Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P97819

- PLPL9_MOUSE

UniProt

P97819 - PLPL9_MOUSE

Protein

85/88 kDa calcium-independent phospholipase A2

Gene

Pla2g6

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 120 (01 Oct 2014)
      Sequence version 3 (31 Oct 2012)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Catalyzes the release of fatty acids from phospholipids. It has been implicated in normal phospholipid remodeling, nitric oxide-induced or vasopressin-induced arachidonic acid release and in leukotriene and prostaglandin production. May participate in fas mediated apoptosis and in regulating transmembrane ion flux in glucose-stimulated B-cells. Has a role in cardiolipin (CL) deacylation. Required for both speed and directionality of monocyte MCP1/CCL2-induced chemotaxis through regulation of F-actin polymerization at the pseudopods By similarity.By similarity

    Catalytic activityi

    Phosphatidylcholine + H2O = 1-acylglycerophosphocholine + a carboxylate.

    Enzyme regulationi

    Inhibited by calcium-activated calmodulin.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei520 – 5201Sequence Analysis

    GO - Molecular functioni

    1. calcium-independent phospholipase A2 activity Source: Ensembl

    GO - Biological processi

    1. cardiolipin biosynthetic process Source: Ensembl
    2. chemotaxis Source: UniProtKB-KW
    3. lipid catabolic process Source: UniProtKB-KW
    4. maternal process involved in female pregnancy Source: Ensembl
    5. memory Source: Ensembl
    6. negative regulation of synaptic transmission, glutamatergic Source: Ensembl
    7. positive regulation of arachidonic acid secretion Source: Ensembl
    8. positive regulation of ceramide biosynthetic process Source: Ensembl
    9. positive regulation of cytosolic calcium ion concentration Source: Ensembl
    10. positive regulation of exocytosis Source: Ensembl
    11. positive regulation of insulin secretion involved in cellular response to glucose stimulus Source: Ensembl
    12. positive regulation of protein kinase C signaling Source: Ensembl
    13. positive regulation of protein phosphorylation Source: Ensembl
    14. positive regulation of release of cytochrome c from mitochondria Source: Ensembl
    15. positive regulation of vasodilation Source: Ensembl
    16. regulation of store-operated calcium channel activity Source: Ensembl
    17. response to endoplasmic reticulum stress Source: Ensembl
    18. urinary bladder smooth muscle contraction Source: Ensembl

    Keywords - Molecular functioni

    Hydrolase

    Keywords - Biological processi

    Chemotaxis, Lipid degradation, Lipid metabolism

    Keywords - Ligandi

    Calmodulin-binding

    Enzyme and pathway databases

    ReactomeiREACT_199027. Acyl chain remodelling of PE.
    REACT_199034. Acyl chain remodeling of CL.
    REACT_199038. Acyl chain remodelling of PC.
    REACT_210240. Role of phospholipids in phagocytosis.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    85/88 kDa calcium-independent phospholipase A2 (EC:3.1.1.4)
    Short name:
    CaI-PLA2
    Alternative name(s):
    Group VI phospholipase A2
    Short name:
    GVI PLA2
    Intracellular membrane-associated calcium-independent phospholipase A2 beta
    Short name:
    iPLA2-beta
    Patatin-like phospholipase domain-containing protein 9
    Short name:
    PNPLA9
    Gene namesi
    Name:Pla2g6
    Synonyms:Pnpla9
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 15

    Organism-specific databases

    MGIiMGI:1859152. Pla2g6.

    Subcellular locationi

    Isoform Long : Membrane; Peripheral membrane protein
    Note: Recruited to the membrane-enriched pseudopod upon MCP1/CCL2 stimulation in monocytes.By similarity

    GO - Cellular componenti

    1. centrosome Source: Ensembl
    2. cytosol Source: Ensembl
    3. membrane Source: UniProtKB-SubCell
    4. mitochondrion Source: Ensembl

    Keywords - Cellular componenti

    Cytoplasm, Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 80780785/88 kDa calcium-independent phospholipase A2PRO_0000067038Add
    BLAST

    Proteomic databases

    PaxDbiP97819.
    PRIDEiP97819.

    PTM databases

    PhosphoSiteiP97819.

    Expressioni

    Gene expression databases

    ArrayExpressiP97819.
    BgeeiP97819.
    CleanExiMM_PLA2G6.
    GenevestigatoriP97819.

