Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P97819

- PLPL9_MOUSE

UniProt

P97819 - PLPL9_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

85/88 kDa calcium-independent phospholipase A2

Gene

Pla2g6

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Catalyzes the release of fatty acids from phospholipids. It has been implicated in normal phospholipid remodeling, nitric oxide-induced or vasopressin-induced arachidonic acid release and in leukotriene and prostaglandin production. May participate in fas mediated apoptosis and in regulating transmembrane ion flux in glucose-stimulated B-cells. Has a role in cardiolipin (CL) deacylation. Required for both speed and directionality of monocyte MCP1/CCL2-induced chemotaxis through regulation of F-actin polymerization at the pseudopods By similarity.By similarity

Catalytic activityi

Phosphatidylcholine + H2O = 1-acylglycerophosphocholine + a carboxylate.

Enzyme regulationi

Inhibited by calcium-activated calmodulin.By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei520 – 5201Sequence Analysis

GO - Molecular functioni

  1. calcium-independent phospholipase A2 activity Source: Ensembl

GO - Biological processi

  1. cardiolipin biosynthetic process Source: Ensembl
  2. chemotaxis Source: UniProtKB-KW
  3. lipid catabolic process Source: UniProtKB-KW
  4. maternal process involved in female pregnancy Source: Ensembl
  5. memory Source: Ensembl
  6. negative regulation of synaptic transmission, glutamatergic Source: Ensembl
  7. positive regulation of arachidonic acid secretion Source: Ensembl
  8. positive regulation of ceramide biosynthetic process Source: Ensembl
  9. positive regulation of cytosolic calcium ion concentration Source: Ensembl
  10. positive regulation of exocytosis Source: Ensembl
  11. positive regulation of insulin secretion involved in cellular response to glucose stimulus Source: Ensembl
  12. positive regulation of protein kinase C signaling Source: Ensembl
  13. positive regulation of protein phosphorylation Source: Ensembl
  14. positive regulation of release of cytochrome c from mitochondria Source: Ensembl
  15. positive regulation of vasodilation Source: Ensembl
  16. regulation of store-operated calcium channel activity Source: Ensembl
  17. response to endoplasmic reticulum stress Source: Ensembl
  18. urinary bladder smooth muscle contraction Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Biological processi

Chemotaxis, Lipid degradation, Lipid metabolism

Keywords - Ligandi

Calmodulin-binding

Enzyme and pathway databases

ReactomeiREACT_199027. Acyl chain remodelling of PE.
REACT_199034. Acyl chain remodeling of CL.
REACT_199038. Acyl chain remodelling of PC.
REACT_210240. Role of phospholipids in phagocytosis.

Names & Taxonomyi

Protein namesi
Recommended name:
85/88 kDa calcium-independent phospholipase A2 (EC:3.1.1.4)
Short name:
CaI-PLA2
Alternative name(s):
Group VI phospholipase A2
Short name:
GVI PLA2
Intracellular membrane-associated calcium-independent phospholipase A2 beta
Short name:
iPLA2-beta
Patatin-like phospholipase domain-containing protein 9
Short name:
PNPLA9
Gene namesi
Name:Pla2g6
Synonyms:Pnpla9
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 15

Organism-specific databases

MGIiMGI:1859152. Pla2g6.

Subcellular locationi

Isoform Long : Membrane; Peripheral membrane protein
Note: Recruited to the membrane-enriched pseudopod upon MCP1/CCL2 stimulation in monocytes.By similarity

GO - Cellular componenti

  1. cytosol Source: Ensembl
  2. membrane Source: UniProtKB-KW
  3. mitochondrion Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 80780785/88 kDa calcium-independent phospholipase A2PRO_0000067038Add
BLAST

Proteomic databases

PaxDbiP97819.
PRIDEiP97819.

PTM databases

PhosphoSiteiP97819.

Expressioni

Gene expression databases

BgeeiP97819.
CleanExiMM_PLA2G6.
ExpressionAtlasiP97819. baseline and differential.
GenevestigatoriP97819.

