Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Uracil-DNA glycosylase

Gene

Ung

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Excises uracil residues from the DNA which can arise as a result of misincorporation of dUMP residues by DNA polymerase or due to deamination of cytosine.

Catalytic activityi

Hydrolyzes single-stranded DNA or mismatched double-stranded DNA and polynucleotides, releasing free uracil.UniRule annotation

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei147Proton acceptorUniRule annotation1

GO - Molecular functioni

  • damaged DNA binding Source: MGI
  • enzyme binding Source: MGI
  • uracil DNA N-glycosylase activity Source: MGI

GO - Biological processi

  • base-excision repair, AP site formation via deaminated base removal Source: MGI
  • DNA repair Source: MGI
  • negative regulation of apoptotic process Source: Ensembl
  • positive regulation of isotype switching Source: MGI
  • somatic hypermutation of immunoglobulin genes Source: MGI
  • somatic recombination of immunoglobulin gene segments Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Glycosidase, Hydrolase

Keywords - Biological processi

DNA damage, DNA repair

Enzyme and pathway databases

ReactomeiR-MMU-110329. Cleavage of the damaged pyrimidine.
R-MMU-110357. Displacement of DNA glycosylase by APEX1.

Names & Taxonomyi

Protein namesi
Recommended name:
Uracil-DNA glycosylaseUniRule annotation (EC:3.2.2.27UniRule annotation)
Short name:
UDGUniRule annotation
Gene namesi
Name:Ung
Synonyms:Ung1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 5

Organism-specific databases

MGIiMGI:109352. Ung.

Subcellular locationi

GO - Cellular componenti

  • mitochondrion Source: MGI
  • nucleus Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Mitochondrion, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001761741 – 306Uracil-DNA glycosylaseAdd BLAST306

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei12PhosphoserineBy similarity1
Modified residuei23PhosphoserineBy similarity1
Modified residuei43PhosphoserineCombined sources1
Modified residuei57PhosphoserineBy similarity1
Modified residuei288N6-acetyllysineBy similarity1

Post-translational modificationi

Isoform 1 is processed by cleavage of a transit peptide.

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDbiP97931.
PeptideAtlasiP97931.
PRIDEiP97931.

PTM databases

iPTMnetiP97931.
PhosphoSitePlusiP97931.

Expressioni

Gene expression databases

BgeeiENSMUSG00000029591.
CleanExiMM_UNG.
ExpressionAtlasiP97931. baseline and differential.
GenevisibleiP97931. MM.

Interactioni

Subunit structurei

Monomer. Interacts with FAM72A.UniRule annotation

GO - Molecular functioni

Protein-protein interaction databases

IntActiP97931. 1 interactor.
STRINGi10090.ENSMUSP00000031587.

Structurei

3D structure databases

ProteinModelPortaliP97931.
SMRiP97931.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the uracil-DNA glycosylase family.UniRule annotation

Phylogenomic databases

eggNOGiKOG2994. Eukaryota.
COG0692. LUCA.
GeneTreeiENSGT00390000003405.
HOGENOMiHOG000229528.
HOVERGENiHBG000396.
InParanoidiP97931.
KOiK03648.
OMAiGCSIPSH.
OrthoDBiEOG091G0HEH.
TreeFamiTF315028.

Family and domain databases

CDDicd10027. UDG_F1. 1 hit.
Gene3Di3.40.470.10. 1 hit.
HAMAPiMF_00148. UDG. 1 hit.
InterProiIPR002043. UDG_fam1.
IPR018085. Ura-DNA_Glyclase_AS.
IPR005122. Uracil-DNA_glycosylase-like.
[Graphical view]
PANTHERiPTHR11264. PTHR11264. 1 hit.
PfamiPF03167. UDG. 1 hit.
[Graphical view]
SMARTiSM00986. UDG. 1 hit.
[Graphical view]
SUPFAMiSSF52141. SSF52141. 1 hit.
TIGRFAMsiTIGR00628. ung. 1 hit.
PROSITEiPS00130. U_DNA_GLYCOSYLASE. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 2 (identifier: P97931-1) [UniParc]FASTAAdd to basket
Also known as: UNG2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MIGQKTLYSF FSPTPTGKRT TRSPEPVPGS GVAAEIGGDA VASPAKKARV
60 70 80 90 100
EQNEQGSPLS AEQLVRIQRN KAAALLRLAA RNVPAGFGES WKQQLCGEFG
110 120 130 140 150
KPYFVKLMGF VAEERNHHKV YPPPEQVFTW TQMCDIRDVK VVILGQDPYH
160 170 180 190 200
GPNQAHGLCF SVQRPVPPPP SLENIFKELS TDIDGFVHPG HGDLSGWARQ
210 220 230 240 250
GVLLLNAVLT VRAHQANSHK ERGWEQFTDA VVSWLNQNLS GLVFLLWGSY
260 270 280 290 300
AQKKGSVIDR KRHHVLQTAH PSPLSVHRGF LGCRHFSKAN ELLQKSGKKP

INWKEL
Length:306
Mass (Da):33,926
Last modified:July 27, 2011 - v3
Checksum:iCE2D5192936CE6EA
GO
Isoform 1 (identifier: P97931-2) [UniParc]FASTAAdd to basket
Also known as: UNG1

