Reviewed,
UniProtKB/Swiss-Prot P97443 (SMYD1_MOUSE)
Last modified
June 16, 2009.
Version 62.
History...
Clusters with 100%,
90%,
50% identity |
 Documents (2) |
 Third-party data |
 Customize display | text xml rdf/xml gff fasta |
Names and origin · Protein attributes · General annotation (Comments) · Ontologies · Alternative products · Sequence annotation (Features) · Sequences · References · Cross-references · Entry information · Relevant documents
Names and origin
| Protein names | Recommended name: SET and MYND domain-containing protein 1 Alternative name(s): Zinc finger protein BOP Short name=m-BOP CD8b-opposite | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 485 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Acts as a transcriptional repressor. Essential for cardiomyocyte differentiation and cardiac morphogenesis. Ref.3 |
| Subunit structure | Interacts with HDAC1, HDAC2 and HDAC3. Ref.3 |
| Subcellular location | |
| Tissue specificity | Expressed in cardiac and skeletal muscle, lymphocytes and thymus. Ref.3 Ref.1 |
| Sequence similarities | Contains 1 MYND-type zinc finger. Contains 1 SET domain. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P97443-1) Also known as: ISKM-BOP1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P97443-2) Also known as: SKM-BOP2; The sequence of this isoform differs from the canonical sequence as follows: 215-215: N → K 216-228: Missing. | ||||||
| Isoform 3 (identifier: P97443-3) Also known as: T-BOP; The sequence of this isoform differs from the canonical sequence as follows: 1-40: MENVEVFTSEGKGRGLKATKEFWAADVIFAERAYSAVVFD → MKNGEACGGWQ |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 485 | 485 | SET and MYND domain-containing protein 1 | PRO_0000218308 | |||||
Regions | |||||||||
| Domain | 121 – 254 | 134 | SET | ||||||
| Zinc finger | 47 – 85 | 39 | MYND-type | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 40 | 40 | MENVE…AVVFD → MKNGEACGGWQ in isoform 3. Ref.1 | VSP_050402 | |||||
| Alternative sequence | 215 | 1 | N → K in isoform 2. Ref.1 | VSP_050403 | |||||
| Alternative sequence | 216 – 228 | 13 | Missing in isoform 2. Ref.1 | VSP_050404 | |||||
| Natural variant | 90 | 1 | K → R in strain: C57BL/6. Ref.1 | ||||||
| Natural variant | 155 | 1 | P → L in strain: C57BL/6. Ref.1 | ||||||
| Natural variant | 339 | 1 | A → T in strain: C57BL/6. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| [1] | "The Bop gene adjacent to the mouse CD8b gene encodes distinct zinc-finger proteins expressed in CTLs and in muscle." Hwang I., Gottlieb P.D. J. Immunol. 158:1165-1174(1997) [PubMed: 9013956] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), TISSUE SPECIFICITY, VARIANTS ARG-90; LEU-155 AND THR-339. Strain: BALB/c and C57BL/6. Tissue: Skeletal muscle and Spleen. |
| [2] | Gottlieb P.D., Hwang I. Submitted (SEP-1999) to the EMBL/GenBank/DDBJ databases Cited for: SEQUENCE REVISION TO N-TERMINUS. |
| [3] | "Bop encodes a muscle-restricted protein containing MYND and SET domains and is essential for cardiac differentiation and morphogenesis." Gottlieb P.D., Pierce S.A., Sims R.J. III, Yamagishi H., Weihe E.K., Harriss J.V., Maika S.D., Kuziel W.A., King H.L., Olson E.N., Nakagawa O., Srivastava D. Nat. Genet. 31:25-32(2002) [PubMed: 11923873] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INTERACTION WITH HDAC1; HDAC2 AND HDAC3. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| U76371 mRNA. Translation: AAC53020.1. U76373 mRNA. Translation: AAC53021.2. U76374 mRNA. Translation: AAC53022.2. | |
| IPI | IPI00118495. IPI00466794. IPI00621974. |
| RefSeq | NP_033892.1. |
| UniGene | Mm.234274 Mm.440892 |
3D structure databases | |
| ModBase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUSG00000055027. Mus musculus. [Contig view] |
| GeneID | 12180. |
| KEGG | mmu:12180. |
Organism-specific databases | |
| MGI | MGI:104790. Smyd1. |
Phylogenomic databases | |
| HOVERGEN | P97443. |
Gene expression databases | |
| ArrayExpress | P97443. |
| Bgee | P97443. |
| CleanEx | MM_SMYD1. |
| GermOnline | ENSMUSG00000055027. Mus musculus. |
Family and domain databases | |
| InterPro | IPR001214. SET. IPR002893. Znf_MYND. [Graphical view] |
| Pfam | PF00856. SET. 1 hit. PF01753. zf-MYND. 1 hit. [Graphical view] |
| SMART | SM00317. SET. 1 hit. [Graphical view] |
| PROSITE | PS50280. SET. 1 hit. PS01360. ZF_MYND_1. 1 hit. PS50865. ZF_MYND_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 280565. |
| SOURCE | Search... |
Entry information
| Entry name | SMYD1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: P97443 Secondary accession number(s): P97442, P97444 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |
