Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P97689 (UT1_RAT) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 69. Feed History...

Clusters with 100%, 90%, 50% identity | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry infoCustomize order

Names and origin

Protein namesRecommended name:
Urea transporter 1
Alternative name(s):
Solute carrier family 14 member 1
Urea transporter B
Short name=UT-B
Urea transporter, erythrocyte
Gene names
Name:Slc14a1
Synonyms:UT11, UT3
OrganismRattus norvegicus (Rat) [Reference proteome]
Taxonomic identifier10116 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus

Protein attributes

Sequence length384 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Low-affinity facilitative urea transporter that allow rapid equilibration between the urinary space and the hyperosmotic interstitium. the rate of urea conduction is increased by hypoosmotic stress. Mediates urea transport in erythrocytes By similarity. Ref.3

Subunit structure

Homotrimer By similarity.

Subcellular location

Cell membrane; Multi-pass membrane protein By similarity. Basolateral cell membrane By similarity.

Tissue specificity

Expressed in brain, spleen, kidney, testis and lung, with highest levels in brain. Ref.3

Sequence caution

The sequence CAA67049.1 differs from that shown. Reason:

Ontologies

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: P97689-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: P97689-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MNGQSLSGGTDDSHHDPLWIDPFGNRAGKAAPGGFRRLNLFLAQRWQEQEPEEEMA
Note: Gene prediction based on similarity to human and mouse orthologs.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 384384Urea transporter 1
PRO_0000410964

Regions

Transmembrane61 – 8121Helical; Potential
Transmembrane85 – 10521Helical; Potential
Transmembrane111 – 13121Helical; Potential
Transmembrane138 – 15821Helical; Potential
Transmembrane168 – 18821Helical; Potential
Transmembrane237 – 25721Helical; Potential
Transmembrane279 – 29921Helical; Potential
Transmembrane305 – 32521Helical; Potential
Transmembrane327 – 34721Helical; Potential

Amino acid modifications

Glycosylation2061N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence11M → MNGQSLSGGTDDSHHDPLWI DPFGNRAGKAAPGGFRRLNL FLAQRWQEQEPEEEMA in isoform 2.
VSP_041576

Experimental info

Sequence conflict251C → W in AAB39937. Ref.1
Sequence conflict471K → E in AAB39937. Ref.1
Sequence conflict501V → G in AAB39937. Ref.1
Sequence conflict1801S → A in AAB39937. Ref.1
Sequence conflict2661G → R in AAB39937. Ref.1
Sequence conflict3251M → I in AAB39937. Ref.1
Sequence conflict3391L → F in AAB39937. Ref.1
Sequence conflict378 – 3792RV → SA in AAB39937. Ref.1
Sequence conflict3821S → R in AAB39937. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 28, 2011. Version 2.
Checksum: 1BBD9E8D60CFD6CA

FASTA38442,034
        10         20         30         40         50         60 
MEDIPTMVKV DRGESQILSC RGRRCGLKVL GYVTGDMKEF ANWLKDKPVV LQFMDWILRG 

        70         80         90        100        110        120 
ISQVVFVSNP ISGILILAGL LVQNPWWALC GCVGTVVSTL TALLLSQDRS AIAAGLQGYN 

       130        140        150        160        170        180 
ATLVGILMAV FSDKGDYFWW LIFPVSAMSM TCPVFSSALS SLFSKWDLPV FTLPFNMALS 

       190        200        210        220        230        240 
LYLSATGHYN TFFPSKLFMP VSSVPNITWS ELSALELLKS LPVGVGQIYG CDNPWTGAIF 

       250        260        270        280        290        300 
LCAILLSSPL MCLHAAIGSL LGVIAGLSLA APFKDIYSGL WGFNSSLACI AIGGMFMALT 

       310        320        330        340        350        360 
WQTHLLALAC ALFTAYFGAC MTHLMAAVHL PACTWSFCLA TLLFLLLTTE NPNIYRMPLS 

       370        380 
KVTYSEENRI FYLQNKKRVV DSPL 

« Hide

Isoform 2 [UniParc].

Checksum: EE827720447E21C1
Show »

