Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Glutamate receptor-interacting protein 1

Gene

Grip1

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May play a role as a localized scaffold for the assembly of a multiprotein signaling complex and as mediator of the trafficking of its binding partners at specific subcellular location in neurons.1 Publication

GO - Molecular functioni

  • receptor binding Source: RGD

GO - Biological processi

  • dendrite development Source: InterPro
  • nervous system development Source: RGD
  • protein transport Source: RGD
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Glutamate receptor-interacting protein 1
Short name:
GRIP-1
Alternative name(s):
AMPA receptor-interacting protein GRIP1
Gene namesi
Name:Grip1
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi621667. Grip1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasm, Endoplasmic reticulum, Membrane, Postsynaptic cell membrane, Synapse

Pathology & Biotechi

Chemistry databases

ChEMBLiCHEMBL2366484.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000838511 – 1112Glutamate receptor-interacting protein 1Add BLAST1112

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei43PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiP97879.
PRIDEiP97879.

PTM databases

iPTMnetiP97879.
PhosphoSitePlusiP97879.
SwissPalmiP97879.

Expressioni

Tissue specificityi

Expressed in brain, testis and retina. In brain highly expressed in the olfactory bulb, cortex and hyppocampus and lower level in thalamus, cerebellum and spinal cord. In brain it is found in the perikaryon, dendrites, dendritic shafts, dendritic spines and, excitatory and inhibitory synapses of neurons. In retina, it is most abundant in the plexiform layers than in perikarya.3 Publications

Developmental stagei

Detected in early embryonic stage as early as E15, gradually increased throughout early development, peaked at approximately between postnatal days P6 and P8, then slightly decreased and remained relatively stable in the adult.1 Publication

Gene expression databases

BgeeiENSRNOG00000004013.

Interactioni

Subunit structurei

Interacts with EFNB1, EPHA7, EPHB2, EFNB3, KIF5A, KIF5C, KIF5B and the C-terminal tail of PRLHR. Forms a ternary complex with GRIA2 and CSPG4 (By similarity). Can form homomultimers or heteromultimers with GRIP2. Interacts with GRIA2, GRIA3, GRIPAP1/GRASP1, PPFIA1, PPFIA4, FRAS1, PLCD4, PTPRF and liprins-alpha. Interacts with ATAD1 in an ATP-dependent manner. ATAD1-catalyzed ATP hydrolysis disrupts binding to ATAD1 and to GRIA2 and leads to AMPAR complex disassembly. Interacts with SLC30A9 (By similarity). Interacts with WBSCR22 (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
Agap2Q8CGU44EBI-936113,EBI-4409108
Gria2P1949115EBI-936113,EBI-77718
Gria3P194923EBI-936113,EBI-77764
Gria4P194933EBI-936113,EBI-7761834
Grip2Q9WTW1-33EBI-936113,EBI-936068
Grm7P354003EBI-936113,EBI-6936416
PPFIA1Q131364EBI-936113,EBI-745426From a different organism.
Ppfia3Q91Z793EBI-936113,EBI-8276993
Ppfia4Q91Z807EBI-936113,EBI-8276907
PtprkQ9WUL32EBI-936113,EBI-8277319

GO - Molecular functioni

  • receptor binding Source: RGD

Protein-protein interaction databases

BioGridi249882. 7 interactors.
DIPiDIP-37486N.
IntActiP97879. 29 interactors.
MINTiMINT-138947.
STRINGi10116.ENSRNOP00000005539.

Structurei

Secondary structure

11112
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi49 – 57Combined sources9
Beta strandi66 – 69Combined sources4
Beta strandi74 – 76Combined sources3
Beta strandi78 – 83Combined sources6
Helixi88 – 91Combined sources4
Beta strandi100 – 104Combined sources5
Helixi114 – 122Combined sources9
Beta strandi126 – 135Combined sources10
Beta strandi144 – 156Combined sources13
Beta strandi163 – 169Combined sources7
Turni174 – 176Combined sources3
Beta strandi178 – 185Combined sources8
Helixi190 – 194Combined sources5
Beta strandi202 – 206Combined sources5
Helixi216 – 224Combined sources9
Beta strandi228 – 239Combined sources12
Beta strandi468 – 475Combined sources8
Turni478 – 480Combined sources3
Beta strandi485 – 488Combined sources4
Beta strandi493 – 495Combined sources3
Beta strandi499 – 504Combined sources6
Helixi510 – 513Combined sources4
Beta strandi523 – 526Combined sources4
Helixi536 – 544Combined sources9
Beta strandi548 – 558Combined sources11
Beta strandi571 – 575Combined sources5
Beta strandi586 – 588Combined sources3
Beta strandi592 – 594Combined sources3
Beta strandi600 – 603Combined sources4
Beta strandi606 – 608Combined sources3
Helixi609 – 612Combined sources4
Beta strandi621 – 625Combined sources5
Helixi630 – 632Combined sources3
Helixi635 – 644Combined sources10
Beta strandi649 – 654Combined sources6
Beta strandi670 – 676Combined sources7
Beta strandi684 – 687Combined sources4
Beta strandi697 – 701Combined sources5
Helixi706 – 710Combined sources5
Beta strandi718 – 722Combined sources5
Helixi732 – 740Combined sources9
Beta strandi744 – 751Combined sources8
Beta strandi985 – 992Combined sources8
Beta strandi998 – 1006Combined sources9
Beta strandi1013 – 1018Combined sources6
Helixi1023 – 1027Combined sources5
Beta strandi1034 – 1038Combined sources5
Helixi1048 – 1056Combined sources9
Beta strandi1061 – 1068Combined sources8

