Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P97689

- UT1_RAT

UniProt

P97689 - UT1_RAT

Protein

Urea transporter 1

Gene

Slc14a1

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 73 (01 Oct 2014)
      Sequence version 2 (28 Jun 2011)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Urea channel that facilitates transmembrane urea transport down a concentration gradient. A constriction of the transmembrane channel functions as selectivity filter through which urea is expected to pass in dehydrated form. The rate of urea conduction is increased by hypotonic stress. Plays an important role in the kidney medulla collecting ducts, where it allows rapid equilibration between the lumen of the collecting ducts and the interstitium, and thereby prevents water loss driven by the high concentration of urea in the urine. Facilitates urea transport across erythrocyte membranes. May also play a role in transmembrane water transport, possibly by indirect means.1 Publication

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sitei334 – 3341Important for channel permeabilityBy similarity

    GO - Molecular functioni

    1. urea channel activity Source: UniProtKB
    2. urea transmembrane transporter activity Source: RGD
    3. water transmembrane transporter activity Source: Ensembl

    GO - Biological processi

    1. urea transmembrane transport Source: UniProtKB
    2. urea transport Source: RGD

    Keywords - Biological processi

    Transport

    Protein family/group databases

    TCDBi1.A.28.1.3. the urea transporter (ut) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Urea transporter 1
    Alternative name(s):
    Solute carrier family 14 member 1
    Urea transporter B
    Short name:
    UT-B
    Urea transporter, erythrocyte
    Gene namesi
    Name:Slc14a1
    Synonyms:UT11, UT3
    OrganismiRattus norvegicus (Rat)
    Taxonomic identifieri10116 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
    ProteomesiUP000002494: Unplaced

    Organism-specific databases

    RGDi3688. Slc14a1.

    Subcellular locationi

    Cell membrane 1 Publication; Multi-pass membrane protein 1 Publication. Basolateral cell membrane By similarity; Multi-pass membrane protein By similarity
    Note: Restricted to the basolateral membrane in various portions of the urothelium.By similarity

    GO - Cellular componenti

    1. basolateral plasma membrane Source: UniProtKB-SubCell
    2. integral component of plasma membrane Source: UniProtKB

    Keywords - Cellular componenti

    Cell membrane, Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 384384Urea transporter 1PRO_0000410964Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi206 – 2061N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    PRIDEiP97689.

    Expressioni

    Tissue specificityi

    Expressed in brain, spleen, kidney, testis and lung, with highest levels in brain.1 Publication

    Gene expression databases

    ArrayExpressiP97689.
    GenevestigatoriP97689.

    Interactioni

    Subunit structurei

    Homotrimer; each subunit contains a pore through which urea permeates. Identified in a complex with STOM By similarity.By similarity

    Protein-protein interaction databases

    BioGridi248521. 1 interaction.
    STRINGi10116.ENSRNOP00000022598.

    Structurei

    Intramembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Intramembranei47 – 6418HelicalBy similarityAdd
    BLAST
    Intramembranei68 – 8316HelicalBy similarityAdd
    BLAST
    Intramembranei215 – 22915HelicalBy similarityAdd
    BLAST
    Intramembranei234 – 24512HelicalBy similarityAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei86 – 10520HelicalBy similarityAdd
    BLAST
    Transmembranei110 – 13223HelicalBy similarityAdd
    BLAST
    Transmembranei139 – 16325HelicalBy similarityAdd
    BLAST
    Transmembranei168 – 18821HelicalBy similarityAdd
    BLAST
    Transmembranei250 – 26920HelicalBy similarityAdd
    BLAST
    Transmembranei279 – 29921HelicalBy similarityAdd
    BLAST
    Transmembranei304 – 32522HelicalBy similarityAdd
    BLAST
    Transmembranei328 – 34821HelicalBy similarityAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the urea transporter family.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG4413.
    HOGENOMiHOG000065705.
    HOVERGENiHBG000540.
    InParanoidiP70633.
    KOiK08716.

    Family and domain databases

    Gene3Di1.10.3430.10. 1 hit.
    InterProiIPR029020. Ammonium/urea_transptr.
    IPR004937. Urea_transporter.
    [Graphical view]
    PANTHERiPTHR10464. PTHR10464. 1 hit.
    PfamiPF03253. UT. 1 hit.
    [Graphical view]
    PIRSFiPIRSF016502. Urea_transporter. 1 hit.

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P97689-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEDIPTMVKV DRGESQILSC RGRRCGLKVL GYVTGDMKEF ANWLKDKPVV    50
    LQFMDWILRG ISQVVFVSNP ISGILILAGL LVQNPWWALC GCVGTVVSTL 100
    TALLLSQDRS AIAAGLQGYN ATLVGILMAV FSDKGDYFWW LIFPVSAMSM 150
    TCPVFSSALS SLFSKWDLPV FTLPFNMALS LYLSATGHYN TFFPSKLFMP 200
    VSSVPNITWS ELSALELLKS LPVGVGQIYG CDNPWTGAIF LCAILLSSPL 250
    MCLHAAIGSL LGVIAGLSLA APFKDIYSGL WGFNSSLACI AIGGMFMALT 300
    WQTHLLALAC ALFTAYFGAC MTHLMAAVHL PACTWSFCLA TLLFLLLTTE 350
    NPNIYRMPLS KVTYSEENRI FYLQNKKRVV DSPL 384
    Length:384
    Mass (Da):42,034
    Last modified:June 28, 2011 - v2
    Checksum:i1BBD9E8D60CFD6CA
    GO
    Isoform 2 (identifier: P97689-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MNGQSLSGGTDDSHHDPLWIDPFGNRAGKAAPGGFRRLNLFLAQRWQEQEPEEEMA

    Note: Gene prediction based on similarity to human and mouse orthologs.

    Show »
    Length:439
    Mass (Da):48,151
    Checksum:iEE827720447E21C1
    GO

    Sequence cautioni

    The sequence CAA67049.1 differs from that shown. Reason:

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti25 – 251C → W in AAB39937. 1 PublicationCurated
    Sequence conflicti47 – 471K → E in AAB39937. 1 PublicationCurated
    Sequence conflicti50 – 501V → G in AAB39937. 1 PublicationCurated
    Sequence conflicti180 – 1801S → A in AAB39937. 1 PublicationCurated
    Sequence conflicti266 – 2661G → R in AAB39937. 1 PublicationCurated
    Sequence conflicti325 – 3251M → I in AAB39937. 1 PublicationCurated
    Sequence conflicti339 – 3391L → F in AAB39937. 1 PublicationCurated
    Sequence conflicti378 – 3792RV → SA in AAB39937. 1 PublicationCurated
    Sequence conflicti382 – 3821S → R in AAB39937. 1 PublicationCurated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MNGQSLSGGTDDSHHDPLWI DPFGNRAGKAAPGGFRRLNL FLAQRWQEQEPEEEMA in isoform 2. CuratedVSP_041576

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U81518 mRNA. Translation: AAB39937.1.
    X98399 mRNA. Translation: CAA67049.1. Sequence problems.
    RefSeqiNP_062219.2. NM_019346.2.
    UniGeneiRn.10654.

    Genome annotation databases

    GeneIDi54301.
    KEGGirno:54301.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U81518 mRNA. Translation: AAB39937.1 .
    X98399 mRNA. Translation: CAA67049.1 . Sequence problems.
    RefSeqi NP_062219.2. NM_019346.2.
    UniGenei Rn.10654.

    3D structure databases

    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 248521. 1 interaction.
    STRINGi 10116.ENSRNOP00000022598.

    Protein family/group databases

    TCDBi 1.A.28.1.3. the urea transporter (ut) family.

    Proteomic databases

    PRIDEi P97689.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    GeneIDi 54301.
    KEGGi rno:54301.

    Organism-specific databases

    CTDi 6563.
    RGDi 3688. Slc14a1.

    Phylogenomic databases

    eggNOGi COG4413.
    HOGENOMi HOG000065705.
    HOVERGENi HBG000540.
    InParanoidi P70633.
    KOi K08716.

    Miscellaneous databases

    NextBioi 610946.
    PROi P97689.

    Gene expression databases

    ArrayExpressi P97689.
    Genevestigatori P97689.

