Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

85/88 kDa calcium-independent phospholipase A2

Gene

Pla2g6

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Catalyzes the release of fatty acids from phospholipids. It has been implicated in normal phospholipid remodeling, nitric oxide-induced or vasopressin-induced arachidonic acid release and in leukotriene and prostaglandin production. May participate in fas mediated apoptosis and in regulating transmembrane ion flux in glucose-stimulated B-cells. Has a role in cardiolipin (CL) deacylation. Required for both speed and directionality of monocyte MCP1/CCL2-induced chemotaxis through regulation of F-actin polymerization at the pseudopods (By similarity).By similarity

Catalytic activityi

Phosphatidylcholine + H2O = 1-acylglycerophosphocholine + a carboxylate.

Enzyme regulationi

Inhibited by calcium-activated calmodulin.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei520NucleophilePROSITE-ProRule annotation1
Active sitei653Proton acceptorPROSITE-ProRule annotation1

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Biological processi

Chemotaxis, Lipid degradation, Lipid metabolism

Keywords - Ligandi

Calmodulin-binding

Enzyme and pathway databases

ReactomeiR-MMU-1482788. Acyl chain remodelling of PC.
R-MMU-1482839. Acyl chain remodelling of PE.
R-MMU-2029485. Role of phospholipids in phagocytosis.
R-MMU-6811436. COPI-independent Golgi-to-ER retrograde traffic.

Names & Taxonomyi

Protein namesi
Recommended name:
85/88 kDa calcium-independent phospholipase A2 (EC:3.1.1.4)
Short name:
CaI-PLA2
Alternative name(s):
Group VI phospholipase A2
Short name:
GVI PLA2
Intracellular membrane-associated calcium-independent phospholipase A2 beta
Short name:
iPLA2-beta
Patatin-like phospholipase domain-containing protein 9
Short name:
PNPLA9
Gene namesi
Name:Pla2g6
Synonyms:Pnpla9
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 15

Organism-specific databases

MGIiMGI:1859152. Pla2g6.

Subcellular locationi

Isoform Long :

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Membrane

Pathology & Biotechi

Chemistry databases

ChEMBLiCHEMBL3259503.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000670381 – 80785/88 kDa calcium-independent phospholipase A2Add BLAST807

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei13PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiP97819.
PaxDbiP97819.
PeptideAtlasiP97819.
PRIDEiP97819.

PTM databases

iPTMnetiP97819.
PhosphoSitePlusiP97819.

Expressioni

Gene expression databases

BgeeiENSMUSG00000042632.
CleanExiMM_PLA2G6.
ExpressionAtlasiP97819. baseline and differential.
GenevisibleiP97819. MM.

Interactioni

Protein-protein interaction databases

IntActiP97819. 3 interactors.
STRINGi10090.ENSMUSP00000134672.

Structurei

3D structure databases

ProteinModelPortaliP97819.
SMRiP97819.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati151 – 181ANK 1Add BLAST31
Repeati185 – 215ANK 2Add BLAST31
Repeati219 – 248ANK 3Add BLAST30
Repeati251 – 281ANK 4Add BLAST31
Repeati286 – 312ANK 5Add BLAST27
Repeati316 – 345ANK 6Add BLAST30
Repeati349 – 378ANK 7Add BLAST30
Domaini482 – 666PNPLAPROSITE-ProRule annotationAdd BLAST185

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni678 – 697Calmodulin-bindingBy similarityAdd BLAST20
Regioni749 – 760Calmodulin-bindingBy similarityAdd BLAST12

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi486 – 491GXGXXGPROSITE-ProRule annotation6
Motifi518 – 522GXSXGPROSITE-ProRule annotation5
Motifi653 – 655DGA/GPROSITE-ProRule annotation3

Sequence similaritiesi

Contains 7 ANK repeats.PROSITE-ProRule annotation
Contains 1 PNPLA (patatin-like phospholipase) domain.PROSITE-ProRule annotation

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

eggNOGiKOG0513. Eukaryota.
COG0666. LUCA.
COG3621. LUCA.
GeneTreeiENSGT00530000063645.
HOGENOMiHOG000013092.
HOVERGENiHBG053482.
InParanoidiP97819.
KOiK16343.
OMAiIFRTHEI.
OrthoDBiEOG091G042U.
TreeFamiTF319230.

Family and domain databases

Gene3Di1.25.40.20. 2 hits.
InterProiIPR016035. Acyl_Trfase/lysoPLipase.
IPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR002641. Patatin/PLipase_A2-rel.
[Graphical view]
PfamiPF12796. Ank_2. 2 hits.
PF13606. Ank_3. 1 hit.
PF01734. Patatin. 1 hit.
[Graphical view]
PRINTSiPR01415. ANKYRIN.
SMARTiSM00248. ANK. 6 hits.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 1 hit.
SSF52151. SSF52151. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 4 hits.
PS51635. PNPLA. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform Long (identifier: P97819-1) [UniParc]FASTAAdd to basket
Also known as: iPLA2-L

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQFFGRLVNT LSSVTNLFSN PFRVKEVSLT DYVSSERVRE EGQLILLQNV
60 70 80 90 100
SNRTWDCVLV SPRNPQSGFR LFQLESEADA LVNFQQFSSQ LPPFYESSVQ
110 120 130 140 150
VLHVEVLQHL TDLIRNHPSW TVTHLAVELG IRECFHHSRI ISCANSTENE
160 170 180 190 200
EGCTPLHLAC RKGDSEILVE LVQYCHAQMD VTDNKGETAF HYAVQGDNPQ
210 220 230 240 250
VLQLLGKNAS AGLNQVNNQG LTPLHLACKM GKQEMVRVLL LCNARCNIMG
260 270 280 290 300
PGGFPIHTAM KFSQKGCAEM IISMDSNQIH SKDPRYGASP LHWAKNAEMA
310 320 330 340 350
RMLLKRGCDV DSTSSSGNTA LHVAVMRNRF DCVMVLLTYG ANAGARGEHG
360 370 380 390 400
NTPLHLAMSK DNMEMVKALI VFGAEVDTPN DFGETPALIA SKISKLITRK
410 420 430 440 450
ALLTLLKTVG ADHHFPIIQG VSTEQGSAAA THPLFSLDRT QPPAISLNNL
460 470 480 490 500
ELQDLMPISR ARKPAFILSS MRDEKRSHDH LLCLDGGGVK GLVIIQLLIA
510 520 530 540 550
IEKASGVATK DLFDWVAGTS TGGILALAIL HSKSMAYMRG VYFRMKDEVF
560 570 580 590 600
RGSRPYESGP LEEFLKREFG EHTKMTDVKK PKVMLTGTLS DRQPAELHLF
610 620 630 640 650
RNYDAPEAVR EPRCNQNINL KPPTQPADQL VWRAARSSGA APTYFRPNGR
660 670 680 690 700
FLDGGLLANN PTLDAMTEIH EYNQDMIRKG QGNKVKKLSI VVSLGTGKSP
710 720 730 740 750
QVPVTCVDVF RPSNPWELAK TVFGAKELGK MVVDCCTDPD GRAVDRARAW
760 770 780 790 800
CEMVGIQYFR LNPQLGSDIM LDEVSDAVLV NALWETEVYI YEHREEFQKL

VQLLLSP
Length:807
Mass (Da):89,560
Last modified:October 31, 2012 - v3
Checksum:i3838889731100294
GO
Isoform Short (identifier: P97819-2) [UniParc]FASTAAdd to basket
Also known as: iPLA2-S

The sequence of this isoform differs from the canonical sequence as follows:
     396-451: LITRKALLTLLKTVGADHHFPIIQGVSTEQGSAAATHPLFSLDRTQPPAISLNNLE → Q

Show »
Length:752
Mass (Da):83,702
Checksum:iAAC3347B0E1292E9
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_044364396 – 451LITRK…LNNLE → Q in isoform Short. 2 PublicationsAdd BLAST56

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U88624 mRNA. Translation: AAB48511.2.
AF259401 mRNA. Translation: AAF72651.1.
BC003487 mRNA. Translation: AAH03487.1.
BC057209 mRNA. Translation: AAH57209.1.
CCDSiCCDS27637.1. [P97819-2]
CCDS56991.1. [P97819-1]
RefSeqiNP_001185952.1. NM_001199023.1. [P97819-1]
NP_001185953.1. NM_001199024.1. [P97819-2]
NP_001185954.1. NM_001199025.1. [P97819-2]
NP_058611.1. NM_016915.4. [P97819-2]
XP_006521215.1. XM_006521152.2. [P97819-1]
XP_006521216.1. XM_006521153.3. [P97819-1]
XP_006521217.1. XM_006521154.1. [P97819-1]
XP_006521218.1. XM_006521155.2. [P97819-1]
XP_006521219.1. XM_006521156.3. [P97819-1]
XP_006521220.1. XM_006521157.3. [P97819-1]
XP_006521221.1. XM_006521158.2. [P97819-1]
XP_006521222.1. XM_006521159.3. [P97819-1]
XP_006521223.1. XM_006521160.2. [P97819-1]
XP_017172187.1. XM_017316698.1. [P97819-2]
UniGeneiMm.155620.

Genome annotation databases

EnsembliENSMUST00000047816; ENSMUSP00000044234; ENSMUSG00000042632. [P97819-2]
ENSMUST00000166977; ENSMUSP00000132071; ENSMUSG00000042632. [P97819-2]
ENSMUST00000172403; ENSMUSP00000131081; ENSMUSG00000042632. [P97819-2]
ENSMUST00000173163; ENSMUSP00000134456; ENSMUSG00000042632. [P97819-2]
ENSMUST00000174021; ENSMUSP00000134672; ENSMUSG00000042632. [P97819-1]
GeneIDi53357.
KEGGimmu:53357.
UCSCiuc007wtd.2. mouse. [P97819-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U88624 mRNA. Translation: AAB48511.2.
AF259401 mRNA. Translation: AAF72651.1.
BC003487 mRNA. Translation: AAH03487.1.
BC057209 mRNA. Translation: AAH57209.1.
CCDSiCCDS27637.1. [P97819-2]
CCDS56991.1. [P97819-1]
RefSeqiNP_001185952.1. NM_001199023.1. [P97819-1]
NP_001185953.1. NM_001199024.1. [P97819-2]
NP_001185954.1. NM_001199025.1. [P97819-2]
NP_058611.1. NM_016915.4. [P97819-2]
XP_006521215.1. XM_006521152.2. [P97819-1]
XP_006521216.1. XM_006521153.3. [P97819-1]
XP_006521217.1. XM_006521154.1. [P97819-1]
XP_006521218.1. XM_006521155.2. [P97819-1]
XP_006521219.1. XM_006521156.3. [P97819-1]
XP_006521220.1. XM_006521157.3. [P97819-1]
XP_006521221.1. XM_006521158.2. [P97819-1]
XP_006521222.1. XM_006521159.3. [P97819-1]
XP_006521223.1. XM_006521160.2. [P97819-1]
XP_017172187.1. XM_017316698.1. [P97819-2]
UniGeneiMm.155620.

3D structure databases

ProteinModelPortaliP97819.
SMRiP97819.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiP97819. 3 interactors.
STRINGi10090.ENSMUSP00000134672.

Chemistry databases

ChEMBLiCHEMBL3259503.

PTM databases

iPTMnetiP97819.
PhosphoSitePlusiP97819.

Proteomic databases

MaxQBiP97819.
PaxDbiP97819.
PeptideAtlasiP97819.
PRIDEiP97819.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000047816; ENSMUSP00000044234; ENSMUSG00000042632. [P97819-2]
ENSMUST00000166977; ENSMUSP00000132071; ENSMUSG00000042632. [P97819-2]
ENSMUST00000172403; ENSMUSP00000131081; ENSMUSG00000042632. [P97819-2]
ENSMUST00000173163; ENSMUSP00000134456; ENSMUSG00000042632. [P97819-2]
ENSMUST00000174021; ENSMUSP00000134672; ENSMUSG00000042632. [P97819-1]
GeneIDi53357.
KEGGimmu:53357.
UCSCiuc007wtd.2. mouse. [P97819-1]

Organism-specific databases

CTDi8398.
MGIiMGI:1859152. Pla2g6.

Phylogenomic databases

eggNOGiKOG0513. Eukaryota.
COG0666. LUCA.
COG3621. LUCA.
GeneTreeiENSGT00530000063645.
HOGENOMiHOG000013092.
HOVERGENiHBG053482.
InParanoidiP97819.
KOiK16343.
OMAiIFRTHEI.
OrthoDBiEOG091G042U.
TreeFamiTF319230.

Enzyme and pathway databases

ReactomeiR-MMU-1482788. Acyl chain remodelling of PC.
R-MMU-1482839. Acyl chain remodelling of PE.
R-MMU-2029485. Role of phospholipids in phagocytosis.
R-MMU-6811436. COPI-independent Golgi-to-ER retrograde traffic.

Miscellaneous databases

PROiP97819.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000042632.
CleanExiMM_PLA2G6.
ExpressionAtlasiP97819. baseline and differential.
GenevisibleiP97819. MM.

Family and domain databases

Gene3Di1.25.40.20. 2 hits.
InterProiIPR016035. Acyl_Trfase/lysoPLipase.
IPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR002641. Patatin/PLipase_A2-rel.
[Graphical view]
PfamiPF12796. Ank_2. 2 hits.
PF13606. Ank_3. 1 hit.
PF01734. Patatin. 1 hit.
[Graphical view]
PRINTSiPR01415. ANKYRIN.
SMARTiSM00248. ANK. 6 hits.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 1 hit.
SSF52151. SSF52151. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 4 hits.
PS51635. PNPLA. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPLPL9_MOUSE
AccessioniPrimary (citable) accession number: P97819
Secondary accession number(s): Q99LA9, Q9JK61
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: October 31, 2012
Last modified: November 30, 2016
This is version 144 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.