Structurei

3D structure databases

ProteinModelPortaliP97819.
SMRiP97819. Positions 115-436.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati151 – 18131ANK 1Add
BLAST
Repeati185 – 21531ANK 2Add
BLAST
Repeati219 – 24830ANK 3Add
BLAST
Repeati251 – 28131ANK 4Add
BLAST
Repeati286 – 31227ANK 5Add
BLAST
Repeati316 – 34530ANK 6Add
BLAST
Repeati349 – 37830ANK 7Add
BLAST
Domaini482 – 666185PatatinAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni678 – 69720Calmodulin-bindingBy similarityAdd
BLAST
Regioni749 – 76012Calmodulin-bindingBy similarityAdd
BLAST

Sequence similaritiesi

Contains 7 ANK repeats.PROSITE-ProRule annotation
Contains 1 patatin domain.Curated

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

eggNOGiCOG0666.
GeneTreeiENSGT00530000063645.
HOGENOMiHOG000013092.
HOVERGENiHBG053482.
InParanoidiP97819.
KOiK16343.
OMAiPTYFRPN.
OrthoDBiEOG76T9QK.
TreeFamiTF319230.

Family and domain databases

Gene3Di1.25.40.20. 2 hits.
InterProiIPR016035. Acyl_Trfase/lysoPLipase.
IPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR002641. Patatin/PLipase_A2-rel.
[Graphical view]
PfamiPF00023. Ank. 1 hit.
PF12796. Ank_2. 2 hits.
PF01734. Patatin. 1 hit.
[Graphical view]
PRINTSiPR01415. ANKYRIN.
SMARTiSM00248. ANK. 6 hits.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 1 hit.
SSF52151. SSF52151. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 4 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform Long (identifier: P97819-1) [UniParc]FASTAAdd to Basket

Also known as: iPLA2-L

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQFFGRLVNT LSSVTNLFSN PFRVKEVSLT DYVSSERVRE EGQLILLQNV
60 70 80 90 100
SNRTWDCVLV SPRNPQSGFR LFQLESEADA LVNFQQFSSQ LPPFYESSVQ
110 120 130 140 150
VLHVEVLQHL TDLIRNHPSW TVTHLAVELG IRECFHHSRI ISCANSTENE
160 170 180 190 200
EGCTPLHLAC RKGDSEILVE LVQYCHAQMD VTDNKGETAF HYAVQGDNPQ
210 220 230 240 250
VLQLLGKNAS AGLNQVNNQG LTPLHLACKM GKQEMVRVLL LCNARCNIMG
260 270 280 290 300
PGGFPIHTAM KFSQKGCAEM IISMDSNQIH SKDPRYGASP LHWAKNAEMA
310 320 330 340 350
RMLLKRGCDV DSTSSSGNTA LHVAVMRNRF DCVMVLLTYG ANAGARGEHG
360 370 380 390 400
NTPLHLAMSK DNMEMVKALI VFGAEVDTPN DFGETPALIA SKISKLITRK
410 420 430 440 450
ALLTLLKTVG ADHHFPIIQG VSTEQGSAAA THPLFSLDRT QPPAISLNNL
460 470 480 490 500
ELQDLMPISR ARKPAFILSS MRDEKRSHDH LLCLDGGGVK GLVIIQLLIA
510 520 530 540 550
IEKASGVATK DLFDWVAGTS TGGILALAIL HSKSMAYMRG VYFRMKDEVF
560 570 580 590 600
RGSRPYESGP LEEFLKREFG EHTKMTDVKK PKVMLTGTLS DRQPAELHLF
610 620 630 640 650
RNYDAPEAVR EPRCNQNINL KPPTQPADQL VWRAARSSGA APTYFRPNGR
660 670 680 690 700
FLDGGLLANN PTLDAMTEIH EYNQDMIRKG QGNKVKKLSI VVSLGTGKSP
710 720 730 740 750
QVPVTCVDVF RPSNPWELAK TVFGAKELGK MVVDCCTDPD GRAVDRARAW
760 770 780 790 800
CEMVGIQYFR LNPQLGSDIM LDEVSDAVLV NALWETEVYI YEHREEFQKL

VQLLLSP
Length:807
Mass (Da):89,560
Last modified:October 31, 2012 - v3
Checksum:i3838889731100294
GO
Isoform Short (identifier: P97819-2) [UniParc]FASTAAdd to Basket

Also known as: iPLA2-S

The sequence of this isoform differs from the canonical sequence as follows:
     396-451: LITRKALLTLLKTVGADHHFPIIQGVSTEQGSAAATHPLFSLDRTQPPAISLNNLE → Q

Show »
Length:752
Mass (Da):83,702
Checksum:iAAC3347B0E1292E9
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei396 – 45156LITRK…LNNLE → Q in isoform Short. 2 PublicationsVSP_044364Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U88624 mRNA. Translation: AAB48511.2.
AF259401 mRNA. Translation: AAF72651.1.
BC003487 mRNA. Translation: AAH03487.1.
BC057209 mRNA. Translation: AAH57209.1.
CCDSiCCDS27637.1. [P97819-2]
CCDS56991.1. [P97819-1]
RefSeqiNP_001185952.1. NM_001199023.1. [P97819-1]
NP_001185953.1. NM_001199024.1. [P97819-2]
NP_001185954.1. NM_001199025.1. [P97819-2]
NP_058611.1. NM_016915.4. [P97819-2]
XP_006521215.1. XM_006521152.1. [P97819-1]
XP_006521216.1. XM_006521153.1. [P97819-1]
XP_006521217.1. XM_006521154.1. [P97819-1]
XP_006521218.1. XM_006521155.1. [P97819-1]
XP_006521219.1. XM_006521156.1. [P97819-1]
XP_006521220.1. XM_006521157.1. [P97819-1]
XP_006521221.1. XM_006521158.1. [P97819-1]
XP_006521222.1. XM_006521159.1. [P97819-1]
XP_006521223.1. XM_006521160.1. [P97819-1]
UniGeneiMm.155620.

Genome annotation databases

EnsembliENSMUST00000047816; ENSMUSP00000044234; ENSMUSG00000042632. [P97819-2]
ENSMUST00000166977; ENSMUSP00000132071; ENSMUSG00000042632. [P97819-2]
ENSMUST00000172403; ENSMUSP00000131081; ENSMUSG00000042632. [P97819-2]
ENSMUST00000173163; ENSMUSP00000134456; ENSMUSG00000042632. [P97819-2]
ENSMUST00000174021; ENSMUSP00000134672; ENSMUSG00000042632. [P97819-1]
GeneIDi53357.
KEGGimmu:53357.
UCSCiuc007wtd.2. mouse. [P97819-2]
uc007wte.2. mouse. [P97819-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U88624 mRNA. Translation: AAB48511.2 .
AF259401 mRNA. Translation: AAF72651.1 .
BC003487 mRNA. Translation: AAH03487.1 .
BC057209 mRNA. Translation: AAH57209.1 .
CCDSi CCDS27637.1. [P97819-2 ]
CCDS56991.1. [P97819-1 ]
RefSeqi NP_001185952.1. NM_001199023.1. [P97819-1 ]
NP_001185953.1. NM_001199024.1. [P97819-2 ]
NP_001185954.1. NM_001199025.1. [P97819-2 ]
NP_058611.1. NM_016915.4. [P97819-2 ]
XP_006521215.1. XM_006521152.1. [P97819-1 ]
XP_006521216.1. XM_006521153.1. [P97819-1 ]
XP_006521217.1. XM_006521154.1. [P97819-1 ]
XP_006521218.1. XM_006521155.1. [P97819-1 ]
XP_006521219.1. XM_006521156.1. [P97819-1 ]
XP_006521220.1. XM_006521157.1. [P97819-1 ]
XP_006521221.1. XM_006521158.1. [P97819-1 ]
XP_006521222.1. XM_006521159.1. [P97819-1 ]
XP_006521223.1. XM_006521160.1. [P97819-1 ]
UniGenei Mm.155620.

3D structure databases

ProteinModelPortali P97819.
SMRi P97819. Positions 115-436.
ModBasei Search...
MobiDBi Search...

PTM databases

PhosphoSitei P97819.

Proteomic databases

PaxDbi P97819.
PRIDEi P97819.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000047816 ; ENSMUSP00000044234 ; ENSMUSG00000042632 . [P97819-2 ]
ENSMUST00000166977 ; ENSMUSP00000132071 ; ENSMUSG00000042632 . [P97819-2 ]
ENSMUST00000172403 ; ENSMUSP00000131081 ; ENSMUSG00000042632 . [P97819-2 ]
ENSMUST00000173163 ; ENSMUSP00000134456 ; ENSMUSG00000042632 . [P97819-2 ]
ENSMUST00000174021 ; ENSMUSP00000134672 ; ENSMUSG00000042632 . [P97819-1 ]
GeneIDi 53357.
KEGGi mmu:53357.
UCSCi uc007wtd.2. mouse. [P97819-2 ]
uc007wte.2. mouse. [P97819-1 ]

Organism-specific databases

CTDi 8398.
MGIi MGI:1859152. Pla2g6.

Phylogenomic databases

eggNOGi COG0666.
GeneTreei ENSGT00530000063645.
HOGENOMi HOG000013092.
HOVERGENi HBG053482.
InParanoidi P97819.
KOi K16343.
OMAi PTYFRPN.
OrthoDBi EOG76T9QK.
TreeFami TF319230.

Enzyme and pathway databases

Reactomei REACT_199027. Acyl chain remodelling of PE.
REACT_199034. Acyl chain remodeling of CL.
REACT_199038. Acyl chain remodelling of PC.
REACT_210240. Role of phospholipids in phagocytosis.

Miscellaneous databases

NextBioi 310173.
PROi P97819.
SOURCEi Search...

Gene expression databases

Bgeei P97819.
CleanExi MM_PLA2G6.
ExpressionAtlasi P97819. baseline and differential.
Genevestigatori P97819.

Family and domain databases

Gene3Di 1.25.40.20. 2 hits.
InterProi IPR016035. Acyl_Trfase/lysoPLipase.
IPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR002641. Patatin/PLipase_A2-rel.
[Graphical view ]
Pfami PF00023. Ank. 1 hit.
PF12796. Ank_2. 2 hits.
PF01734. Patatin. 1 hit.
[Graphical view ]
PRINTSi PR01415. ANKYRIN.
SMARTi SM00248. ANK. 6 hits.
[Graphical view ]
SUPFAMi SSF48403. SSF48403. 1 hit.
SSF52151. SSF52151. 1 hit.
PROSITEi PS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 4 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identity between the Ca2+-independent phospholipase A2 enzymes from P388D1 macrophages and Chinese hamster ovary cells."
    Balboa M.A., Balsinde J., Jones S.S., Dennis E.A.
    J. Biol. Chem. 272:8576-8580(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SHORT).
    Strain: DBA/2.
  2. Balboa M.A., Balsinde J., Jones S.S., Dennis E.A.
    Submitted (FEB-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: SEQUENCE REVISION TO 2-3; 9; 11 AND 211.
  3. "Role of calcium-independent phospholipases (iPLA(2)) in phosphatidylcholine metabolism."
    Chiu C.-H., Jackowski S.
    Biochem. Biophys. Res. Commun. 287:600-606(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM LONG), ALTERNATIVE SPLICING, SUBCELLULAR LOCATION.
    Strain: NIH Swiss.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS LONG AND SHORT).
    Strain: C57BL/6J, FVB/N and NMRI.
    Tissue: Mammary tumor.
  5. Lubec G., Sunyer B., Chen W.-Q.
    Submitted (JAN-2009) to UniProtKB
    Cited for: PROTEIN SEQUENCE OF 479-491, IDENTIFICATION BY MASS SPECTROMETRY.
    Strain: OF1.
    Tissue: Hippocampus.

Entry informationi

Entry nameiPLPL9_MOUSE
AccessioniPrimary (citable) accession number: P97819
Secondary accession number(s): Q99LA9, Q9JK61
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: October 31, 2012
Last modified: October 29, 2014
This is version 121 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3