Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P97931

- UNG_MOUSE

UniProt

P97931 - UNG_MOUSE

Protein

Uracil-DNA glycosylase

Gene

Ung

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 120 (01 Oct 2014)
      Sequence version 3 (27 Jul 2011)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Excises uracil residues from the DNA which can arise as a result of misincorporation of dUMP residues by DNA polymerase or due to deamination of cytosine.

    Catalytic activityi

    Hydrolyzes single-stranded DNA or mismatched double-stranded DNA and polynucleotides, releasing free uracil.UniRule annotation

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei147 – 1471Proton acceptorUniRule annotation

    GO - Molecular functioni

    1. uracil DNA N-glycosylase activity Source: MGI

    GO - Biological processi

    1. base-excision repair Source: UniProtKB-HAMAP
    2. DNA repair Source: MGI
    3. negative regulation of apoptotic process Source: Ensembl
    4. somatic hypermutation of immunoglobulin genes Source: MGI
    5. somatic recombination of immunoglobulin gene segments Source: MGI

    Keywords - Molecular functioni

    Glycosidase, Hydrolase

    Keywords - Biological processi

    DNA damage, DNA repair

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Uracil-DNA glycosylaseUniRule annotation (EC:3.2.2.27UniRule annotation)
    Short name:
    UDGUniRule annotation
    Gene namesi
    Name:Ung
    Synonyms:Ung1
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 5

    Organism-specific databases

    MGIiMGI:109352. Ung.

    Subcellular locationi

    GO - Cellular componenti

    1. mitochondrion Source: MGI
    2. nucleus Source: MGI

    Keywords - Cellular componenti

    Mitochondrion, Nucleus

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 306306Uracil-DNA glycosylasePRO_0000176174Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei12 – 121PhosphoserineBy similarity
    Modified residuei23 – 231PhosphoserineBy similarity
    Modified residuei57 – 571PhosphoserineBy similarity
    Modified residuei288 – 2881N6-acetyllysineBy similarity

    Post-translational modificationi

    Isoform 1 is processed by cleavage of a transit peptide.

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    PRIDEiP97931.

    PTM databases

    PhosphoSiteiP97931.

    Expressioni

    Gene expression databases

    ArrayExpressiP97931.
    BgeeiP97931.
    CleanExiMM_UNG.
    GenevestigatoriP97931.

    Interactioni

    Subunit structurei

    Monomer. Interacts with FAM72A.UniRule annotation

    Protein-protein interaction databases

    IntActiP97931. 1 interaction.

    Structurei

    3D structure databases

    ProteinModelPortaliP97931.
    SMRiP97931. Positions 87-306.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the uracil-DNA glycosylase family.UniRule annotation

    Phylogenomic databases

    eggNOGiCOG0692.
    GeneTreeiENSGT00390000003405.
    HOGENOMiHOG000229528.
    HOVERGENiHBG000396.
    InParanoidiQ9JIW8.
    KOiK03648.
    OMAiMNQITTH.
    OrthoDBiEOG786H4X.
    TreeFamiTF315028.

    Family and domain databases

    Gene3Di3.40.470.10. 1 hit.
    HAMAPiMF_00148. UDG.
    InterProiIPR018085. Ura-DNA_Glyclase_AS.
    IPR002043. Ura_DNA_glycsylse.
    IPR005122. Uracil-DNA_glycosylase-like.
    [Graphical view]
    PANTHERiPTHR11264. PTHR11264. 1 hit.
    PfamiPF03167. UDG. 1 hit.
    [Graphical view]
    SMARTiSM00986. UDG. 1 hit.
    [Graphical view]
    SUPFAMiSSF52141. SSF52141. 1 hit.
    TIGRFAMsiTIGR00628. ung. 1 hit.
    PROSITEiPS00130. U_DNA_GLYCOSYLASE. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 2 (identifier: P97931-1) [UniParc]FASTAAdd to Basket

    Also known as: UNG2

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MIGQKTLYSF FSPTPTGKRT TRSPEPVPGS GVAAEIGGDA VASPAKKARV    50
    EQNEQGSPLS AEQLVRIQRN KAAALLRLAA RNVPAGFGES WKQQLCGEFG 100
    KPYFVKLMGF VAEERNHHKV YPPPEQVFTW TQMCDIRDVK VVILGQDPYH 150
    GPNQAHGLCF SVQRPVPPPP SLENIFKELS TDIDGFVHPG HGDLSGWARQ 200
    GVLLLNAVLT VRAHQANSHK ERGWEQFTDA VVSWLNQNLS GLVFLLWGSY 250
    AQKKGSVIDR KRHHVLQTAH PSPLSVHRGF LGCRHFSKAN ELLQKSGKKP 300
    INWKEL 306
    Length:306
    Mass (Da):33,926
    Last modified:July 27, 2011 - v3
    Checksum:iCE2D5192936CE6EA
    GO
    Isoform 1 (identifier: P97931-2) [UniParc]FASTAAdd to Basket

    Also known as: UNG1

    The sequence of this isoform differs from the canonical sequence as follows:
         1-41: MIGQKTLYSFFSPTPTGKRTTRSPEPVPGSGVAAEIGGDAV → MGVLGRRSLRLARRAGLRSLTPNPDSDSRQ

