Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Glutamate receptor-interacting protein 1

Gene

Grip1

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May play a role as a localized scaffold for the assembly of a multiprotein signaling complex and as mediator of the trafficking of its binding partners at specific subcellular location in neurons.1 Publication

GO - Molecular functioni

  • receptor binding Source: RGD

GO - Biological processi

  • dendrite development Source: InterPro
  • nervous system development Source: RGD
  • protein transport Source: RGD
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Glutamate receptor-interacting protein 1
Short name:
GRIP-1
Alternative name(s):
AMPA receptor-interacting protein GRIP1
Gene namesi
Name:Grip1
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi621667. Grip1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasm, Endoplasmic reticulum, Membrane, Postsynaptic cell membrane, Synapse

Pathology & Biotechi

Chemistry

ChEMBLiCHEMBL2366484.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 11121112Glutamate receptor-interacting protein 1PRO_0000083851Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei43 – 431PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiP97879.
PRIDEiP97879.

PTM databases

iPTMnetiP97879.
PhosphoSiteiP97879.
SwissPalmiP97879.

Expressioni

Tissue specificityi

Expressed in brain, testis and retina. In brain highly expressed in the olfactory bulb, cortex and hyppocampus and lower level in thalamus, cerebellum and spinal cord. In brain it is found in the perikaryon, dendrites, dendritic shafts, dendritic spines and, excitatory and inhibitory synapses of neurons. In retina, it is most abundant in the plexiform layers than in perikarya.3 Publications

Developmental stagei

Detected in early embryonic stage as early as E15, gradually increased throughout early development, peaked at approximately between postnatal days P6 and P8, then slightly decreased and remained relatively stable in the adult.1 Publication

Gene expression databases

BgeeiENSRNOG00000004013.

Interactioni

Subunit structurei

Interacts with EFNB1, EPHA7, EPHB2, EFNB3, KIF5A, KIF5C, KIF5B and the C-terminal tail of PRLHR. Forms a ternary complex with GRIA2 and CSPG4 (By similarity). Can form homomultimers or heteromultimers with GRIP2. Interacts with GRIA2, GRIA3, GRIPAP1/GRASP1, PPFIA1, PPFIA4, FRAS1, PLCD4, PTPRF and liprins-alpha. Interacts with ATAD1 in an ATP-dependent manner. ATAD1-catalyzed ATP hydrolysis disrupts binding to ATAD1 and to GRIA2 and leads to AMPAR complex disassembly. Interacts with SLC30A9 (By similarity). Interacts with WBSCR22 (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
Agap2Q8CGU44EBI-936113,EBI-4409108
Gria2P1949115EBI-936113,EBI-77718
Gria3P194923EBI-936113,EBI-77764
Gria4P194933EBI-936113,EBI-7761834
Grip2Q9WTW1-33EBI-936113,EBI-936068
Grm7P354003EBI-936113,EBI-6936416
PPFIA1Q131364EBI-936113,EBI-745426From a different organism.
Ppfia3Q91Z793EBI-936113,EBI-8276993
Ppfia4Q91Z807EBI-936113,EBI-8276907
PtprkQ9WUL32EBI-936113,EBI-8277319

GO - Molecular functioni

  • receptor binding Source: RGD

Protein-protein interaction databases

BioGridi249882. 7 interactions.
DIPiDIP-37486N.
IntActiP97879. 29 interactions.
MINTiMINT-138947.
STRINGi10116.ENSRNOP00000005539.

Structurei

Secondary structure

1
1112
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi49 – 579Combined sources
Beta strandi66 – 694Combined sources
Beta strandi74 – 763Combined sources
Beta strandi78 – 836Combined sources
Helixi88 – 914Combined sources
Beta strandi100 – 1045Combined sources
Helixi114 – 1229Combined sources
Beta strandi126 – 13510Combined sources
Beta strandi144 – 15613Combined sources
Beta strandi163 – 1697Combined sources
Turni174 – 1763Combined sources
Beta strandi178 – 1858Combined sources
Helixi190 – 1945Combined sources
Beta strandi202 – 2065Combined sources
Helixi216 – 2249Combined sources
Beta strandi228 – 23912Combined sources
Beta strandi468 – 4758Combined sources
Turni478 – 4803Combined sources
Beta strandi485 – 4884Combined sources
Beta strandi493 – 4953Combined sources
Beta strandi499 – 5046Combined sources
Helixi510 – 5134Combined sources
Beta strandi523 – 5264Combined sources
Helixi536 – 5449Combined sources
Beta strandi548 – 55811Combined sources
Beta strandi571 – 5755Combined sources
Beta strandi586 – 5883Combined sources
Beta strandi592 – 5943Combined sources
Beta strandi600 – 6034Combined sources
Beta strandi606 – 6083Combined sources
Helixi609 – 6124Combined sources
Beta strandi621 – 6255Combined sources
Helixi630 – 6323Combined sources
Helixi635 – 64410Combined sources
Beta strandi649 – 6546Combined sources
Beta strandi670 – 6767Combined sources
Beta strandi684 – 6874Combined sources
Beta strandi697 – 7015Combined sources
Helixi706 – 7105Combined sources
Beta strandi718 – 7225Combined sources
Helixi732 – 7409Combined sources
Beta strandi744 – 7518Combined sources
Beta strandi985 – 9928Combined sources
Beta strandi998 – 10069Combined sources
Beta strandi1013 – 10186Combined sources
Helixi1023 – 10275Combined sources
Beta strandi1034 – 10385Combined sources
Helixi1048 – 10569Combined sources
Beta strandi1061 – 10688Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1M5ZNMR-A980-1070[»]
1N7EX-ray1.50A665-761[»]
1N7FX-ray1.80A/B665-761[»]
1P1DNMR-A463-658[»]
1P1ENMR-A463-563[»]
2QT5X-ray2.30A/B48-243[»]
ProteinModelPortaliP97879.
SMRiP97879. Positions 48-240, 242-343, 463-658, 667-761, 980-1070.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP97879.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini53 – 13684PDZ 1PROSITE-ProRule annotationAdd
BLAST
Domaini150 – 23889PDZ 2PROSITE-ProRule annotationAdd
BLAST
Domaini252 – 33685PDZ 3PROSITE-ProRule annotationAdd
BLAST
Domaini471 – 56090PDZ 4PROSITE-ProRule annotationAdd
BLAST
Domaini572 – 65786PDZ 5PROSITE-ProRule annotationAdd
BLAST
Domaini672 – 75483PDZ 6PROSITE-ProRule annotationAdd
BLAST
Domaini988 – 107083PDZ 7PROSITE-ProRule annotationAdd
BLAST

Domaini

PDZ 6 mediates interaction with the PDZ recognition motif of EFNB1 and EPHB2 and with the C-terminus of PPFIA1 and PPFIA4. PDZ 4 and PDZ 5 mediate interaction with PRLHR (By similarity). PDZ 4 and PDZ 5 mediate interaction with the C-terminus of GRIA2 and GRIA3. PDZ 4, PDZ 5 and PDZ 6 mediate homomultimers. PDZ 7 mediates interaction with PDZ domain of GRASP1. PDZ 7 domain binds CSPG4. PDZ 6 mediates interaction with the C-terminus of liprins-alpha. PDZ 1, PDZ 2 and PDZ 3 mediate interaction with the PDZ-binding motif of FRAS1.By similarity1 Publication

Sequence similaritiesi

Contains 7 PDZ (DHR) domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG3528. Eukaryota.
ENOG410XSUX. LUCA.
HOGENOMiHOG000043120.
HOVERGENiHBG051841.
InParanoidiP97879.
KOiK20251.
PhylomeDBiP97879.