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MIGQKTLYSFFSPTPTGKRTTRSPEPVPGSGVAAEIGGDAV → MGVLGRRSLRLARRAGLRSLTPNPDSDSRQ

Show »
Length:295
Mass (Da):33,054
Checksum:i7E66E56DEC55B851
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti277H → Y in CAA67489 (PubMed:9016624).Curated1
Sequence conflicti277H → Y in CAA70168 (PubMed:9016624).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0085141 – 41MIGQK…GGDAV → MGVLGRRSLRLARRAGLRSL TPNPDSDSRQ in isoform 1. 5 PublicationsAdd BLAST41

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U55040 Genomic DNA. Translation: AAB39511.1.
U55041 mRNA. Translation: AAC53197.1.
X99018 mRNA. Translation: CAA67489.1.
Y08975 mRNA. Translation: CAA70168.1.
AF174485 Genomic DNA. Translation: AAF76936.1.
AK146178 mRNA. Translation: BAE26956.1.
CH466529 Genomic DNA. Translation: EDL19920.1.
BC011039 mRNA. Translation: AAH11039.1.
BC052853 mRNA. Translation: AAH52853.1.
CCDSiCCDS19560.1. [P97931-2]
CCDS39221.1. [P97931-1]
RefSeqiNP_001035781.1. NM_001040691.1. [P97931-1]
NP_035807.2. NM_011677.2. [P97931-2]
UniGeneiMm.1393.

Genome annotation databases

EnsembliENSMUST00000031587; ENSMUSP00000031587; ENSMUSG00000029591. [P97931-1]
ENSMUST00000102584; ENSMUSP00000099644; ENSMUSG00000029591. [P97931-2]
GeneIDi22256.
KEGGimmu:22256.
UCSCiuc008yzf.1. mouse. [P97931-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U55040 Genomic DNA. Translation: AAB39511.1.
U55041 mRNA. Translation: AAC53197.1.
X99018 mRNA. Translation: CAA67489.1.
Y08975 mRNA. Translation: CAA70168.1.
AF174485 Genomic DNA. Translation: AAF76936.1.
AK146178 mRNA. Translation: BAE26956.1.
CH466529 Genomic DNA. Translation: EDL19920.1.
BC011039 mRNA. Translation: AAH11039.1.
BC052853 mRNA. Translation: AAH52853.1.
CCDSiCCDS19560.1. [P97931-2]
CCDS39221.1. [P97931-1]
RefSeqiNP_001035781.1. NM_001040691.1. [P97931-1]
NP_035807.2. NM_011677.2. [P97931-2]
UniGeneiMm.1393.

3D structure databases

ProteinModelPortaliP97931.
SMRiP97931.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiP97931. 1 interactor.
STRINGi10090.ENSMUSP00000031587.

PTM databases

iPTMnetiP97931.
PhosphoSitePlusiP97931.

Proteomic databases

PaxDbiP97931.
PeptideAtlasiP97931.
PRIDEiP97931.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000031587; ENSMUSP00000031587; ENSMUSG00000029591. [P97931-1]
ENSMUST00000102584; ENSMUSP00000099644; ENSMUSG00000029591. [P97931-2]
GeneIDi22256.
KEGGimmu:22256.
UCSCiuc008yzf.1. mouse. [P97931-1]

Organism-specific databases

CTDi7374.
MGIiMGI:109352. Ung.

Phylogenomic databases

eggNOGiKOG2994. Eukaryota.
COG0692. LUCA.
GeneTreeiENSGT00390000003405.
HOGENOMiHOG000229528.
HOVERGENiHBG000396.
InParanoidiP97931.
KOiK03648.
OMAiGCSIPSH.
OrthoDBiEOG091G0HEH.
TreeFamiTF315028.

Enzyme and pathway databases

ReactomeiR-MMU-110329. Cleavage of the damaged pyrimidine.
R-MMU-110357. Displacement of DNA glycosylase by APEX1.

Miscellaneous databases

PROiP97931.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000029591.
CleanExiMM_UNG.
ExpressionAtlasiP97931. baseline and differential.
GenevisibleiP97931. MM.

Family and domain databases

CDDicd10027. UDG_F1. 1 hit.
Gene3Di3.40.470.10. 1 hit.
HAMAPiMF_00148. UDG. 1 hit.
InterProiIPR002043. UDG_fam1.
IPR018085. Ura-DNA_Glyclase_AS.
IPR005122. Uracil-DNA_glycosylase-like.
[Graphical view]
PANTHERiPTHR11264. PTHR11264. 1 hit.
PfamiPF03167. UDG. 1 hit.
[Graphical view]
SMARTiSM00986. UDG. 1 hit.
[Graphical view]
SUPFAMiSSF52141. SSF52141. 1 hit.
TIGRFAMsiTIGR00628. ung. 1 hit.
PROSITEiPS00130. U_DNA_GLYCOSYLASE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiUNG_MOUSE
AccessioniPrimary (citable) accession number: P97931
Secondary accession number(s): P97285
, P97509, Q7TPW8, Q9JIW8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: July 27, 2011
Last modified: November 2, 2016
This is version 137 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.