    Show »
    Length:295
    Mass (Da):33,054
    Checksum:i7E66E56DEC55B851
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti277 – 2771H → Y in CAA67489. (PubMed:9016624)Curated
    Sequence conflicti277 – 2771H → Y in CAA70168. (PubMed:9016624)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 4141MIGQK…GGDAV → MGVLGRRSLRLARRAGLRSL TPNPDSDSRQ in isoform 1. 5 PublicationsVSP_008514Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U55040 Genomic DNA. Translation: AAB39511.1.
    U55041 mRNA. Translation: AAC53197.1.
    X99018 mRNA. Translation: CAA67489.1.
    Y08975 mRNA. Translation: CAA70168.1.
    AF174485 Genomic DNA. Translation: AAF76936.1.
    AK146178 mRNA. Translation: BAE26956.1.
    CH466529 Genomic DNA. Translation: EDL19920.1.
    BC011039 mRNA. Translation: AAH11039.1.
    BC052853 mRNA. Translation: AAH52853.1.
    CCDSiCCDS19560.1. [P97931-2]
    CCDS39221.1. [P97931-1]
    RefSeqiNP_001035781.1. NM_001040691.1. [P97931-1]
    NP_035807.2. NM_011677.2. [P97931-2]
    UniGeneiMm.1393.

    Genome annotation databases

    EnsembliENSMUST00000031587; ENSMUSP00000031587; ENSMUSG00000029591. [P97931-1]
    ENSMUST00000102584; ENSMUSP00000099644; ENSMUSG00000029591. [P97931-2]
    GeneIDi22256.
    KEGGimmu:22256.
    UCSCiuc008yzf.1. mouse. [P97931-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U55040 Genomic DNA. Translation: AAB39511.1 .
    U55041 mRNA. Translation: AAC53197.1 .
    X99018 mRNA. Translation: CAA67489.1 .
    Y08975 mRNA. Translation: CAA70168.1 .
    AF174485 Genomic DNA. Translation: AAF76936.1 .
    AK146178 mRNA. Translation: BAE26956.1 .
    CH466529 Genomic DNA. Translation: EDL19920.1 .
    BC011039 mRNA. Translation: AAH11039.1 .
    BC052853 mRNA. Translation: AAH52853.1 .
    CCDSi CCDS19560.1. [P97931-2 ]
    CCDS39221.1. [P97931-1 ]
    RefSeqi NP_001035781.1. NM_001040691.1. [P97931-1 ]
    NP_035807.2. NM_011677.2. [P97931-2 ]
    UniGenei Mm.1393.

    3D structure databases

    ProteinModelPortali P97931.
    SMRi P97931. Positions 87-306.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    IntActi P97931. 1 interaction.

    PTM databases

    PhosphoSitei P97931.

    Proteomic databases

    PRIDEi P97931.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000031587 ; ENSMUSP00000031587 ; ENSMUSG00000029591 . [P97931-1 ]
    ENSMUST00000102584 ; ENSMUSP00000099644 ; ENSMUSG00000029591 . [P97931-2 ]
    GeneIDi 22256.
    KEGGi mmu:22256.
    UCSCi uc008yzf.1. mouse. [P97931-1 ]

    Organism-specific databases

    CTDi 7374.
    MGIi MGI:109352. Ung.

    Phylogenomic databases

    eggNOGi COG0692.
    GeneTreei ENSGT00390000003405.
    HOGENOMi HOG000229528.
    HOVERGENi HBG000396.
    InParanoidi Q9JIW8.
    KOi K03648.
    OMAi MNQITTH.
    OrthoDBi EOG786H4X.
    TreeFami TF315028.

    Miscellaneous databases

    NextBioi 302339.
    PROi P97931.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P97931.
    Bgeei P97931.
    CleanExi MM_UNG.
    Genevestigatori P97931.

    Family and domain databases

    Gene3Di 3.40.470.10. 1 hit.
    HAMAPi MF_00148. UDG.
    InterProi IPR018085. Ura-DNA_Glyclase_AS.
    IPR002043. Ura_DNA_glycsylse.
    IPR005122. Uracil-DNA_glycosylase-like.
    [Graphical view ]
    PANTHERi PTHR11264. PTHR11264. 1 hit.
    Pfami PF03167. UDG. 1 hit.
    [Graphical view ]
    SMARTi SM00986. UDG. 1 hit.
    [Graphical view ]
    SUPFAMi SSF52141. SSF52141. 1 hit.
    TIGRFAMsi TIGR00628. ung. 1 hit.
    PROSITEi PS00130. U_DNA_GLYCOSYLASE. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The mouse uracil-DNA glycosylase gene: isolation of cDNA and genomic clones and mapping ung to mouse chromosome 5."
      Svendsen P.C., Yee H.A., Winkfein R.J., van de Sande J.H.
      Gene 189:175-181(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1).
    2. "Nuclear and mitochondrial uracil-DNA glycosylases are generated by alternative splicing and transcription from different positions in the UNG gene."
      Nilsen H., Solum K., Haug T., Krokan H.E.
      Nucleic Acids Res. 25:750-755(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
    3. "Analysis of uracil-DNA glycosylases from the murine Ung gene reveals differential expression in tissues and in embryonic development and a subcellular sorting pattern that differs from the human homologues."
      Nilsen H., Steinsbekk K.S., Otterlei M., Slupphaug G., Aas P.A., Krokan H.E.
      Nucleic Acids Res. 28:2277-2285(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Strain: 129/Sv.
    4. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Strain: DBA/2.
    5. Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
      Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Strain: C3H/He and Czech II.
      Tissue: Mammary tumor and Osteoblast.

    Entry informationi

    Entry nameiUNG_MOUSE
    AccessioniPrimary (citable) accession number: P97931
    Secondary accession number(s): P97285
    , P97509, Q7TPW8, Q9JIW8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1997
    Last sequence update: July 27, 2011
    Last modified: October 1, 2014
    This is version 120 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3