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1M5ZNMR-A980-1070[»]
1N7EX-ray1.50A665-761[»]
1N7FX-ray1.80A/B665-761[»]
1P1DNMR-A463-658[»]
1P1ENMR-A463-563[»]
2QT5X-ray2.30A/B48-243[»]
ProteinModelPortaliP97879.
SMRiP97879.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP97879.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini53 – 136PDZ 1PROSITE-ProRule annotationAdd BLAST84
Domaini150 – 238PDZ 2PROSITE-ProRule annotationAdd BLAST89
Domaini252 – 336PDZ 3PROSITE-ProRule annotationAdd BLAST85
Domaini471 – 560PDZ 4PROSITE-ProRule annotationAdd BLAST90
Domaini572 – 657PDZ 5PROSITE-ProRule annotationAdd BLAST86
Domaini672 – 754PDZ 6PROSITE-ProRule annotationAdd BLAST83
Domaini988 – 1070PDZ 7PROSITE-ProRule annotationAdd BLAST83

Domaini

PDZ 6 mediates interaction with the PDZ recognition motif of EFNB1 and EPHB2 and with the C-terminus of PPFIA1 and PPFIA4. PDZ 4 and PDZ 5 mediate interaction with PRLHR (By similarity). PDZ 4 and PDZ 5 mediate interaction with the C-terminus of GRIA2 and GRIA3. PDZ 4, PDZ 5 and PDZ 6 mediate homomultimers. PDZ 7 mediates interaction with PDZ domain of GRASP1. PDZ 7 domain binds CSPG4. PDZ 6 mediates interaction with the C-terminus of liprins-alpha. PDZ 1, PDZ 2 and PDZ 3 mediate interaction with the PDZ-binding motif of FRAS1.By similarity1 Publication

Sequence similaritiesi

Contains 7 PDZ (DHR) domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG3528. Eukaryota.
ENOG410XSUX. LUCA.
HOGENOMiHOG000043120.
HOVERGENiHBG051841.
InParanoidiP97879.
KOiK20251.
PhylomeDBiP97879.

Family and domain databases

Gene3Di2.30.42.10. 7 hits.
InterProiIPR030026. GRIP1.
IPR001478. PDZ.
[Graphical view]
PANTHERiPTHR10316:SF39. PTHR10316:SF39. 2 hits.
PfamiPF00595. PDZ. 7 hits.
[Graphical view]
SMARTiSM00228. PDZ. 7 hits.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 7 hits.
PROSITEiPS50106. PDZ. 7 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P97879-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MIAVSFKCRC QILRRLTKDE SPYTKSASQT KPPDGALAVR RQSIPEEFKG
60 70 80 90 100
STVVELMKKE GTTLGLTVSG GIDKDGKPRV SNLRQGGIAA RSDQLDVGDY
110 120 130 140 150
IKAVNGINLA KFRHDEIISL LKNVGERVVL EVEYELPPVS IQGSSVMFRT
160 170 180 190 200
VEVTLHKEGN TFGFVIRGGA HDDRNKSRPV VITCVRPGGP ADREGTIKPG
210 220 230 240 250
DRLLSVDGIR LLGTTHAEAM SILKQCGQEA TLLIEYDVSV MDSVATASGP
260 270 280 290 300
LLVEVAKTPG ASLGVALTTS VCCNKQVIVI DKIKSASIAD RCGALHVGDH
310 320 330 340 350
ILSIDGTSME YCTLAEATQF LANTTDQVKL EILPHHQTRL ALKGPDHVKI
360 370 380 390 400
QRSDRQLPWD PWASSQCSVH TNHHHNPHHP DHCRVPALGF PKALTPNSPP
410 420 430 440 450
AMVSSSSPTS MSAYSLSSLN MGTLPRSLYS TSPRGTMMRR RLKKKDFKSS
460 470 480 490 500
LSLASSTVGL AGQVVHTETT EVVLTADPVT GFGIQLQGSV FATETLSSPP
510 520 530 540 550
LISYIEADSP AERCGVLQIG DRVMAINGIP TEDSTFEEAN QLLRDSSITS
560 570 580 590 600
KVTLEIEFDV AESVIPSSGT FHVKLPKKHS VELGITISSP SSRKPGDPLV
610 620 630 640 650
ISDIKKGSVA HRTGTLELGD KLLAIDNIRL DSCSMEDAVQ ILQQCEDLVK
660 670 680 690 700
LKIRKDEDNS DEQESSGAII YTVELKRYGG PLGITISGTE EPFDPIIISS
710 720 730 740 750
LTKGGLAERT GAIHIGDRIL AINSSSLKGK PLSEAIHLLQ MAGETVTLKI
760 770 780 790 800
KKQTDAQPAS SPKKLPIPSH SSDLGDGEED PSPIQRPGKL SDVYPSTVPS
810 820 830 840 850
VDSAVDSWDG SGIDARYGSQ GTTFQTSGYN FNTYDWRSPK KRASLSPVPK
860 870 880 890 900
PRSQTYPDVG LSNEDWDRST ASGFAGASDS ADAEQEENFW SQALEDLETC
910 920 930 940 950
GQSGILRELE ATIMSGSTMS LNHEAPTARS QLGRQASFQE RSNSRPHYSQ
960 970 980 990 1000
TTRSNTLPSD VGRKSVTLRK MKQEIKEIMS PTPVELHKVT LYKDSGMEDF
1010 1020 1030 1040 1050
GFSVADGLLE KGVYVKNIRP AGPGDLGGLK PYDRLLQVNH VRTRDFDCCL
1060 1070 1080 1090 1100
VVPLIAESGN KLDLVISRNP LASQKSIEQP ALPSDWSEQN SAFFQQPSHG
1110
GNLETREPTN TL
Note: No experimental confirmation available.
Length:1,112
Mass (Da):120,298
Last modified:May 1, 1997 - v1
Checksum:i2EFFFFE0D8609C59
GO
Isoform 2 (identifier: P97879-2) [UniParc]FASTAAdd to basket
Also known as: GRIP1c4-7

