P97412 (LYST_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 109.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Lysosomal-trafficking regulator Alternative name(s): Beige protein CHS1 homolog | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 3788 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May be required for sorting endosomal resident proteins into late multivesicular endosomes by a mechanism involving microtubules. |
| Subunit structure | Interacts with CENPJ, LIP8 and ZNF521 By similarity. |
| Subcellular location | Cytoplasm Potential. |
| Involvement in disease | Defects in Lyst are the cause of beige, an autosomal recessive disorder characterized by hypopigmentation, bleeding, immune cell dysfunction, abnormal intracellular transport to and from the lysosome, and giant inclusion bodies in a variety of cell types. |
| Sequence similarities | Contains 1 BEACH domain. Contains 7 WD repeats. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: P97412-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P97412-2) The sequence of this isoform differs from the canonical sequence as follows: 1509-1545: EGDRPEVTESINPGDRLIEDGCIHLISLGSKALMIQV → GMMAGSDLYTKILQIAACLSFKHIWQYFNVFFKCYSP 1546-3788: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 3788 | 3788 | Lysosomal-trafficking regulator | PRO_0000051072 | |||||
Regions | |||||||||
| Repeat | 662 – 700 | 39 | WD 1 | ||||||
| Repeat | 1576 – 1620 | 45 | WD 2 | ||||||
| Domain | 3126 – 3409 | 284 | BEACH | ||||||
| Repeat | 3550 – 3589 | 40 | WD 3 | ||||||
| Repeat | 3601 – 3640 | 40 | WD 4 | ||||||
| Repeat | 3643 – 3686 | 44 | WD 5 | ||||||
| Repeat | 3687 – 3731 | 45 | WD 6 | ||||||
| Repeat | 3736 – 3775 | 40 | WD 7 | ||||||
Amino acid modifications | |||||||||
| Modified residue | 1503 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 1504 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 2099 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 2203 | 1 | Phosphoserine Ref.5 | ||||||
| Modified residue | 2207 | 1 | Phosphoserine Ref.5 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1509 – 1545 | 37 | EGDRP…LMIQV → GMMAGSDLYTKILQIAACLS FKHIWQYFNVFFKCYSP in isoform 2. | VSP_006783 | |||||
| Alternative sequence | 1546 – 3788 | 2243 | Missing in isoform 2. | VSP_006784 | |||||
Sequences
| ||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U70015 mRNA. Translation: AAC53011.1. L77884 mRNA. Translation: AAL40134.1. U52461 mRNA. Translation: AAB60778.1. |
| IPI | IPI00227912. IPI00399954. |
| PIR | T30851. |
| RefSeq | NP_034878.2. NM_010748.2. |
| UniGene | Mm.342337. |
3D structure databases | |
| ProteinModelPortal | P97412. |
| SMR | P97412. Positions 3010-3409, 3549-3770. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | P97412. |
Proteomic databases | |
| PaxDb | P97412. |
| PRIDE | P97412. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| GeneID | 17101. |
| KEGG | mmu:17101. |
| UCSC | uc007pmj.1. mouse. |
Organism-specific databases | |
| CTD | 1130. |
| MGI | MGI:107448. Lyst. |
Phylogenomic databases | |
| eggNOG | COG2319. |
| HOGENOM | HOG000113425. |
| HOVERGEN | HBG006300. |
| OrthoDB | EOG418BMF. |
Gene expression databases | |
| CleanEx | MM_LYST. |
| Genevestigator | P97412. |
| GermOnline | ENSMUSG00000019726. Mus musculus. |
Family and domain databases | |
| Gene3D | 1.10.1540.10. 1 hit. 2.130.10.10. 1 hit. 2.30.29.40. 1 hit. |
| InterPro | IPR000409. BEACH_dom. IPR023362. PH-BEACH_dom. IPR015943. WD40/YVTN_repeat-like_dom. IPR001680. WD40_repeat. IPR019775. WD40_repeat_CS. IPR017986. WD40_repeat_dom. [Graphical view] |
| Pfam | PF02138. Beach. 1 hit. PF00400. WD40. 2 hits. [Graphical view] |
| SMART | SM01026. Beach. 1 hit. SM00320. WD40. 4 hits. [Graphical view] |
| SUPFAM | SSF81837. Beige_BEACH. 1 hit. SSF50978. WD40_like. 1 hit. |
| PROSITE | PS50197. BEACH. 1 hit. PS00678. WD_REPEATS_1. 1 hit. PS50082. WD_REPEATS_2. 1 hit. PS50294. WD_REPEATS_REGION. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | LYST. mouse. |
| NextBio | 291244. |
| SOURCE | Search... |
Entry information
| Entry name | LYST_MOUSE | ||||||||
| Accession | Primary (citable) accession number: P97412 Secondary accession number(s): Q62403, Q8VBS6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
