Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P97879 (GRIP1_RAT) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 111. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Glutamate receptor-interacting protein 1

Short name=GRIP-1
Alternative name(s):
AMPA receptor-interacting protein GRIP1
Gene names
Name:Grip1
OrganismRattus norvegicus (Rat) [Reference proteome]
Taxonomic identifier10116 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus

Protein attributes

Sequence length1112 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May play a role as a localized scaffold for the assembly of a multiprotein signaling complex and as mediator of the trafficking of its binding partners at specific subcellular location in neurons. Ref.1

Subunit structure

Interacts with EFNB1, EPHA7, EPHB2, EFNB3, KIF5A, KIF5C, KIF5B and the C-terminal tail of PRLHR. Forms a ternary complex with GRIA2 and CSPG4 By similarity. Can form homomultimers or heteromultimers with GRIP2. Interacts with GRIA2, GRIA3, GRIPAP1/GRASP1, PPFIA1, PPFIA4, FRAS1, PLCD4, PTPRF and liprins-alpha. Interacts with ATAD1 in an ATP-dependent manner. ATAD1-catalyzed ATP hydrolysis disrupts binding to ATAD1 and to GRIA2 and leads to AMPAR complex disassembly. Interacts with SLC30A9 By similarity. Ref.1 Ref.2 Ref.3 Ref.4 Ref.5 Ref.7 Ref.8 Ref.9 Ref.10

Subcellular location

Cytoplasm. Endomembrane system; Peripheral membrane protein. Cell junctionsynapsepostsynaptic cell membrane. Cell junctionsynapsepostsynaptic cell membranepostsynaptic density. Endoplasmic reticulum membrane; Peripheral membrane protein Potential. Note: Membrane-associated with vesicles, peri-Golgi complexes and endoplasmic reticulum. Enriched in postsynaptic plasma membrane and postsynaptic densities. Ref.2 Ref.3

Tissue specificity

Expressed in brain, testis and retina. In brain highly expressed in the olfactory bulb, cortex and hyppocampus and lower level in thalamus, cerebellum and spinal cord. In brain it is found in the perikaryon, dendrites, dendritic shafts, dendritic spines and, excitatory and inhibitory synapses of neurons. In retina, it is most abundant in the plexiform layers than in perikarya. Ref.1 Ref.3 Ref.6

Developmental stage

Detected in early embryonic stage as early as E15, gradually increased throughout early development, peaked at approximately between postnatal days P6 and P8, then slightly decreased and remained relatively stable in the adult. Ref.3

Domain

PDZ 6 mediates interaction with the PDZ recognition motif of EFNB1 and EPHB2 and with the C-terminus of PPFIA1 and PPFIA4. PDZ 4 and PDZ 5 mediate interaction with PRLHR By similarity. PDZ 4 and PDZ 5 mediate interaction with the C-terminus of GRIA2 and GRIA3. PDZ 4, PDZ 5 and PDZ 6 mediate homomultimers. PDZ 7 mediates interaction with PDZ domain of GRASP1. PDZ 7 domain binds CSPG4. PDZ 6 mediates interaction with the C-terminus of liprins-alpha. PDZ 1, PDZ 2 and PDZ 3 mediate interaction with the PDZ-binding motif of FRAS1. Ref.9

Sequence similarities

Contains 7 PDZ (DHR) domains.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: P97879-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Note: No experimental confirmation available.
Isoform 2 (identifier: P97879-2)

Also known as: GRIP1c4-7;

The sequence of this isoform differs from the canonical sequence as follows:
     1-416: Missing.
     417-451: SSLNMGTLPRSLYSTSPRGTMMRRRLKKKDFKSSL → MTPKRTEKEMKKPHNFHHASHPPLRKGQKINAAHV
     1101-1112: GNLETREPTNTL → IPGDAVYFWQS
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 11121112Glutamate receptor-interacting protein 1
PRO_0000083851

Regions

Domain53 – 13684PDZ 1
Domain150 – 23889PDZ 2
Domain252 – 33685PDZ 3
Domain471 – 56090PDZ 4
Domain572 – 65786PDZ 5
Domain672 – 75483PDZ 6
Domain988 – 107083PDZ 7

Natural variations

Alternative sequence1 – 416416Missing in isoform 2.
VSP_009751
Alternative sequence417 – 45135SSLNM…FKSSL → MTPKRTEKEMKKPHNFHHAS HPPLRKGQKINAAHV in isoform 2.
VSP_009752
Alternative sequence1101 – 111212GNLET…PTNTL → IPGDAVYFWQS in isoform 2.
VSP_009753

Experimental info

Sequence conflict8161R → S in AAR08916. Ref.2
Sequence conflict8411K → Q in AAR08916. Ref.2

Secondary structure

.................................................................................................. 1112
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified May 1, 1997. Version 1.
Checksum: 2EFFFFE0D8609C59

FASTA1,112120,298
        10         20         30         40         50         60 
MIAVSFKCRC QILRRLTKDE SPYTKSASQT KPPDGALAVR RQSIPEEFKG STVVELMKKE 

        70         80         90        100        110        120 
GTTLGLTVSG GIDKDGKPRV SNLRQGGIAA RSDQLDVGDY IKAVNGINLA KFRHDEIISL 

       130        140        150        160        170        180 
LKNVGERVVL EVEYELPPVS IQGSSVMFRT VEVTLHKEGN TFGFVIRGGA HDDRNKSRPV 

       190        200        210        220        230        240 
VITCVRPGGP ADREGTIKPG DRLLSVDGIR LLGTTHAEAM SILKQCGQEA TLLIEYDVSV 

       250        260        270        280        290        300 
MDSVATASGP LLVEVAKTPG ASLGVALTTS VCCNKQVIVI DKIKSASIAD RCGALHVGDH 

       310        320        330        340        350        360 
ILSIDGTSME YCTLAEATQF LANTTDQVKL EILPHHQTRL ALKGPDHVKI QRSDRQLPWD 

       370        380        390        400        410        420 
PWASSQCSVH TNHHHNPHHP DHCRVPALGF PKALTPNSPP AMVSSSSPTS MSAYSLSSLN 

       430        440        450        460        470        480 
MGTLPRSLYS TSPRGTMMRR RLKKKDFKSS LSLASSTVGL AGQVVHTETT EVVLTADPVT 

       490        500        510        520        530        540 
GFGIQLQGSV FATETLSSPP LISYIEADSP AERCGVLQIG DRVMAINGIP TEDSTFEEAN 

       550        560        570        580        590        600 
QLLRDSSITS KVTLEIEFDV AESVIPSSGT FHVKLPKKHS VELGITISSP SSRKPGDPLV 

       610        620        630        640        650        660 
ISDIKKGSVA HRTGTLELGD KLLAIDNIRL DSCSMEDAVQ ILQQCEDLVK LKIRKDEDNS 

       670        680        690        700        710        720 
DEQESSGAII YTVELKRYGG PLGITISGTE EPFDPIIISS LTKGGLAERT GAIHIGDRIL 

       730        740        750        760        770        780 
AINSSSLKGK PLSEAIHLLQ MAGETVTLKI KKQTDAQPAS SPKKLPIPSH SSDLGDGEED 

       790        800        810        820        830        840 
PSPIQRPGKL SDVYPSTVPS VDSAVDSWDG SGIDARYGSQ GTTFQTSGYN FNTYDWRSPK 

       850        860        870        880        890        900 
KRASLSPVPK PRSQTYPDVG LSNEDWDRST ASGFAGASDS ADAEQEENFW SQALEDLETC 

       910        920        930        940        950        960 
GQSGILRELE ATIMSGSTMS LNHEAPTARS QLGRQASFQE RSNSRPHYSQ TTRSNTLPSD 

       970        980        990       1000       1010       1020 
VGRKSVTLRK MKQEIKEIMS PTPVELHKVT LYKDSGMEDF GFSVADGLLE KGVYVKNIRP 

      1030       1040       1050       1060       1070       1080 
AGPGDLGGLK PYDRLLQVNH VRTRDFDCCL VVPLIAESGN KLDLVISRNP LASQKSIEQP 

      1090       1100       1110 
ALPSDWSEQN SAFFQQPSHG GNLETREPTN TL 

« Hide

Isoform 2 (GRIP1c4-7) [UniParc].

Checksum: 0E8E0AE3EE7BCCDD
Show »

FASTA69575,383

References

[1]"GRIP: a synaptic PDZ domain-containing protein that interacts with AMPA receptors."
Dong H., O'Brien R.J., Fung E.T., Lanahan A.A., Worley P.F., Huganir R.L.
Nature 386:279-284(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH GRIA2 AND GRIA3, TISSUE SPECIFICITY, FUNCTION.
Tissue: Hippocampus.
[2]"A four PDZ domain-containing splice variant form of GRIP1 is localized in GABAergic and glutamatergic synapses in the brain."
Charych E.I., Yu W., Li R., Serwanski D.R., Miralles C.P., Li X., Yang B.Y., Pinal N., Walikonis R., De Blas A.L.
J. Biol. Chem. 279:38978-38990(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), SUBCELLULAR LOCATION, INTERACTION WITH GRIA2 AND GRIA3.
Strain: Sprague-Dawley.
Tissue: Brain.
[3]"Characterization of the glutamate receptor-interacting proteins GRIP1 and GRIP2."
Dong H., Zhang P., Song I., Petralia R.S., Liao D., Huganir R.L.
J. Neurosci. 19:6930-6941(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: SUBUNIT, INTERACTION WITH GRIA2, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE, SUBCELLULAR LOCATION.
[4]"GRASP-1: a neuronal RasGEF associated with the AMPA receptor/GRIP complex."
Ye B., Liao D., Zhang X., Zhang P., Dong H., Huganir R.L.
Neuron 26:603-617(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH GRIPAP1.
[5]"Interaction between GRIP and liprin-alpha/SYD2 is required for AMPA receptor targeting."
Wyszynski M., Kim E., Dunah A.W., Passafaro M., Valtschanoff J.G., Serra-Pages C., Streuli M., Weinberg R.J., Sheng M.
Neuron 34:39-52(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH PPFIA1; PPFIA4; PTPRF AND LIPRINS-ALPHA.
[6]"Association of the AMPA receptor-related postsynaptic density proteins GRIP and ABP with subsets of glutamate-sensitive neurons in the rat retina."
Gabriel R., de Souza S., Ziff E.B., Witkovsky P.
J. Comp. Neurol. 449:129-140(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY.
[7]"The AAA+ ATPase Thorase regulates AMPA receptor-dependent synaptic plasticity and behavior."
Zhang J., Wang Y., Chi Z., Keuss M.J., Pai Y.M., Kang H.C., Shin J.H., Bugayenko A., Wang H., Xiong Y., Pletnikov M.V., Mattson M.P., Dawson T.M., Dawson V.L.
Cell 145:284-299(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH ATAD1 AND GRIA2.
[8]"PDZ7 of glutamate receptor interacting protein binds to its target via a novel hydrophobic surface area."
Feng W., Fan J.-S., Jiang M., Shi Y.-W., Zhang M.
J. Biol. Chem. 277:41140-41146(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: STRUCTURE BY NMR OF 980-1070, INTERACTION WITH GRASP1.
[9]"The proteoglycan NG2 is complexed with alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptors by the PDZ glutamate receptor interaction protein (GRIP) in glial progenitor cells. Implications for glial-neuronal signaling."
Stegmueller J., Werner H., Nave K.-A., Trotter J.
J. Biol. Chem. 278:3590-3598(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH CSPG4, DOMAIN.
[10]"A direct functional link between the multi-PDZ domain protein GRIP1 and the Fraser syndrome protein Fras1."
Takamiya K., Kostourou V., Adams S., Jadeja S., Chalepakis G., Scambler P.J., Huganir R.L., Adams R.H.
Nat. Genet. 36:172-177(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH FRAS1.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U88572 mRNA. Translation: AAB51689.1.
AY437398 mRNA. Translation: AAR08916.1.
PIRT32733.
RefSeqNP_114458.1. NM_032069.1.
UniGeneRn.74240.

3D structure databases

PDBe
RCSB PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
1M5ZNMR-A980-1070[»]
1N7EX-ray1.50A665-761[»]
1N7FX-ray1.80A/B665-761[»]
1P1DNMR-A463-658[»]
1P1ENMR-A463-563[»]
2QT5X-ray2.30A/B48-243[»]
ProteinModelPortalP97879.
SMRP97879. Positions 48-240, 242-343, 463-658, 667-761, 980-1070.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid249882. 7 interactions.
DIPDIP-37486N.
IntActP97879. 29 interactions.
MINTMINT-138947.
STRING10116.ENSRNOP00000061369.

PTM databases

PhosphoSiteP97879.

Proteomic databases

PRIDEP97879.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSRNOT00000005545; ENSRNOP00000005545; ENSRNOG00000004013.
GeneID84016.
KEGGrno:84016.

Organism-specific databases

CTD23426.
RGD621667. Grip1.

Phylogenomic databases

eggNOGNOG297474.
GeneTreeENSGT00390000013494.
HOGENOMHOG000043120.
HOVERGENHBG051841.
InParanoidP97879.
PhylomeDBP97879.

Gene expression databases

GenevestigatorP97879.

Family and domain databases

Gene3D2.30.42.10. 7 hits.
InterProIPR001478. PDZ.
[Graphical view]
PfamPF00595. PDZ. 7 hits.
[Graphical view]
SMARTSM00228. PDZ. 7 hits.
[Graphical view]
SUPFAMSSF50156. SSF50156. 7 hits.
PROSITEPS50106. PDZ. 7 hits.
[Graphical view]
ProtoNetSearch...

Other

EvolutionaryTraceP97879.
NextBio616561.
PROP97879.

Entry information

Entry nameGRIP1_RAT
AccessionPrimary (citable) accession number: P97879
Entry history
Integrated into UniProtKB/Swiss-Prot: March 29, 2004
Last sequence update: May 1, 1997
Last modified: April 16, 2014
This is version 111 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references