The sequence of this isoform differs from the canonical sequence as follows:
     1-416: Missing.
     417-451: SSLNMGTLPRSLYSTSPRGTMMRRRLKKKDFKSSL → MTPKRTEKEMKKPHNFHHASHPPLRKGQKINAAHV
     1101-1112: GNLETREPTNTL → IPGDAVYFWQS

Note: No experimental confirmation available.
Show »
Length:695
Mass (Da):75,383
Checksum:i0E8E0AE3EE7BCCDD
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti816R → S in AAR08916 (PubMed:15226318).Curated1
Sequence conflicti841K → Q in AAR08916 (PubMed:15226318).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0097511 – 416Missing in isoform 2. 1 PublicationAdd BLAST416
Alternative sequenceiVSP_009752417 – 451SSLNM…FKSSL → MTPKRTEKEMKKPHNFHHAS HPPLRKGQKINAAHV in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_0097531101 – 1112GNLET…PTNTL → IPGDAVYFWQS in isoform 2. 1 PublicationAdd BLAST12

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U88572 mRNA. Translation: AAB51689.1.
AY437398 mRNA. Translation: AAR08916.1.
PIRiT32733.
RefSeqiNP_114458.1. NM_032069.1. [P97879-1]
UniGeneiRn.74240.

Genome annotation databases

GeneIDi84016.
KEGGirno:84016.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U88572 mRNA. Translation: AAB51689.1.
AY437398 mRNA. Translation: AAR08916.1.
PIRiT32733.
RefSeqiNP_114458.1. NM_032069.1. [P97879-1]
UniGeneiRn.74240.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1M5ZNMR-A980-1070[»]
1N7EX-ray1.50A665-761[»]
1N7FX-ray1.80A/B665-761[»]
1P1DNMR-A463-658[»]
1P1ENMR-A463-563[»]
2QT5X-ray2.30A/B48-243[»]
ProteinModelPortaliP97879.
SMRiP97879.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi249882. 7 interactors.
DIPiDIP-37486N.
IntActiP97879. 29 interactors.
MINTiMINT-138947.
STRINGi10116.ENSRNOP00000005539.

Chemistry databases

ChEMBLiCHEMBL2366484.

PTM databases

iPTMnetiP97879.
PhosphoSitePlusiP97879.
SwissPalmiP97879.

Proteomic databases

PaxDbiP97879.
PRIDEiP97879.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi84016.
KEGGirno:84016.

Organism-specific databases

CTDi23426.
RGDi621667. Grip1.

Phylogenomic databases

eggNOGiKOG3528. Eukaryota.
ENOG410XSUX. LUCA.
HOGENOMiHOG000043120.
HOVERGENiHBG051841.
InParanoidiP97879.
KOiK20251.
PhylomeDBiP97879.

Miscellaneous databases

EvolutionaryTraceiP97879.
PROiP97879.

Gene expression databases

BgeeiENSRNOG00000004013.

Family and domain databases

Gene3Di2.30.42.10. 7 hits.
InterProiIPR030026. GRIP1.
IPR001478. PDZ.
[Graphical view]
PANTHERiPTHR10316:SF39. PTHR10316:SF39. 2 hits.
PfamiPF00595. PDZ. 7 hits.
[Graphical view]
SMARTiSM00228. PDZ. 7 hits.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 7 hits.
PROSITEiPS50106. PDZ. 7 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiGRIP1_RAT
AccessioniPrimary (citable) accession number: P97879
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 29, 2004
Last sequence update: May 1, 1997
Last modified: November 2, 2016
This is version 134 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.