FASTA43948,151

References

« Hide 'large scale' references
[1]Tsukaguchi H., Shayakul C., Berger U.V., Tokui T., Brown D., Hediger M.A.
Submitted (DEC-1996) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Strain: Sprague-Dawley.
[2]"Genome sequence of the Brown Norway rat yields insights into mammalian evolution."
Gibbs R.A., Weinstock G.M., Metzker M.L., Muzny D.M., Sodergren E.J., Scherer S., Scott G., Steffen D., Worley K.C., Burch P.E., Okwuonu G., Hines S., Lewis L., Deramo C., Delgado O., Dugan-Rocha S., Miner G., Morgan M. expand/collapse author list , Hawes A., Gill R., Holt R.A., Adams M.D., Amanatides P.G., Baden-Tillson H., Barnstead M., Chin S., Evans C.A., Ferriera S., Fosler C., Glodek A., Gu Z., Jennings D., Kraft C.L., Nguyen T., Pfannkoch C.M., Sitter C., Sutton G.G., Venter J.C., Woodage T., Smith D., Lee H.-M., Gustafson E., Cahill P., Kana A., Doucette-Stamm L., Weinstock K., Fechtel K., Weiss R.B., Dunn D.M., Green E.D., Blakesley R.W., Bouffard G.G., De Jong P.J., Osoegawa K., Zhu B., Marra M., Schein J., Bosdet I., Fjell C., Jones S., Krzywinski M., Mathewson C., Siddiqui A., Wye N., McPherson J., Zhao S., Fraser C.M., Shetty J., Shatsman S., Geer K., Chen Y., Abramzon S., Nierman W.C., Havlak P.H., Chen R., Durbin K.J., Egan A., Ren Y., Song X.-Z., Li B., Liu Y., Qin X., Cawley S., Cooney A.J., D'Souza L.M., Martin K., Wu J.Q., Gonzalez-Garay M.L., Jackson A.R., Kalafus K.J., McLeod M.P., Milosavljevic A., Virk D., Volkov A., Wheeler D.A., Zhang Z., Bailey J.A., Eichler E.E., Tuzun E., Birney E., Mongin E., Ureta-Vidal A., Woodwark C., Zdobnov E., Bork P., Suyama M., Torrents D., Alexandersson M., Trask B.J., Young J.M., Huang H., Wang H., Xing H., Daniels S., Gietzen D., Schmidt J., Stevens K., Vitt U., Wingrove J., Camara F., Mar Alba M., Abril J.F., Guigo R., Smit A., Dubchak I., Rubin E.M., Couronne O., Poliakov A., Huebner N., Ganten D., Goesele C., Hummel O., Kreitler T., Lee Y.-A., Monti J., Schulz H., Zimdahl H., Himmelbauer H., Lehrach H., Jacob H.J., Bromberg S., Gullings-Handley J., Jensen-Seaman M.I., Kwitek A.E., Lazar J., Pasko D., Tonellato P.J., Twigger S., Ponting C.P., Duarte J.M., Rice S., Goodstadt L., Beatson S.A., Emes R.D., Winter E.E., Webber C., Brandt P., Nyakatura G., Adetobi M., Chiaromonte F., Elnitski L., Eswara P., Hardison R.C., Hou M., Kolbe D., Makova K., Miller W., Nekrutenko A., Riemer C., Schwartz S., Taylor J., Yang S., Zhang Y., Lindpaintner K., Andrews T.D., Caccamo M., Clamp M., Clarke L., Curwen V., Durbin R.M., Eyras E., Searle S.M., Cooper G.M., Batzoglou S., Brudno M., Sidow A., Stone E.A., Payseur B.A., Bourque G., Lopez-Otin C., Puente X.S., Chakrabarti K., Chatterji S., Dewey C., Pachter L., Bray N., Yap V.B., Caspi A., Tesler G., Pevzner P.A., Haussler D., Roskin K.M., Baertsch R., Clawson H., Furey T.S., Hinrichs A.S., Karolchik D., Kent W.J., Rosenbloom K.R., Trumbower H., Weirauch M., Cooper D.N., Stenson P.D., Ma B., Brent M., Arumugam M., Shteynberg D., Copley R.R., Taylor M.S., Riethman H., Mudunuri U., Peterson J., Guyer M., Felsenfeld A., Old S., Mockrin S., Collins F.S.
Nature 428:493-521(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: Brown Norway.
[3]"Cloning and functional characterization of a rat urea transporter: expression in the brain."
Couriaud C., Ripoche P., Rousselet G.
Biochim. Biophys. Acta 1309:197-199(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-382, FUNCTION, TISSUE SPECIFICITY.
Strain: Sprague-Dawley.
Tissue: Kidney.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U81518 mRNA. Translation: AAB39937.1.
X98399 mRNA. Translation: CAA67049.1. Sequence problems.
RefSeqNP_062219.2. NM_019346.2.
UniGeneRn.10654.

3D structure databases

ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid248521. 1 interaction.
STRING10116.ENSRNOP00000022598.

Protein family/group databases

TCDB1.A.28.1.3. the urea transporter (ut) family.

Proteomic databases

PRIDEP97689.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

GeneID54301.
KEGGrno:54301.

Organism-specific databases

CTD6563.
RGD3688. Slc14a1.

Phylogenomic databases

eggNOGCOG4413.
HOGENOMHOG000065705.
HOVERGENHBG000540.
InParanoidP70633.
KOK08716.

Gene expression databases

ArrayExpressP97689.
GenevestigatorP97689.

Family and domain databases

InterProIPR004937. Urea_transporter.
[Graphical view]
PANTHERPTHR10464. PTHR10464. 1 hit.
PfamPF03253. UT. 1 hit.
[Graphical view]
PIRSFPIRSF016502. Urea_transporter. 1 hit.
ProtoNetSearch...

Other

NextBio610946.
PROP97689.

Entry information

Entry nameUT1_RAT
AccessionPrimary (citable) accession number: P97689
Secondary accession number(s): E9PSP0, P70633
Entry history
Integrated into UniProtKB/Swiss-Prot: June 28, 2011
Last sequence update: June 28, 2011
Last modified: April 16, 2014
This is version 69 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program