    Structurei

    3D structure databases

    ProteinModelPortaliP97819.
    SMRiP97819. Positions 120-416.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati151 – 18131ANK 1Add
    BLAST
    Repeati185 – 21531ANK 2Add
    BLAST
    Repeati219 – 24830ANK 3Add
    BLAST
    Repeati251 – 28131ANK 4Add
    BLAST
    Repeati286 – 31227ANK 5Add
    BLAST
    Repeati316 – 34530ANK 6Add
    BLAST
    Repeati349 – 37830ANK 7Add
    BLAST
    Domaini482 – 666185PatatinAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni678 – 69720Calmodulin-bindingBy similarityAdd
    BLAST
    Regioni749 – 76012Calmodulin-bindingBy similarityAdd
    BLAST

    Sequence similaritiesi

    Contains 7 ANK repeats.PROSITE-ProRule annotation
    Contains 1 patatin domain.Curated

    Keywords - Domaini

    ANK repeat, Repeat

    Phylogenomic databases

    eggNOGiCOG0666.
    GeneTreeiENSGT00530000063645.
    HOGENOMiHOG000013092.
    HOVERGENiHBG053482.
    KOiK16343.
    OMAiPTYFRPN.
    OrthoDBiEOG76T9QK.
    TreeFamiTF319230.

    Family and domain databases

    Gene3Di1.25.40.20. 2 hits.
    InterProiIPR016035. Acyl_Trfase/lysoPLipase.
    IPR002110. Ankyrin_rpt.
    IPR020683. Ankyrin_rpt-contain_dom.
    IPR002641. Patatin/PLipase_A2-rel.
    [Graphical view]
    PfamiPF00023. Ank. 1 hit.
    PF12796. Ank_2. 2 hits.
    PF01734. Patatin. 1 hit.
    [Graphical view]
    PRINTSiPR01415. ANKYRIN.
    SMARTiSM00248. ANK. 6 hits.
    [Graphical view]
    SUPFAMiSSF48403. SSF48403. 1 hit.
    SSF52151. SSF52151. 1 hit.
    PROSITEiPS50297. ANK_REP_REGION. 1 hit.
    PS50088. ANK_REPEAT. 4 hits.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform Long (identifier: P97819-1) [UniParc]FASTAAdd to Basket

    Also known as: iPLA2-L

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MQFFGRLVNT LSSVTNLFSN PFRVKEVSLT DYVSSERVRE EGQLILLQNV    50
    SNRTWDCVLV SPRNPQSGFR LFQLESEADA LVNFQQFSSQ LPPFYESSVQ 100
    VLHVEVLQHL TDLIRNHPSW TVTHLAVELG IRECFHHSRI ISCANSTENE 150
    EGCTPLHLAC RKGDSEILVE LVQYCHAQMD VTDNKGETAF HYAVQGDNPQ 200
    VLQLLGKNAS AGLNQVNNQG LTPLHLACKM GKQEMVRVLL LCNARCNIMG 250
    PGGFPIHTAM KFSQKGCAEM IISMDSNQIH SKDPRYGASP LHWAKNAEMA 300
    RMLLKRGCDV DSTSSSGNTA LHVAVMRNRF DCVMVLLTYG ANAGARGEHG 350
    NTPLHLAMSK DNMEMVKALI VFGAEVDTPN DFGETPALIA SKISKLITRK 400
    ALLTLLKTVG ADHHFPIIQG VSTEQGSAAA THPLFSLDRT QPPAISLNNL 450
    ELQDLMPISR ARKPAFILSS MRDEKRSHDH LLCLDGGGVK GLVIIQLLIA 500
    IEKASGVATK DLFDWVAGTS TGGILALAIL HSKSMAYMRG VYFRMKDEVF 550
    RGSRPYESGP LEEFLKREFG EHTKMTDVKK PKVMLTGTLS DRQPAELHLF 600
    RNYDAPEAVR EPRCNQNINL KPPTQPADQL VWRAARSSGA APTYFRPNGR 650
    FLDGGLLANN PTLDAMTEIH EYNQDMIRKG QGNKVKKLSI VVSLGTGKSP 700
    QVPVTCVDVF RPSNPWELAK TVFGAKELGK MVVDCCTDPD GRAVDRARAW 750
    CEMVGIQYFR LNPQLGSDIM LDEVSDAVLV NALWETEVYI YEHREEFQKL 800
    VQLLLSP 807
    Length:807
    Mass (Da):89,560
    Last modified:October 31, 2012 - v3
    Checksum:i3838889731100294
    GO
    Isoform Short (identifier: P97819-2) [UniParc]FASTAAdd to Basket

