN2.
HPAi CAB018622.
HPA001934.
MIMi 135821. gene.
neXtProti NX_P98095.
PharmGKBi PA28014.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG12793.
GeneTreei ENSGT00760000118806.
HOGENOMi HOG000007079.
HOVERGENi HBG051559.
InParanoidi P98095.
KOi K17307.
OMAi SETKCER.
OrthoDBi EOG7P5T0C.
PhylomeDBi P98095.
TreeFami TF317514.

Enzyme and pathway databases

Reactomei REACT_150331. Molecules associated with elastic fibres.

Miscellaneous databases

GeneWikii FBLN2.
GenomeRNAii 2199.
NextBioi 8885.
PROi P98095.
SOURCEi Search...

Gene expression databases

Bgeei P98095.
CleanExi HS_FBLN2.
ExpressionAtlasi P98095. baseline and differential.
Genevestigatori P98095.

Family and domain databases

InterProi IPR000020. Anaphylatoxin/fibulin.
IPR026823. cEGF.
IPR000742. EG-like_dom.
IPR001881. EGF-like_Ca-bd_dom.
IPR013032. EGF-like_CS.
IPR000152. EGF-type_Asp/Asn_hydroxyl_site.
IPR018097. EGF_Ca-bd_CS.
IPR009030. Growth_fac_rcpt_N_dom.
[Graphical view ]
Pfami PF01821. ANATO. 2 hits.
PF12662. cEGF. 2 hits.
PF07645. EGF_CA. 5 hits.
[Graphical view ]
SMARTi SM00104. ANATO. 3 hits.
SM00181. EGF. 1 hit.
SM00179. EGF_CA. 9 hits.
[Graphical view ]
SUPFAMi SSF57184. SSF57184. 5 hits.
PROSITEi PS01177. ANAPHYLATOXIN_1. 3 hits.
PS01178. ANAPHYLATOXIN_2. 3 hits.
PS00010. ASX_HYDROXYL. 5 hits.
PS01186. EGF_2. 5 hits.
PS50026. EGF_3. 4 hits.
PS01187. EGF_CA. 9 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Fibulin-2 (FBLN2): human cDNA sequence, mRNA expression, and mapping of the gene on human and mouse chromosomes."
    Zhang R.-Z., Pan T.-C., Zhang Z.-Y., Mattei M.-G., Timpl R., Chu M.-L.
    Genomics 22:425-430(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ALA-854.
    Tissue: Fibroblast.
  2. "Identification of a novel alternatively spliced isoform of human fibulin-2 gene abundantly expressed in heart and genetic evaluation in patients with ARVD."
    Li D., Marian A.J., Roberts R.
    Submitted (JUL-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 2), ALTERNATIVE SPLICING.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Uterus.
  4. "The DNA sequence, annotation and analysis of human chromosome 3."
    Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
    , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
    Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The extracellular matrix proteins fibulin-1 and fibulin-2 in the early human embryo."
    Miosge N., Gotz W., Sasaki T., Chu M.-L., Timpl R., Herken R.
    Histochem. J. 28:109-116(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: DEVELOPMENTAL STAGE.
  6. "Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography."
    Han G., Ye M., Zhou H., Jiang X., Feng S., Jiang X., Tian R., Wan D., Zou H., Gu J.
    Proteomics 8:1346-1361(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-277, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  7. "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry."
    Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.
    J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-1035.
    Tissue: Liver.
  8. "Human urinary glycoproteomics; attachment site specific analysis of N-and O-linked glycosylations by CID and ECD."
    Halim A., Nilsson J., Ruetschi U., Hesse C., Larson G.
    Mol. Cell. Proteomics 0:0-0(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION AT THR-347 AND SER-348, STRUCTURE OF CARBOHYDRATES, IDENTIFICATION BY MASS SPECTROMETRY.

Entry informationi

Entry nameiFBLN2_HUMAN
AccessioniPrimary (citable) accession number: P98095
Secondary accession number(s): B7Z9C5, Q8IUI0, Q8IUI1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1995
Last sequence update: March 3, 2009
Last modified: October 29, 2014
This is version 139 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3