    Family and domain databases

    Gene3Di 1.10.3430.10. 1 hit.
    InterProi IPR029020. Ammonium/urea_transptr.
    IPR004937. Urea_transporter.
    [Graphical view ]
    PANTHERi PTHR10464. PTHR10464. 1 hit.
    Pfami PF03253. UT. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF016502. Urea_transporter. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. Tsukaguchi H., Shayakul C., Berger U.V., Tokui T., Brown D., Hediger M.A.
      Submitted (DEC-1996) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Strain: Sprague-Dawley.
    2. "Genome sequence of the Brown Norway rat yields insights into mammalian evolution."
      Gibbs R.A., Weinstock G.M., Metzker M.L., Muzny D.M., Sodergren E.J., Scherer S., Scott G., Steffen D., Worley K.C., Burch P.E., Okwuonu G., Hines S., Lewis L., Deramo C., Delgado O., Dugan-Rocha S., Miner G., Morgan M.
      , Hawes A., Gill R., Holt R.A., Adams M.D., Amanatides P.G., Baden-Tillson H., Barnstead M., Chin S., Evans C.A., Ferriera S., Fosler C., Glodek A., Gu Z., Jennings D., Kraft C.L., Nguyen T., Pfannkoch C.M., Sitter C., Sutton G.G., Venter J.C., Woodage T., Smith D., Lee H.-M., Gustafson E., Cahill P., Kana A., Doucette-Stamm L., Weinstock K., Fechtel K., Weiss R.B., Dunn D.M., Green E.D., Blakesley R.W., Bouffard G.G., De Jong P.J., Osoegawa K., Zhu B., Marra M., Schein J., Bosdet I., Fjell C., Jones S., Krzywinski M., Mathewson C., Siddiqui A., Wye N., McPherson J., Zhao S., Fraser C.M., Shetty J., Shatsman S., Geer K., Chen Y., Abramzon S., Nierman W.C., Havlak P.H., Chen R., Durbin K.J., Egan A., Ren Y., Song X.-Z., Li B., Liu Y., Qin X., Cawley S., Cooney A.J., D'Souza L.M., Martin K., Wu J.Q., Gonzalez-Garay M.L., Jackson A.R., Kalafus K.J., McLeod M.P., Milosavljevic A., Virk D., Volkov A., Wheeler D.A., Zhang Z., Bailey J.A., Eichler E.E., Tuzun E., Birney E., Mongin E., Ureta-Vidal A., Woodwark C., Zdobnov E., Bork P., Suyama M., Torrents D., Alexandersson M., Trask B.J., Young J.M., Huang H., Wang H., Xing H., Daniels S., Gietzen D., Schmidt J., Stevens K., Vitt U., Wingrove J., Camara F., Mar Alba M., Abril J.F., Guigo R., Smit A., Dubchak I., Rubin E.M., Couronne O., Poliakov A., Huebner N., Ganten D., Goesele C., Hummel O., Kreitler T., Lee Y.-A., Monti J., Schulz H., Zimdahl H., Himmelbauer H., Lehrach H., Jacob H.J., Bromberg S., Gullings-Handley J., Jensen-Seaman M.I., Kwitek A.E., Lazar J., Pasko D., Tonellato P.J., Twigger S., Ponting C.P., Duarte J.M., Rice S., Goodstadt L., Beatson S.A., Emes R.D., Winter E.E., Webber C., Brandt P., Nyakatura G., Adetobi M., Chiaromonte F., Elnitski L., Eswara P., Hardison R.C., Hou M., Kolbe D., Makova K., Miller W., Nekrutenko A., Riemer C., Schwartz S., Taylor J., Yang S., Zhang Y., Lindpaintner K., Andrews T.D., Caccamo M., Clamp M., Clarke L., Curwen V., Durbin R.M., Eyras E., Searle S.M., Cooper G.M., Batzoglou S., Brudno M., Sidow A., Stone E.A., Payseur B.A., Bourque G., Lopez-Otin C., Puente X.S., Chakrabarti K., Chatterji S., Dewey C., Pachter L., Bray N., Yap V.B., Caspi A., Tesler G., Pevzner P.A., Haussler D., Roskin K.M., Baertsch R., Clawson H., Furey T.S., Hinrichs A.S., Karolchik D., Kent W.J., Rosenbloom K.R., Trumbower H., Weirauch M., Cooper D.N., Stenson P.D., Ma B., Brent M., Arumugam M., Shteynberg D., Copley R.R., Taylor M.S., Riethman H., Mudunuri U., Peterson J., Guyer M., Felsenfeld A., Old S., Mockrin S., Collins F.S.
      Nature 428:493-521(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: Brown Norway.
    3. "Cloning and functional characterization of a rat urea transporter: expression in the brain."
      Couriaud C., Ripoche P., Rousselet G.
      Biochim. Biophys. Acta 1309:197-199(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-382, FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
      Strain: Sprague-Dawley.
      Tissue: Kidney.

    Entry informationi

    Entry nameiUT1_RAT
    AccessioniPrimary (citable) accession number: P97689
    Secondary accession number(s): E9PSP0, P70633
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 28, 2011
    Last sequence update: June 28, 2011
    Last modified: October 1, 2014
    This is version 73 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3