Family and domain databases

Gene3Di2.30.42.10. 7 hits.
InterProiIPR030026. GRIP1.
IPR001478. PDZ.
[Graphical view]
PANTHERiPTHR10316:SF39. PTHR10316:SF39. 2 hits.
PfamiPF00595. PDZ. 7 hits.
[Graphical view]
SMARTiSM00228. PDZ. 7 hits.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 7 hits.
PROSITEiPS50106. PDZ. 7 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P97879-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MIAVSFKCRC QILRRLTKDE SPYTKSASQT KPPDGALAVR RQSIPEEFKG
60 70 80 90 100
STVVELMKKE GTTLGLTVSG GIDKDGKPRV SNLRQGGIAA RSDQLDVGDY
110 120 130 140 150
IKAVNGINLA KFRHDEIISL LKNVGERVVL EVEYELPPVS IQGSSVMFRT
160 170 180 190 200
VEVTLHKEGN TFGFVIRGGA HDDRNKSRPV VITCVRPGGP ADREGTIKPG
210 220 230 240 250
DRLLSVDGIR LLGTTHAEAM SILKQCGQEA TLLIEYDVSV MDSVATASGP
260 270 280 290 300
LLVEVAKTPG ASLGVALTTS VCCNKQVIVI DKIKSASIAD RCGALHVGDH
310 320 330 340 350
ILSIDGTSME YCTLAEATQF LANTTDQVKL EILPHHQTRL ALKGPDHVKI
360 370 380 390 400
QRSDRQLPWD PWASSQCSVH TNHHHNPHHP DHCRVPALGF PKALTPNSPP
410 420 430 440 450
AMVSSSSPTS MSAYSLSSLN MGTLPRSLYS TSPRGTMMRR RLKKKDFKSS
460 470 480 490 500
LSLASSTVGL AGQVVHTETT EVVLTADPVT GFGIQLQGSV FATETLSSPP
510 520 530 540 550
LISYIEADSP AERCGVLQIG DRVMAINGIP TEDSTFEEAN QLLRDSSITS
560 570 580 590 600
KVTLEIEFDV AESVIPSSGT FHVKLPKKHS VELGITISSP SSRKPGDPLV
610 620 630 640 650
ISDIKKGSVA HRTGTLELGD KLLAIDNIRL DSCSMEDAVQ ILQQCEDLVK
660 670 680 690 700
LKIRKDEDNS DEQESSGAII YTVELKRYGG PLGITISGTE EPFDPIIISS
710 720 730 740 750
LTKGGLAERT GAIHIGDRIL AINSSSLKGK PLSEAIHLLQ MAGETVTLKI
760 770 780 790 800
KKQTDAQPAS SPKKLPIPSH SSDLGDGEED PSPIQRPGKL SDVYPSTVPS
810 820 830 840 850
VDSAVDSWDG SGIDARYGSQ GTTFQTSGYN FNTYDWRSPK KRASLSPVPK
860 870 880 890 900
PRSQTYPDVG LSNEDWDRST ASGFAGASDS ADAEQEENFW SQALEDLETC
910 920 930 940 950
GQSGILRELE ATIMSGSTMS LNHEAPTARS QLGRQASFQE RSNSRPHYSQ
960 970 980 990 1000
TTRSNTLPSD VGRKSVTLRK MKQEIKEIMS PTPVELHKVT LYKDSGMEDF
1010 1020 1030 1040 1050
GFSVADGLLE KGVYVKNIRP AGPGDLGGLK PYDRLLQVNH VRTRDFDCCL
1060 1070 1080 1090 1100
VVPLIAESGN KLDLVISRNP LASQKSIEQP ALPSDWSEQN SAFFQQPSHG
1110
GNLETREPTN TL
Note: No experimental confirmation available.
Length:1,112
Mass (Da):120,298
Last modified:May 1, 1997 - v1
Checksum:i2EFFFFE0D8609C59
GO
Isoform 2 (identifier: P97879-2) [UniParc]FASTAAdd to basket
Also known as: GRIP1c4-7

The sequence of this isoform differs from the canonical sequence as follows:
     1-416: Missing.
     417-451: SSLNMGTLPRSLYSTSPRGTMMRRRLKKKDFKSSL → MTPKRTEKEMKKPHNFHHASHPPLRKGQKINAAHV
     1101-1112: GNLETREPTNTL → IPGDAVYFWQS

Note: No experimental confirmation available.
Show »
Length:695
Mass (Da):75,383
Checksum:i0E8E0AE3EE7BCCDD
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti816 – 8161R → S in AAR08916 (PubMed:15226318).Curated
Sequence conflicti841 – 8411K → Q in AAR08916 (PubMed:15226318).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 416416Missing in isoform 2. 1 PublicationVSP_009751Add
BLAST
Alternative sequencei417 – 45135SSLNM…FKSSL → MTPKRTEKEMKKPHNFHHAS HPPLRKGQKINAAHV in isoform 2. 1 PublicationVSP_009752Add
BLAST
Alternative sequencei1101 – 111212GNLET…PTNTL → IPGDAVYFWQS in isoform 2. 1 PublicationVSP_009753Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U88572 mRNA. Translation: AAB51689.1.
AY437398 mRNA. Translation: AAR08916.1.
PIRiT32733.
RefSeqiNP_114458.1. NM_032069.1. [P97879-1]
UniGeneiRn.74240.

Genome annotation databases

GeneIDi84016.
KEGGirno:84016.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U88572 mRNA. Translation: AAB51689.1.
AY437398 mRNA. Translation: AAR08916.1.
PIRiT32733.
RefSeqiNP_114458.1. NM_032069.1. [P97879-1]
UniGeneiRn.74240.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1M5ZNMR-A980-1070[»]
1N7EX-ray1.50A665-761[»]
1N7FX-ray1.80A/B665-761[»]
1P1DNMR-A463-658[»]
1P1ENMR-A463-563[»]
2QT5X-ray2.30A/B48-243[»]
ProteinModelPortaliP97879.
SMRiP97879. Positions 48-240, 242-343, 463-658, 667-761, 980-1070.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi249882. 7 interactions.
DIPiDIP-37486N.
IntActiP97879. 29 interactions.
MINTiMINT-138947.
STRINGi10116.ENSRNOP00000005539.

Chemistry

ChEMBLiCHEMBL2366484.

PTM databases

iPTMnetiP97879.
PhosphoSiteiP97879.
SwissPalmiP97879.

Proteomic databases

PaxDbiP97879.
PRIDEiP97879.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi84016.
KEGGirno:84016.

Organism-specific databases

CTDi23426.
RGDi621667. Grip1.

Phylogenomic databases

eggNOGiKOG3528. Eukaryota.
ENOG410XSUX. LUCA.
HOGENOMiHOG000043120.
HOVERGENiHBG051841.
InParanoidiP97879.
KOiK20251.
PhylomeDBiP97879.

Miscellaneous databases

EvolutionaryTraceiP97879.
PROiP97879.

Gene expression databases

BgeeiENSRNOG00000004013.

Family and domain databases

Gene3Di2.30.42.10. 7 hits.
InterProiIPR030026. GRIP1.
IPR001478. PDZ.
[Graphical view]
PANTHERiPTHR10316:SF39. PTHR10316:SF39. 2 hits.
PfamiPF00595. PDZ. 7 hits.
[Graphical view]
SMARTiSM00228. PDZ. 7 hits.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 7 hits.
PROSITEiPS50106. PDZ. 7 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiGRIP1_RAT
AccessioniPrimary (citable) accession number: P97879
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 29, 2004
Last sequence update: May 1, 1997
Last modified: September 7, 2016
This is version 132 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.