Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P97689

- UT1_RAT

UniProt

P97689 - UT1_RAT

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Urea transporter 1

Gene

Slc14a1

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli

Functioni

Urea channel that facilitates transmembrane urea transport down a concentration gradient. A constriction of the transmembrane channel functions as selectivity filter through which urea is expected to pass in dehydrated form. The rate of urea conduction is increased by hypotonic stress. Plays an important role in the kidney medulla collecting ducts, where it allows rapid equilibration between the lumen of the collecting ducts and the interstitium, and thereby prevents water loss driven by the high concentration of urea in the urine. Facilitates urea transport across erythrocyte membranes. May also play a role in transmembrane water transport, possibly by indirect means.1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei334 – 3341Important for channel permeabilityBy similarity

GO - Molecular functioni

  1. urea channel activity Source: UniProtKB
  2. urea transmembrane transporter activity Source: RGD
  3. water transmembrane transporter activity Source: Ensembl

GO - Biological processi

  1. urea transmembrane transport Source: UniProtKB
  2. urea transport Source: RGD
Complete GO annotation...

Keywords - Biological processi

Transport

Protein family/group databases

TCDBi1.A.28.1.3. the urea transporter (ut) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Urea transporter 1
Alternative name(s):
Solute carrier family 14 member 1
Urea transporter B
Short name:
UT-B
Urea transporter, erythrocyte
Gene namesi
Name:Slc14a1
Synonyms:UT11, UT3
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
ProteomesiUP000002494: Unplaced

Organism-specific databases

RGDi3688. Slc14a1.

Subcellular locationi

Cell membrane 1 Publication; Multi-pass membrane protein 1 Publication. Basolateral cell membrane By similarity; Multi-pass membrane protein By similarity
Note: Restricted to the basolateral membrane in various portions of the urothelium.By similarity

GO - Cellular componenti

  1. integral component of plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 384384Urea transporter 1PRO_0000410964Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi206 – 2061N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

PRIDEiP97689.

Expressioni

Tissue specificityi

Expressed in brain, spleen, kidney, testis and lung, with highest levels in brain.1 Publication

Gene expression databases

ExpressionAtlasiP97689. baseline and differential.
GenevestigatoriP97689.

Interactioni

Subunit structurei

Homotrimer; each subunit contains a pore through which urea permeates. Identified in a complex with STOM (By similarity).By similarity

Protein-protein interaction databases

BioGridi248521. 1 interaction.
STRINGi10116.ENSRNOP00000022598.

Structurei

Intramembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Intramembranei47 – 6418HelicalBy similarityAdd
BLAST
Intramembranei68 – 8316HelicalBy similarityAdd
BLAST
Intramembranei215 – 22915HelicalBy similarityAdd
BLAST
Intramembranei234 – 24512HelicalBy similarityAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei86 – 10520HelicalBy similarityAdd
BLAST
Transmembranei110 – 13223HelicalBy similarityAdd
BLAST
Transmembranei139 – 16325HelicalBy similarityAdd
BLAST
Transmembranei168 – 18821HelicalBy similarityAdd
BLAST
Transmembranei250 – 26920HelicalBy similarityAdd
BLAST
Transmembranei279 – 29921HelicalBy similarityAdd
BLAST
Transmembranei304 – 32522HelicalBy similarityAdd
BLAST
Transmembranei328 – 34821HelicalBy similarityAdd
BLAST

Family & Domainsi

Sequence similaritiesi

Belongs to the urea transporter family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG4413.
HOGENOMiHOG000065705.
HOVERGENiHBG000540.
InParanoidiP97689.
KOiK08716.

Family and domain databases

Gene3Di1.10.3430.10. 1 hit.
InterProiIPR029020. Ammonium/urea_transptr.
IPR004937. Urea_transporter.
[Graphical view]
PANTHERiPTHR10464. PTHR10464. 1 hit.
PfamiPF03253. UT. 1 hit.
[Graphical view]
PIRSFiPIRSF016502. Urea_transporter. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P97689-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEDIPTMVKV DRGESQILSC RGRRCGLKVL GYVTGDMKEF ANWLKDKPVV
60 70 80 90 100
LQFMDWILRG ISQVVFVSNP ISGILILAGL LVQNPWWALC GCVGTVVSTL
110 120 130 140 150
TALLLSQDRS AIAAGLQGYN ATLVGILMAV FSDKGDYFWW LIFPVSAMSM
160 170 180 190 200
TCPVFSSALS SLFSKWDLPV FTLPFNMALS LYLSATGHYN TFFPSKLFMP
210 220 230 240 250
VSSVPNITWS ELSALELLKS LPVGVGQIYG CDNPWTGAIF LCAILLSSPL
260 270 280 290 300
MCLHAAIGSL LGVIAGLSLA APFKDIYSGL WGFNSSLACI AIGGMFMALT
310 320 330 340 350
WQTHLLALAC ALFTAYFGAC MTHLMAAVHL PACTWSFCLA TLLFLLLTTE
360 370 380
NPNIYRMPLS KVTYSEENRI FYLQNKKRVV DSPL
Length:384
Mass (Da):42,034
Last modified:June 28, 2011 - v2
Checksum:i1BBD9E8D60CFD6CA
GO
Isoform 2 (identifier: P97689-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MNGQSLSGGTDDSHHDPLWIDPFGNRAGKAAPGGFRRLNLFLAQRWQEQEPEEEMA

Note: Gene prediction based on similarity to human and mouse orthologs.

Show »
Length:439
Mass (Da):48,151
Checksum:iEE827720447E21C1
GO

Sequence cautioni

The sequence CAA67049.1 differs from that shown. Reason:

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti25 – 251C → W in AAB39937. 1 PublicationCurated
Sequence conflicti47 – 471K → E in AAB39937. 1 PublicationCurated
Sequence conflicti50 – 501V → G in AAB39937. 1 PublicationCurated
Sequence conflicti180 – 1801S → A in AAB39937. 1 PublicationCurated
Sequence conflicti266 – 2661G → R in AAB39937. 1 PublicationCurated
Sequence conflicti325 – 3251M → I in AAB39937. 1 PublicationCurated
Sequence conflicti339 – 3391L → F in AAB39937. 1 PublicationCurated
Sequence conflicti378 – 3792RV → SA in AAB39937. 1 PublicationCurated
Sequence conflicti382 – 3821S → R in AAB39937. 1 PublicationCurated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MNGQSLSGGTDDSHHDPLWI DPFGNRAGKAAPGGFRRLNL FLAQRWQEQEPEEEMA in isoform 2. CuratedVSP_041576

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U81518 mRNA. Translation: AAB39937.1.
X98399 mRNA. Translation: CAA67049.1. Sequence problems.
RefSeqiNP_062219.2. NM_019346.2.
UniGeneiRn.10654.

Genome annotation databases

GeneIDi54301.
KEGGirno:54301.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U81518 mRNA. Translation: AAB39937.1 .
X98399 mRNA. Translation: CAA67049.1 . Sequence problems.
RefSeqi NP_062219.2. NM_019346.2.
UniGenei Rn.10654.

3D structure databases

ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 248521. 1 interaction.
STRINGi 10116.ENSRNOP00000022598.

Protein family/group databases

TCDBi 1.A.28.1.3. the urea transporter (ut) family.

Proteomic databases

PRIDEi P97689.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 54301.
KEGGi rno:54301.

Organism-specific databases

CTDi 6563.
RGDi 3688. Slc14a1.

Phylogenomic databases

eggNOGi COG4413.
HOGENOMi HOG000065705.
HOVERGENi HBG000540.
InParanoidi P97689.
KOi K08716.

Miscellaneous databases

NextBioi 610946.
PROi P97689.

Gene expression databases

ExpressionAtlasi P97689. baseline and differential.
Genevestigatori P97689.

Family and domain databases

Gene3Di 1.10.3430.10. 1 hit.
InterProi IPR029020. Ammonium/urea_transptr.
IPR004937. Urea_transporter.
[Graphical view ]
PANTHERi PTHR10464. PTHR10464. 1 hit.
Pfami PF03253. UT. 1 hit.
[Graphical view ]
PIRSFi PIRSF016502. Urea_transporter. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Tsukaguchi H., Shayakul C., Berger U.V., Tokui T., Brown D., Hediger M.A.
    Submitted (DEC-1996) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Strain: Sprague-Dawley.
  2. "Genome sequence of the Brown Norway rat yields insights into mammalian evolution."
    Gibbs R.A., Weinstock G.M., Metzker M.L., Muzny D.M., Sodergren E.J., Scherer S., Scott G., Steffen D., Worley K.C., Burch P.E., Okwuonu G., Hines S., Lewis L., Deramo C., Delgado O., Dugan-Rocha S., Miner G., Morgan M.
    , Hawes A., Gill R., Holt R.A., Adams M.D., Amanatides P.G., Baden-Tillson H., Barnstead M., Chin S., Evans C.A., Ferriera S., Fosler C., Glodek A., Gu Z., Jennings D., Kraft C.L., Nguyen T., Pfannkoch C.M., Sitter C., Sutton G.G., Venter J.C., Woodage T., Smith D., Lee H.-M., Gustafson E., Cahill P., Kana A., Doucette-Stamm L., Weinstock K., Fechtel K., Weiss R.B., Dunn D.M., Green E.D., Blakesley R.W., Bouffard G.G., De Jong P.J., Osoegawa K., Zhu B., Marra M., Schein J., Bosdet I., Fjell C., Jones S., Krzywinski M., Mathewson C., Siddiqui A., Wye N., McPherson J., Zhao S., Fraser C.M., Shetty J., Shatsman S., Geer K., Chen Y., Abramzon S., Nierman W.C., Havlak P.H., Chen R., Durbin K.J., Egan A., Ren Y., Song X.-Z., Li B., Liu Y., Qin X., Cawley S., Cooney A.J., D'Souza L.M., Martin K., Wu J.Q., Gonzalez-Garay M.L., Jackson A.R., Kalafus K.J., McLeod M.P., Milosavljevic A., Virk D., Volkov A., Wheeler D.A., Zhang Z., Bailey J.A., Eichler E.E., Tuzun E., Birney E., Mongin E., Ureta-Vidal A., Woodwark C., Zdobnov E., Bork P., Suyama M., Torrents D., Alexandersson M., Trask B.J., Young J.M., Huang H., Wang H., Xing H., Daniels S., Gietzen D., Schmidt J., Stevens K., Vitt U., Wingrove J., Camara F., Mar Alba M., Abril J.F., Guigo R., Smit A., Dubchak I., Rubin E.M., Couronne O., Poliakov A., Huebner N., Ganten D., Goesele C., Hummel O., Kreitler T., Lee Y.-A., Monti J., Schulz H., Zimdahl H., Himmelbauer H., Lehrach H., Jacob H.J., Bromberg S., Gullings-Handley J., Jensen-Seaman M.I., Kwitek A.E., Lazar J., Pasko D., Tonellato P.J., Twigger S., Ponting C.P., Duarte J.M., Rice S., Goodstadt L., Beatson S.A., Emes R.D., Winter E.E., Webber C., Brandt P., Nyakatura G., Adetobi M., Chiaromonte F., Elnitski L., Eswara P., Hardison R.C., Hou M., Kolbe D., Makova K., Miller W., Nekrutenko A., Riemer C., Schwartz S., Taylor J., Yang S., Zhang Y., Lindpaintner K., Andrews T.D., Caccamo M., Clamp M., Clarke L., Curwen V., Durbin R.M., Eyras E., Searle S.M., Cooper G.M., Batzoglou S., Brudno M., Sidow A., Stone E.A., Payseur B.A., Bourque G., Lopez-Otin C., Puente X.S., Chakrabarti K., Chatterji S., Dewey C., Pachter L., Bray N., Yap V.B., Caspi A., Tesler G., Pevzner P.A., Haussler D., Roskin K.M., Baertsch R., Clawson H., Furey T.S., Hinrichs A.S., Karolchik D., Kent W.J., Rosenbloom K.R., Trumbower H., Weirauch M., Cooper D.N., Stenson P.D., Ma B., Brent M., Arumugam M., Shteynberg D., Copley R.R., Taylor M.S., Riethman H., Mudunuri U., Peterson J., Guyer M., Felsenfeld A., Old S., Mockrin S., Collins F.S.
    Nature 428:493-521(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: Brown Norway.
  3. "Cloning and functional characterization of a rat urea transporter: expression in the brain."
    Couriaud C., Ripoche P., Rousselet G.
    Biochim. Biophys. Acta 1309:197-199(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-382, FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    Strain: Sprague-Dawley.
    Tissue: Kidney.

Entry informationi

Entry nameiUT1_RAT
AccessioniPrimary (citable) accession number: P97689
Secondary accession number(s): E9PSP0, P70633
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 28, 2011
Last sequence update: June 28, 2011
Last modified: October 29, 2014
This is version 74 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3