    Also known as: iPLA2-S

    The sequence of this isoform differs from the canonical sequence as follows:
         396-451: LITRKALLTLLKTVGADHHFPIIQGVSTEQGSAAATHPLFSLDRTQPPAISLNNLE → Q

    Show »
    Length:752
    Mass (Da):83,702
    Checksum:iAAC3347B0E1292E9
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei396 – 45156LITRK…LNNLE → Q in isoform Short. 2 PublicationsVSP_044364Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U88624 mRNA. Translation: AAB48511.2.
    AF259401 mRNA. Translation: AAF72651.1.
    BC003487 mRNA. Translation: AAH03487.1.
    BC057209 mRNA. Translation: AAH57209.1.
    CCDSiCCDS27637.1. [P97819-2]
    CCDS56991.1. [P97819-1]
    RefSeqiNP_001185952.1. NM_001199023.1. [P97819-1]
    NP_001185953.1. NM_001199024.1. [P97819-2]
    NP_001185954.1. NM_001199025.1. [P97819-2]
    NP_058611.1. NM_016915.4. [P97819-2]
    XP_006521215.1. XM_006521152.1. [P97819-1]
    XP_006521216.1. XM_006521153.1. [P97819-1]
    XP_006521217.1. XM_006521154.1. [P97819-1]
    XP_006521218.1. XM_006521155.1. [P97819-1]
    XP_006521219.1. XM_006521156.1. [P97819-1]
    XP_006521220.1. XM_006521157.1. [P97819-1]
    XP_006521221.1. XM_006521158.1. [P97819-1]
    XP_006521222.1. XM_006521159.1. [P97819-1]
    XP_006521223.1. XM_006521160.1. [P97819-1]
    UniGeneiMm.155620.

    Genome annotation databases

    EnsembliENSMUST00000047816; ENSMUSP00000044234; ENSMUSG00000042632. [P97819-2]
    ENSMUST00000166977; ENSMUSP00000132071; ENSMUSG00000042632. [P97819-2]
    ENSMUST00000172403; ENSMUSP00000131081; ENSMUSG00000042632. [P97819-2]
    ENSMUST00000173163; ENSMUSP00000134456; ENSMUSG00000042632. [P97819-2]
    ENSMUST00000174021; ENSMUSP00000134672; ENSMUSG00000042632. [P97819-1]
    GeneIDi53357.
    KEGGimmu:53357.
    UCSCiuc007wtd.2. mouse. [P97819-2]
    uc007wte.2. mouse. [P97819-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U88624 mRNA. Translation: AAB48511.2 .
    AF259401 mRNA. Translation: AAF72651.1 .
    BC003487 mRNA. Translation: AAH03487.1 .
    BC057209 mRNA. Translation: AAH57209.1 .
    CCDSi CCDS27637.1. [P97819-2 ]
    CCDS56991.1. [P97819-1 ]
    RefSeqi NP_001185952.1. NM_001199023.1. [P97819-1 ]
    NP_001185953.1. NM_001199024.1. [P97819-2 ]
    NP_001185954.1. NM_001199025.1. [P97819-2 ]
    NP_058611.1. NM_016915.4. [P97819-2 ]
    XP_006521215.1. XM_006521152.1. [P97819-1 ]
    XP_006521216.1. XM_006521153.1. [P97819-1 ]
    XP_006521217.1. XM_006521154.1. [P97819-1 ]
    XP_006521218.1. XM_006521155.1. [P97819-1 ]
    XP_006521219.1. XM_006521156.1. [P97819-1 ]
    XP_006521220.1. XM_006521157.1. [P97819-1 ]
    XP_006521221.1. XM_006521158.1. [P97819-1 ]
    XP_006521222.1. XM_006521159.1. [P97819-1 ]
    XP_006521223.1. XM_006521160.1. [P97819-1 ]
    UniGenei Mm.155620.

    3D structure databases

    ProteinModelPortali P97819.
    SMRi P97819. Positions 120-416.
    ModBasei Search...
    MobiDBi Search...

    PTM databases

    PhosphoSitei P97819.

    Proteomic databases

    PaxDbi P97819.
    PRIDEi P97819.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000047816 ; ENSMUSP00000044234 ; ENSMUSG00000042632 . [P97819-2 ]
    ENSMUST00000166977 ; ENSMUSP00000132071 ; ENSMUSG00000042632 . [P97819-2 ]
    ENSMUST00000172403 ; ENSMUSP00000131081 ; ENSMUSG00000042632 . [P97819-2 ]
    ENSMUST00000173163 ; ENSMUSP00000134456 ; ENSMUSG00000042632 . [P97819-2 ]
    ENSMUST00000174021 ; ENSMUSP00000134672 ; ENSMUSG00000042632 . [P97819-1 ]
    GeneIDi 53357.
    KEGGi mmu:53357.
    UCSCi uc007wtd.2. mouse. [P97819-2 ]
    uc007wte.2. mouse. [P97819-1 ]

    Organism-specific databases

    CTDi 8398.
    MGIi MGI:1859152. Pla2g6.

    Phylogenomic databases

    eggNOGi COG0666.
    GeneTreei ENSGT00530000063645.
    HOGENOMi HOG000013092.
    HOVERGENi HBG053482.
    KOi K16343.
    OMAi PTYFRPN.
    OrthoDBi EOG76T9QK.
    TreeFami TF319230.

    Enzyme and pathway databases

    Reactomei REACT_199027. Acyl chain remodelling of PE.
    REACT_199034. Acyl chain remodeling of CL.
    REACT_199038. Acyl chain remodelling of PC.
    REACT_210240. Role of phospholipids in phagocytosis.

    Miscellaneous databases

    NextBioi 310173.
    PROi P97819.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P97819.
    Bgeei P97819.
    CleanExi MM_PLA2G6.
    Genevestigatori P97819.

    Family and domain databases

    Gene3Di 1.25.40.20. 2 hits.
    InterProi IPR016035. Acyl_Trfase/lysoPLipase.
    IPR002110. Ankyrin_rpt.
    IPR020683. Ankyrin_rpt-contain_dom.
    IPR002641. Patatin/PLipase_A2-rel.
    [Graphical view ]
    Pfami PF00023. Ank. 1 hit.
    PF12796. Ank_2. 2 hits.
    PF01734. Patatin. 1 hit.
    [Graphical view ]
    PRINTSi PR01415. ANKYRIN.
    SMARTi SM00248. ANK. 6 hits.
    [Graphical view ]
    SUPFAMi SSF48403. SSF48403. 1 hit.
    SSF52151. SSF52151. 1 hit.
    PROSITEi PS50297. ANK_REP_REGION. 1 hit.
    PS50088. ANK_REPEAT. 4 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Identity between the Ca2+-independent phospholipase A2 enzymes from P388D1 macrophages and Chinese hamster ovary cells."
      Balboa M.A., Balsinde J., Jones S.S., Dennis E.A.
      J. Biol. Chem. 272:8576-8580(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SHORT).
      Strain: DBA/2.
    2. Balboa M.A., Balsinde J., Jones S.S., Dennis E.A.
      Submitted (FEB-2000) to the EMBL/GenBank/DDBJ databases
      Cited for: SEQUENCE REVISION TO 2-3; 9; 11 AND 211.
    3. "Role of calcium-independent phospholipases (iPLA(2)) in phosphatidylcholine metabolism."
      Chiu C.-H., Jackowski S.
      Biochem. Biophys. Res. Commun. 287:600-606(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM LONG), ALTERNATIVE SPLICING, SUBCELLULAR LOCATION.
      Strain: NIH Swiss.
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS LONG AND SHORT).
      Strain: C57BL/6J, FVB/N and NMRI.
      Tissue: Mammary tumor.
    5. Lubec G., Sunyer B., Chen W.-Q.
      Submitted (JAN-2009) to UniProtKB
      Cited for: PROTEIN SEQUENCE OF 479-491, IDENTIFICATION BY MASS SPECTROMETRY.
      Strain: OF1.
      Tissue: Hippocampus.

    Entry informationi

    Entry nameiPLPL9_MOUSE
    AccessioniPrimary (citable) accession number: P97819
    Secondary accession number(s): Q99LA9, Q9JK61
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 30, 2000
    Last sequence update: October 31, 2012
    Last modified: October 1, 2014
    This is version 120 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3