Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P97931 (UNG_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 119. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Uracil-DNA glycosylase

Short name=UDG
EC=3.2.2.27
Gene names
Name:Ung
Synonyms:Ung1
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length306 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Excises uracil residues from the DNA which can arise as a result of misincorporation of dUMP residues by DNA polymerase or due to deamination of cytosine. HAMAP-Rule MF_03166

Catalytic activity

Hydrolyzes single-stranded DNA or mismatched double-stranded DNA and polynucleotides, releasing free uracil. HAMAP-Rule MF_03166

Subunit structure

Monomer By similarity. Interacts with FAM72A By similarity. HAMAP-Rule MF_03166

Subcellular location

Isoform 1: Mitochondrion HAMAP-Rule MF_03166.

Isoform 2: Nucleus HAMAP-Rule MF_03166.

Post-translational modification

Isoform 1 is processed by cleavage of a transit peptide. HAMAP-Rule MF_03166

Sequence similarities

Belongs to the uracil-DNA glycosylase family.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 2 (identifier: P97931-1)

Also known as: UNG2;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 1 (identifier: P97931-2)

Also known as: UNG1;

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MIGQKTLYSFFSPTPTGKRTTRSPEPVPGSGVAAEIGGDAV → MGVLGRRSLRLARRAGLRSLTPNPDSDSRQ

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 306306Uracil-DNA glycosylase HAMAP-Rule MF_03166
PRO_0000176174

Sites

Active site1471Proton acceptor By similarity

Amino acid modifications

Modified residue121Phosphoserine By similarity
Modified residue231Phosphoserine By similarity
Modified residue571Phosphoserine By similarity
Modified residue2881N6-acetyllysine By similarity

Natural variations

Alternative sequence1 – 4141MIGQK…GGDAV → MGVLGRRSLRLARRAGLRSL TPNPDSDSRQ in isoform 1.
VSP_008514

Experimental info

Sequence conflict2771H → Y in CAA67489. Ref.2
Sequence conflict2771H → Y in CAA70168. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 2 (UNG2) [UniParc].

Last modified July 27, 2011. Version 3.
Checksum: CE2D5192936CE6EA

FASTA30633,926
        10         20         30         40         50         60 
MIGQKTLYSF FSPTPTGKRT TRSPEPVPGS GVAAEIGGDA VASPAKKARV EQNEQGSPLS 

        70         80         90        100        110        120 
AEQLVRIQRN KAAALLRLAA RNVPAGFGES WKQQLCGEFG KPYFVKLMGF VAEERNHHKV 

       130        140        150        160        170        180 
YPPPEQVFTW TQMCDIRDVK VVILGQDPYH GPNQAHGLCF SVQRPVPPPP SLENIFKELS 

       190        200        210        220        230        240 
TDIDGFVHPG HGDLSGWARQ GVLLLNAVLT VRAHQANSHK ERGWEQFTDA VVSWLNQNLS 

       250        260        270        280        290        300 
GLVFLLWGSY AQKKGSVIDR KRHHVLQTAH PSPLSVHRGF LGCRHFSKAN ELLQKSGKKP 


INWKEL 

« Hide

Isoform 1 (UNG1) [UniParc].

Checksum: 7E66E56DEC55B851
Show »

FASTA29533,054

References

« Hide 'large scale' references
[1]"The mouse uracil-DNA glycosylase gene: isolation of cDNA and genomic clones and mapping ung to mouse chromosome 5."
Svendsen P.C., Yee H.A., Winkfein R.J., van de Sande J.H.
Gene 189:175-181(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1).
[2]"Nuclear and mitochondrial uracil-DNA glycosylases are generated by alternative splicing and transcription from different positions in the UNG gene."
Nilsen H., Solum K., Haug T., Krokan H.E.
Nucleic Acids Res. 25:750-755(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
[3]"Analysis of uracil-DNA glycosylases from the murine Ung gene reveals differential expression in tissues and in embryonic development and a subcellular sorting pattern that differs from the human homologues."
Nilsen H., Steinsbekk K.S., Otterlei M., Slupphaug G., Aas P.A., Krokan H.E.
Nucleic Acids Res. 28:2277-2285(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Strain: 129/Sv.
[4]"The transcriptional landscape of the mammalian genome."
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. expand/collapse author list , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Strain: DBA/2.
[5]Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Strain: C3H/He and Czech II.
Tissue: Mammary tumor and Osteoblast.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U55040 Genomic DNA. Translation: AAB39511.1.
U55041 mRNA. Translation: AAC53197.1.
X99018 mRNA. Translation: CAA67489.1.
Y08975 mRNA. Translation: CAA70168.1.
AF174485 Genomic DNA. Translation: AAF76936.1.
AK146178 mRNA. Translation: BAE26956.1.
CH466529 Genomic DNA. Translation: EDL19920.1.
BC011039 mRNA. Translation: AAH11039.1.
BC052853 mRNA. Translation: AAH52853.1.
CCDSCCDS19560.1. [P97931-2]
CCDS39221.1. [P97931-1]
RefSeqNP_001035781.1. NM_001040691.1. [P97931-1]
NP_035807.2. NM_011677.2. [P97931-2]
UniGeneMm.1393.

3D structure databases

ProteinModelPortalP97931.
SMRP97931. Positions 87-306.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

IntActP97931. 1 interaction.

PTM databases

PhosphoSiteP97931.

Proteomic databases

PRIDEP97931.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000031587; ENSMUSP00000031587; ENSMUSG00000029591. [P97931-1]
ENSMUST00000102584; ENSMUSP00000099644; ENSMUSG00000029591. [P97931-2]
GeneID22256.
KEGGmmu:22256.
UCSCuc008yzf.1. mouse. [P97931-1]

Organism-specific databases

CTD7374.
MGIMGI:109352. Ung.

Phylogenomic databases

eggNOGCOG0692.
GeneTreeENSGT00390000003405.
HOGENOMHOG000229528.
HOVERGENHBG000396.
InParanoidQ9JIW8.
KOK03648.
OMAMNQITTH.
OrthoDBEOG786H4X.
TreeFamTF315028.

Gene expression databases

ArrayExpressP97931.
BgeeP97931.
CleanExMM_UNG.
GenevestigatorP97931.

Family and domain databases

Gene3D3.40.470.10. 1 hit.
HAMAPMF_00148. UDG.
InterProIPR018085. Ura-DNA_Glyclase_AS.
IPR002043. Ura_DNA_glycsylse.
IPR005122. Uracil-DNA_glycosylase-like.
[Graphical view]
PANTHERPTHR11264. PTHR11264. 1 hit.
PfamPF03167. UDG. 1 hit.
[Graphical view]
SMARTSM00986. UDG. 1 hit.
[Graphical view]
SUPFAMSSF52141. SSF52141. 1 hit.
TIGRFAMsTIGR00628. ung. 1 hit.
PROSITEPS00130. U_DNA_GLYCOSYLASE. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio302339.
PROP97931.
SOURCESearch...

Entry information

Entry nameUNG_MOUSE
AccessionPrimary (citable) accession number: P97931
Secondary accession number(s): P97285 expand/collapse secondary AC list , P97509, Q7TPW8, Q9JIW8
Entry history
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: July 27, 2011
Last modified: July 9, 2014
This is version 119 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot