Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P97819 (PLPL9_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 118. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
85/88 kDa calcium-independent phospholipase A2

Short name=CaI-PLA2
EC=3.1.1.4
Alternative name(s):
Group VI phospholipase A2
Short name=GVI PLA2
Intracellular membrane-associated calcium-independent phospholipase A2 beta
Short name=iPLA2-beta
Patatin-like phospholipase domain-containing protein 9
Short name=PNPLA9
Gene names
Name:Pla2g6
Synonyms:Pnpla9
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length807 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Catalyzes the release of fatty acids from phospholipids. It has been implicated in normal phospholipid remodeling, nitric oxide-induced or vasopressin-induced arachidonic acid release and in leukotriene and prostaglandin production. May participate in fas mediated apoptosis and in regulating transmembrane ion flux in glucose-stimulated B-cells. Has a role in cardiolipin (CL) deacylation. Required for both speed and directionality of monocyte MCP1/CCL2-induced chemotaxis through regulation of F-actin polymerization at the pseudopods By similarity.

Catalytic activity

Phosphatidylcholine + H2O = 1-acylglycerophosphocholine + a carboxylate.

Enzyme regulation

Inhibited by calcium-activated calmodulin By similarity.

Subcellular location

Isoform Long: Membrane; Peripheral membrane protein. Note: Recruited to the membrane-enriched pseudopod upon MCP1/CCL2 stimulation in monocytes By similarity. Ref.3

Isoform Short: Cytoplasm Ref.3.

Sequence similarities

Contains 7 ANK repeats.

Contains 1 patatin domain.

Ontologies

Keywords
   Biological processChemotaxis
Lipid degradation
Lipid metabolism
   Cellular componentCytoplasm
Membrane
   Coding sequence diversityAlternative splicing
   DomainANK repeat
Repeat
   LigandCalmodulin-binding
   Molecular functionHydrolase
   Technical termComplete proteome
Direct protein sequencing
Reference proteome
Gene Ontology (GO)
   Biological_processcardiolipin biosynthetic process

Inferred from electronic annotation. Source: Ensembl

chemotaxis

Inferred from electronic annotation. Source: UniProtKB-KW

lipid catabolic process

Inferred from electronic annotation. Source: UniProtKB-KW

maternal process involved in female pregnancy

Inferred from electronic annotation. Source: Ensembl

memory

Inferred from electronic annotation. Source: Ensembl

negative regulation of synaptic transmission, glutamatergic

Inferred from electronic annotation. Source: Ensembl

positive regulation of arachidonic acid secretion

Inferred from electronic annotation. Source: Ensembl

positive regulation of ceramide biosynthetic process

Inferred from electronic annotation. Source: Ensembl

positive regulation of cytosolic calcium ion concentration

Inferred from electronic annotation. Source: Ensembl

positive regulation of exocytosis

Inferred from electronic annotation. Source: Ensembl

positive regulation of insulin secretion involved in cellular response to glucose stimulus

Inferred from electronic annotation. Source: Ensembl

positive regulation of protein kinase C signaling

Inferred from electronic annotation. Source: Ensembl

positive regulation of protein phosphorylation

Inferred from electronic annotation. Source: Ensembl

positive regulation of release of cytochrome c from mitochondria

Inferred from electronic annotation. Source: Ensembl

positive regulation of vasodilation

Inferred from electronic annotation. Source: Ensembl

regulation of store-operated calcium channel activity

Inferred from electronic annotation. Source: Ensembl

response to endoplasmic reticulum stress

Inferred from electronic annotation. Source: Ensembl

urinary bladder smooth muscle contraction

Inferred from electronic annotation. Source: Ensembl

   Cellular_componentcentrosome

Inferred from electronic annotation. Source: Ensembl

cytosol

Inferred from electronic annotation. Source: Ensembl

membrane

Inferred from electronic annotation. Source: UniProtKB-SubCell

mitochondrion

Inferred from electronic annotation. Source: Ensembl

   Molecular_functioncalcium-independent phospholipase A2 activity

Inferred from electronic annotation. Source: Ensembl

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform Long (identifier: P97819-1)

Also known as: iPLA2-L;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform Short (identifier: P97819-2)

Also known as: iPLA2-S;

The sequence of this isoform differs from the canonical sequence as follows:
     396-451: LITRKALLTLLKTVGADHHFPIIQGVSTEQGSAAATHPLFSLDRTQPPAISLNNLE → Q

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 80780785/88 kDa calcium-independent phospholipase A2
PRO_0000067038

Regions

Repeat151 – 18131ANK 1
Repeat185 – 21531ANK 2
Repeat219 – 24830ANK 3
Repeat251 – 28131ANK 4
Repeat286 – 31227ANK 5
Repeat316 – 34530ANK 6
Repeat349 – 37830ANK 7
Domain482 – 666185Patatin
Region678 – 69720Calmodulin-binding By similarity
Region749 – 76012Calmodulin-binding By similarity

Sites

Active site5201 Potential

Natural variations

Alternative sequence396 – 45156LITRK…LNNLE → Q in isoform Short.
VSP_044364

Sequences

Sequence LengthMass (Da)Tools
Isoform Long (iPLA2-L) [UniParc].

Last modified October 31, 2012. Version 3.
Checksum: 3838889731100294

FASTA80789,560
        10         20         30         40         50         60 
MQFFGRLVNT LSSVTNLFSN PFRVKEVSLT DYVSSERVRE EGQLILLQNV SNRTWDCVLV 

        70         80         90        100        110        120 
SPRNPQSGFR LFQLESEADA LVNFQQFSSQ LPPFYESSVQ VLHVEVLQHL TDLIRNHPSW 

       130        140        150        160        170        180 
TVTHLAVELG IRECFHHSRI ISCANSTENE EGCTPLHLAC RKGDSEILVE LVQYCHAQMD 

       190        200        210        220        230        240 
VTDNKGETAF HYAVQGDNPQ VLQLLGKNAS AGLNQVNNQG LTPLHLACKM GKQEMVRVLL 

       250        260        270        280        290        300 
LCNARCNIMG PGGFPIHTAM KFSQKGCAEM IISMDSNQIH SKDPRYGASP LHWAKNAEMA 

       310        320        330        340        350        360 
RMLLKRGCDV DSTSSSGNTA LHVAVMRNRF DCVMVLLTYG ANAGARGEHG NTPLHLAMSK 

       370        380        390        400        410        420 
DNMEMVKALI VFGAEVDTPN DFGETPALIA SKISKLITRK ALLTLLKTVG ADHHFPIIQG 

       430        440        450        460        470        480 
VSTEQGSAAA THPLFSLDRT QPPAISLNNL ELQDLMPISR ARKPAFILSS MRDEKRSHDH 

       490        500        510        520        530        540 
LLCLDGGGVK GLVIIQLLIA IEKASGVATK DLFDWVAGTS TGGILALAIL HSKSMAYMRG 

       550        560        570        580        590        600 
VYFRMKDEVF RGSRPYESGP LEEFLKREFG EHTKMTDVKK PKVMLTGTLS DRQPAELHLF 

       610        620        630        640        650        660 
RNYDAPEAVR EPRCNQNINL KPPTQPADQL VWRAARSSGA APTYFRPNGR FLDGGLLANN 

       670        680        690        700        710        720 
PTLDAMTEIH EYNQDMIRKG QGNKVKKLSI VVSLGTGKSP QVPVTCVDVF RPSNPWELAK 

       730        740        750        760        770        780 
TVFGAKELGK MVVDCCTDPD GRAVDRARAW CEMVGIQYFR LNPQLGSDIM LDEVSDAVLV 

       790        800 
NALWETEVYI YEHREEFQKL VQLLLSP 

« Hide

Isoform Short (iPLA2-S) [UniParc].

Checksum: AAC3347B0E1292E9
Show »

FASTA75283,702

References

« Hide 'large scale' references
[1]"Identity between the Ca2+-independent phospholipase A2 enzymes from P388D1 macrophages and Chinese hamster ovary cells."
Balboa M.A., Balsinde J., Jones S.S., Dennis E.A.
J. Biol. Chem. 272:8576-8580(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SHORT).
Strain: DBA/2.
[2]Balboa M.A., Balsinde J., Jones S.S., Dennis E.A.
Submitted (FEB-2000) to the EMBL/GenBank/DDBJ databases
Cited for: SEQUENCE REVISION TO 2-3; 9; 11 AND 211.
[3]"Role of calcium-independent phospholipases (iPLA(2)) in phosphatidylcholine metabolism."
Chiu C.-H., Jackowski S.
Biochem. Biophys. Res. Commun. 287:600-606(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM LONG), ALTERNATIVE SPLICING, SUBCELLULAR LOCATION.
Strain: NIH Swiss.
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS LONG AND SHORT).
Strain: C57BL/6J, FVB/N and NMRI.
Tissue: Mammary tumor.
[5]Lubec G., Sunyer B., Chen W.-Q.
Submitted (JAN-2009) to UniProtKB
Cited for: PROTEIN SEQUENCE OF 479-491, IDENTIFICATION BY MASS SPECTROMETRY.
Strain: OF1.
Tissue: Hippocampus.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U88624 mRNA. Translation: AAB48511.2.
AF259401 mRNA. Translation: AAF72651.1.
BC003487 mRNA. Translation: AAH03487.1.
BC057209 mRNA. Translation: AAH57209.1.
CCDSCCDS27637.1. [P97819-2]
CCDS56991.1. [P97819-1]
RefSeqNP_001185952.1. NM_001199023.1. [P97819-1]
NP_001185953.1. NM_001199024.1. [P97819-2]
NP_001185954.1. NM_001199025.1. [P97819-2]
NP_058611.1. NM_016915.4. [P97819-2]
XP_006521215.1. XM_006521152.1. [P97819-1]
XP_006521216.1. XM_006521153.1. [P97819-1]
XP_006521217.1. XM_006521154.1. [P97819-1]
XP_006521218.1. XM_006521155.1. [P97819-1]
XP_006521219.1. XM_006521156.1. [P97819-1]
XP_006521220.1. XM_006521157.1. [P97819-1]
XP_006521221.1. XM_006521158.1. [P97819-1]
XP_006521222.1. XM_006521159.1. [P97819-1]
XP_006521223.1. XM_006521160.1. [P97819-1]
UniGeneMm.155620.

3D structure databases

ProteinModelPortalP97819.
SMRP97819. Positions 120-416.
ModBaseSearch...
MobiDBSearch...

PTM databases

PhosphoSiteP97819.

Proteomic databases

PaxDbP97819.
PRIDEP97819.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000047816; ENSMUSP00000044234; ENSMUSG00000042632. [P97819-2]
ENSMUST00000166977; ENSMUSP00000132071; ENSMUSG00000042632. [P97819-2]
ENSMUST00000172403; ENSMUSP00000131081; ENSMUSG00000042632. [P97819-2]
ENSMUST00000173163; ENSMUSP00000134456; ENSMUSG00000042632. [P97819-2]
ENSMUST00000174021; ENSMUSP00000134672; ENSMUSG00000042632. [P97819-1]
GeneID53357.
KEGGmmu:53357.
UCSCuc007wtd.2. mouse. [P97819-2]
uc007wte.2. mouse. [P97819-1]

Organism-specific databases

CTD8398.
MGIMGI:1859152. Pla2g6.

Phylogenomic databases

eggNOGCOG0666.
GeneTreeENSGT00530000063645.
HOGENOMHOG000013092.
HOVERGENHBG053482.
KOK16343.
OMAPTYFRPN.
OrthoDBEOG76T9QK.
TreeFamTF319230.

Gene expression databases

ArrayExpressP97819.
BgeeP97819.
CleanExMM_PLA2G6.
GenevestigatorP97819.

Family and domain databases

Gene3D1.25.40.20. 2 hits.
InterProIPR016035. Acyl_Trfase/lysoPLipase.
IPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR002641. Patatin/PLipase_A2-rel.
[Graphical view]
PfamPF00023. Ank. 1 hit.
PF12796. Ank_2. 2 hits.
PF01734. Patatin. 1 hit.
[Graphical view]
PRINTSPR01415. ANKYRIN.
SMARTSM00248. ANK. 6 hits.
[Graphical view]
SUPFAMSSF48403. SSF48403. 1 hit.
SSF52151. SSF52151. 1 hit.
PROSITEPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 4 hits.
[Graphical view]
ProtoNetSearch...

Other

NextBio310173.
PROP97819.
SOURCESearch...

Entry information

Entry namePLPL9_MOUSE
AccessionPrimary (citable) accession number: P97819
Secondary accession number(s): Q99LA9, Q9JK61
Entry history
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: October 31, 2012
Last modified: July 9, 2014
This is version 118 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot