P97570 (PLPL9_RAT) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 100.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: 85/88 kDa calcium-independent phospholipase A2 Short name=CaI-PLA2 EC=3.1.1.4 Alternative name(s): Group VI phospholipase A2 Short name=GVI PLA2 Intracellular membrane-associated calcium-independent phospholipase A2 beta Short name=iPLA2-beta Patatin-like phospholipase domain-containing protein 9 Short name=PNPLA9 | ||||
| Gene names |
| ||||
| Organism | Rattus norvegicus (Rat) [Reference proteome] | ||||
| Taxonomic identifier | 10116 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus![]() |
Protein attributes
| Sequence length | 807 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Catalyzes the release of fatty acids from phospholipids. It has been implicated in normal phospholipid remodeling, nitric oxide-induced or vasopressin-induced arachidonic acid release and in leukotriene and prostaglandin production. May participate in fas mediated apoptosis and in regulating transmembrane ion flux in glucose-stimulated B-cells. Has a role in cardiolipin (CL) deacylation. Required for both speed and directionality of monocyte MCP1/CCL2-induced chemotaxis through regulation of F-actin polymerization at the pseudopods By similarity. |
| Catalytic activity | Phosphatidylcholine + H2O = 1-acylglycerophosphocholine + a carboxylate. |
| Enzyme regulation | Inhibited by calcium-activated calmodulin. Ref.5 |
| Subcellular location | Isoform Long: Membrane By similarity; Peripheral membrane protein. Note: Recruited to the membrane-enriched pseudopod upon MCP1/CCL2 stimulation in monocytes By similarity. |
| Tissue specificity | Found in brain, lung, spleen, kidney, liver, heart and skeletal muscle. |
| Sequence similarities | Contains 7 ANK repeats. Contains 1 patatin domain. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Long (identifier: P97570-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Short (identifier: P97570-2) The sequence of this isoform differs from the canonical sequence as follows: 396-451: LITRKALLTLLKTVGADYHFPFIQGVSTEQSSAAGPHPFFSLDRTQPPTISLNNLE → Q |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 807 | 807 | 85/88 kDa calcium-independent phospholipase A2 | PRO_0000067039 | |||||
Regions | |||||||||
| Repeat | 150 – 180 | 31 | ANK 1 | ||||||
| Repeat | 184 – 214 | 31 | ANK 2 | ||||||
| Repeat | 218 – 247 | 30 | ANK 3 | ||||||
| Repeat | 250 – 280 | 31 | ANK 4 | ||||||
| Repeat | 285 – 311 | 27 | ANK 5 | ||||||
| Repeat | 315 – 344 | 30 | ANK 6 | ||||||
| Repeat | 348 – 377 | 30 | ANK 7 | ||||||
| Domain | 481 – 665 | 185 | Patatin | ||||||
| Region | 678 – 687 | 10 | Calmodulin-binding | ||||||
| Region | 749 – 760 | 12 | Calmodulin-binding | ||||||
Sites | |||||||||
| Active site | 520 | 1 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 588 | 1 | Phosphothreonine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 396 – 451 | 56 | LITRK…LNNLE → Q in isoform Short. | VSP_044365 | |||||
Experimental info | |||||||||
| Sequence conflict | 24 | 1 | V → A in AAC53136. Ref.1 | ||||||
| Sequence conflict | 58 | 1 | V → D in AAC53136. Ref.1 | ||||||
| Sequence conflict | 68 | 1 | G → D in AAC53136. Ref.1 | ||||||
| Sequence conflict | 80 | 1 | A → V in AAC53136. Ref.1 | ||||||
| Sequence conflict | 99 | 1 | V → E in AAC53136. Ref.1 | ||||||
| Sequence conflict | 109 | 1 | Missing in AAC53136. Ref.1 | ||||||
| Sequence conflict | 142 | 1 | S → T in AAC53136. Ref.1 | ||||||
| Sequence conflict | 477 | 1 | S → T in AAC53136. Ref.1 | ||||||
| Sequence conflict | 793 | 1 | H → Y in AAC53136. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Pancreatic islets express a Ca2+-independent phospholipase A2 enzyme that contains a repeated structural homologous to the integral membrane protein binding domain of ankyrin." Ma Z., Ramanadham S., Kempe K., Chi X.S., Ladenson J., Turk J. J. Biol. Chem. 272:11118-11127(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SHORT). Strain: Sprague-Dawley. Tissue: Pancreatic islet. |
| [2] | "Genome sequence of the Brown Norway rat yields insights into mammalian evolution." Gibbs R.A., Weinstock G.M., Metzker M.L., Muzny D.M., Sodergren E.J., Scherer S., Scott G., Steffen D., Worley K.C., Burch P.E., Okwuonu G., Hines S., Lewis L., Deramo C., Delgado O., Dugan-Rocha S., Miner G., Morgan M. Collins F.S.Nature 428:493-521(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: Brown Norway. |
| [3] | Mural R.J., Li P.W., Adams M.D., Amanatides P.G., Baden-Tillson H., Barnstead M., Chin S.H., Dew I., Evans C.A., Ferriera S., Flanigan M., Fosler C., Glodek A., Gu Z., Holt R.A., Jennings D., Kraft C.L., Lu F. Zhong F.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: Brown Norway. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM LONG). Tissue: Testis. |
| [5] | "Identification of the calmodulin-binding domain of recombinant calcium-independent phospholipase A2beta. implications for structure and function." Jenkins C.M., Wolf M.J., Mancuso D.J., Gross R.W. J. Biol. Chem. 276:7129-7135(2001) [PubMed] [Europe PMC] [Abstract] Cited for: ENZYME REGULATION, CALMODULIN-BINDING REGIONS. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U51898 mRNA. Translation: AAC53136.1. AABR06052011 Genomic DNA. No translation available. CH473950 Genomic DNA. Translation: EDM15808.1. CH473950 Genomic DNA. Translation: EDM15809.1. BC081916 mRNA. Translation: AAH81916.1. |
| IPI | IPI00189942. IPI00205595. |
| RefSeq | NP_001005560.1. NM_001005560.1. NP_001257725.1. NM_001270796.1. |
| UniGene | Rn.44692. |
3D structure databases | |
| ProteinModelPortal | P97570. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P97570. 1 interaction. |
| STRING | 10116.ENSRNOP00000017104. |
PTM databases | |
| PhosphoSite | P97570. |
Proteomic databases | |
| PaxDb | P97570. |
| PRIDE | P97570. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSRNOT00000016827; ENSRNOP00000016827; ENSRNOG00000012295. ENSRNOT00000017108; ENSRNOP00000017104; ENSRNOG00000012295. |
| GeneID | 360426. |
| KEGG | rno:360426. |
| UCSC | RGD:628867. rat. |
Organism-specific databases | |
| CTD | 8398. |
| RGD | 628867. Pla2g6. |
Phylogenomic databases | |
| eggNOG | COG0666. |
| GeneTree | ENSGT00530000063645. |
| HOGENOM | HOG000013092. |
| HOVERGEN | HBG053482. |
| KO | K16343. |
| OMA | PNGRFLD. |
Enzyme and pathway databases | |
| Reactome | REACT_113568. Metabolism. |
Gene expression databases | |
| ArrayExpress | P97570. |
| Genevestigator | P97570. |
| GermOnline | ENSRNOG00000012295. Rattus norvegicus. |
Family and domain databases | |
| Gene3D | 1.25.40.20. 1 hit. |
| InterPro | IPR016035. Acyl_Trfase/lysoPLipase. IPR002110. Ankyrin_rpt. IPR020683. Ankyrin_rpt-contain_dom. IPR002641. Patatin/PLipase_A2-rel. [Graphical view] |
| Pfam | PF00023. Ank. 1 hit. PF12796. Ank_2. 2 hits. PF01734. Patatin. 1 hit. [Graphical view] |
| PRINTS | PR01415. ANKYRIN. |
| SMART | SM00248. ANK. 6 hits. [Graphical view] |
| SUPFAM | SSF52151. Acyl_Trfase/lysoPlipase. 1 hit. SSF48403. ANK. 1 hit. |
| PROSITE | PS50297. ANK_REP_REGION. 1 hit. PS50088. ANK_REPEAT. 4 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChEMBL | CHEMBL1075318. |
| NextBio | 35583980. |
Entry information
| Entry name | PLPL9_RAT | ||||||||
| Accession | Primary (citable) accession number: P97570 Secondary accession number(s): G3V7M8, Q66HD1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| SIMILARITY comments Index of protein domains and families |

Clusters with
