Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Urea transporter 1

Gene

Slc14a1

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Urea channel that facilitates transmembrane urea transport down a concentration gradient. A constriction of the transmembrane channel functions as selectivity filter through which urea is expected to pass in dehydrated form. The rate of urea conduction is increased by hypotonic stress. Plays an important role in the kidney medulla collecting ducts, where it allows rapid equilibration between the lumen of the collecting ducts and the interstitium, and thereby prevents water loss driven by the high concentration of urea in the urine. Facilitates urea transport across erythrocyte membranes. May also play a role in transmembrane water transport, possibly by indirect means.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei334Important for channel permeabilityBy similarity1

GO - Molecular functioni

  • urea channel activity Source: UniProtKB
  • urea transmembrane transporter activity Source: RGD

GO - Biological processi

  • urea transmembrane transport Source: UniProtKB
  • urea transport Source: RGD
Complete GO annotation...

Keywords - Biological processi

Transport

Protein family/group databases

TCDBi1.A.28.1.3. the urea transporter (ut) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Urea transporter 1
Alternative name(s):
Solute carrier family 14 member 1
Urea transporter B
Short name:
UT-B
Urea transporter, erythrocyte
Gene namesi
Name:Slc14a1
Synonyms:UT11, UT3
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi3688. Slc14a1.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Intramembranei47 – 64HelicalBy similarityAdd BLAST18
Intramembranei68 – 83HelicalBy similarityAdd BLAST16
Transmembranei86 – 105HelicalBy similarityAdd BLAST20
Transmembranei110 – 132HelicalBy similarityAdd BLAST23
Transmembranei139 – 163HelicalBy similarityAdd BLAST25
Transmembranei168 – 188HelicalBy similarityAdd BLAST21
Intramembranei215 – 229HelicalBy similarityAdd BLAST15
Intramembranei234 – 245HelicalBy similarityAdd BLAST12
Transmembranei250 – 269HelicalBy similarityAdd BLAST20
Transmembranei279 – 299HelicalBy similarityAdd BLAST21
Transmembranei304 – 325HelicalBy similarityAdd BLAST22
Transmembranei328 – 348HelicalBy similarityAdd BLAST21

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00004109641 – 384Urea transporter 1Add BLAST384

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi206N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiP97689.
PRIDEiP97689.

Expressioni

Tissue specificityi

Expressed in brain, spleen, kidney, testis and lung, with highest levels in brain.1 Publication

Gene expression databases

BgeeiENSRNOG00000016753.

Interactioni

Subunit structurei

Homotrimer; each subunit contains a pore through which urea permeates. Identified in a complex with STOM (By similarity).By similarity

Protein-protein interaction databases

BioGridi248521. 1 interactor.
STRINGi10116.ENSRNOP00000022598.

Chemistry databases

BindingDBiP97689.

Family & Domainsi

Sequence similaritiesi

Belongs to the urea transporter family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IEWG. Eukaryota.
COG4413. LUCA.
HOGENOMiHOG000065705.
HOVERGENiHBG000540.
InParanoidiP97689.
KOiK08716.

Family and domain databases

Gene3Di1.10.3430.10. 1 hit.
InterProiIPR029020. Ammonium/urea_transptr.
IPR004937. Urea_transporter.
[Graphical view]
PANTHERiPTHR10464. PTHR10464. 1 hit.
PfamiPF03253. UT. 1 hit.
[Graphical view]
PIRSFiPIRSF016502. Urea_transporter. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P97689-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEDIPTMVKV DRGESQILSC RGRRCGLKVL GYVTGDMKEF ANWLKDKPVV
60 70 80 90 100
LQFMDWILRG ISQVVFVSNP ISGILILAGL LVQNPWWALC GCVGTVVSTL
110 120 130 140 150
TALLLSQDRS AIAAGLQGYN ATLVGILMAV FSDKGDYFWW LIFPVSAMSM
160 170 180 190 200
TCPVFSSALS SLFSKWDLPV FTLPFNMALS LYLSATGHYN TFFPSKLFMP
210 220 230 240 250
VSSVPNITWS ELSALELLKS LPVGVGQIYG CDNPWTGAIF LCAILLSSPL
260 270 280 290 300
MCLHAAIGSL LGVIAGLSLA APFKDIYSGL WGFNSSLACI AIGGMFMALT
310 320 330 340 350
WQTHLLALAC ALFTAYFGAC MTHLMAAVHL PACTWSFCLA TLLFLLLTTE
360 370 380
NPNIYRMPLS KVTYSEENRI FYLQNKKRVV DSPL
Length:384
Mass (Da):42,034
Last modified:June 28, 2011 - v2
Checksum:i1BBD9E8D60CFD6CA
GO
Isoform 2 (identifier: P97689-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MNGQSLSGGTDDSHHDPLWIDPFGNRAGKAAPGGFRRLNLFLAQRWQEQEPEEEMA

Note: Gene prediction based on similarity to human and mouse orthologs.
Show »
Length:439
Mass (Da):48,151
Checksum:iEE827720447E21C1
GO

Sequence cautioni

The sequence CAA67049 differs from that shown.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti25C → W in AAB39937 (Ref. 1) Curated1
Sequence conflicti47K → E in AAB39937 (Ref. 1) Curated1
Sequence conflicti50V → G in AAB39937 (Ref. 1) Curated1
Sequence conflicti180S → A in AAB39937 (Ref. 1) Curated1
Sequence conflicti266G → R in AAB39937 (Ref. 1) Curated1
Sequence conflicti325M → I in AAB39937 (Ref. 1) Curated1
Sequence conflicti339L → F in AAB39937 (Ref. 1) Curated1
Sequence conflicti378 – 379RV → SA in AAB39937 (Ref. 1) Curated2
Sequence conflicti382S → R in AAB39937 (Ref. 1) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0415761M → MNGQSLSGGTDDSHHDPLWI DPFGNRAGKAAPGGFRRLNL FLAQRWQEQEPEEEMA in isoform 2. Curated1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U81518 mRNA. Translation: AAB39937.1.
X98399 mRNA. Translation: CAA67049.1. Sequence problems.
RefSeqiNP_062219.2. NM_019346.2.
UniGeneiRn.10654.

Genome annotation databases

GeneIDi54301.
KEGGirno:54301.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U81518 mRNA. Translation: AAB39937.1.
X98399 mRNA. Translation: CAA67049.1. Sequence problems.
RefSeqiNP_062219.2. NM_019346.2.
UniGeneiRn.10654.

3D structure databases

ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi248521. 1 interactor.
STRINGi10116.ENSRNOP00000022598.

Chemistry databases

BindingDBiP97689.

Protein family/group databases

TCDBi1.A.28.1.3. the urea transporter (ut) family.

Proteomic databases

PaxDbiP97689.
PRIDEiP97689.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi54301.
KEGGirno:54301.

Organism-specific databases

CTDi6563.
RGDi3688. Slc14a1.

Phylogenomic databases

eggNOGiENOG410IEWG. Eukaryota.
COG4413. LUCA.
HOGENOMiHOG000065705.
HOVERGENiHBG000540.
InParanoidiP97689.
KOiK08716.

Miscellaneous databases

PROiP97689.

Gene expression databases

BgeeiENSRNOG00000016753.

Family and domain databases

Gene3Di1.10.3430.10. 1 hit.
InterProiIPR029020. Ammonium/urea_transptr.
IPR004937. Urea_transporter.
[Graphical view]
PANTHERiPTHR10464. PTHR10464. 1 hit.
PfamiPF03253. UT. 1 hit.
[Graphical view]
PIRSFiPIRSF016502. Urea_transporter. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiUT1_RAT
AccessioniPrimary (citable) accession number: P97689
Secondary accession number(s): E9PSP0, P70633
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 28, 2011
Last sequence update: June 28, 2011
Last modified: September 7, 2016
This is version 84 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.