Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P97412 (LYST_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 117. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Lysosomal-trafficking regulator
Alternative name(s):
Beige protein
CHS1 homolog
Gene names
Name:Lyst
Synonyms:Bg, Chs1
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length3788 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May be required for sorting endosomal resident proteins into late multivesicular endosomes by a mechanism involving microtubules.

Subunit structure

Interacts with CENPJ, LIP8 and ZNF521 By similarity.

Subcellular location

Cytoplasm Potential.

Involvement in disease

Defects in Lyst are the cause of beige, an autosomal recessive disorder characterized by hypopigmentation, bleeding, immune cell dysfunction, abnormal intracellular transport to and from the lysosome, and giant inclusion bodies in a variety of cell types.

Sequence similarities

Contains 1 BEACH domain.

Contains 7 WD repeats.

Ontologies

Keywords
   Biological processProtein transport
Transport
   Cellular componentCytoplasm
   Coding sequence diversityAlternative splicing
   DomainRepeat
WD repeat
   PTMPhosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processT cell mediated immunity

Inferred from mutant phenotype PubMed 6977094. Source: MGI

blood coagulation

Inferred from mutant phenotype PubMed 6696991. Source: MGI

defense response to bacterium

Inferred from mutant phenotype PubMed 4589319PubMed 4601767PubMed 7988496. Source: MGI

defense response to protozoan

Inferred from mutant phenotype PubMed 6218091. Source: MGI

defense response to virus

Inferred from mutant phenotype PubMed 6272291. Source: MGI

leukocyte chemotaxis

Inferred from mutant phenotype PubMed 4589319. Source: MGI

lysosome organization

Inferred from mutant phenotype PubMed 1113502PubMed 4031470PubMed 4697831PubMed 6170520PubMed 9368050. Source: MGI

mast cell secretory granule organization

Inferred from mutant phenotype PubMed 624833. Source: MGI

melanosome organization

Inferred from mutant phenotype PubMed 16518687PubMed 4634048. Source: MGI

microtubule-based process

Inferred from mutant phenotype PubMed 187062. Source: MGI

neutrophil mediated immunity

Inferred from mutant phenotype PubMed 7988496. Source: MGI

phospholipid homeostasis

Inferred from mutant phenotype PubMed 580786. Source: MGI

phospholipid metabolic process

Inferred from mutant phenotype PubMed 580786. Source: MGI

pigment granule organization

Inferred from mutant phenotype PubMed 1278263. Source: MGI

pigmentation

Inferred from mutant phenotype PubMed 13943454PubMed 2513223PubMed 4031470PubMed 7089489. Source: MGI

positive regulation of natural killer cell activation

Inferred from mutant phenotype PubMed 7089489. Source: MGI

response to drug

Inferred from mutant phenotype PubMed 2513223. Source: MGI

secretion of lysosomal enzymes

Inferred from mutant phenotype PubMed 408PubMed 7089489. Source: MGI

   Cellular_componentcytosol

Inferred from direct assay PubMed 9368050. Source: MGI

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: P97412-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: P97412-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1509-1545: EGDRPEVTESINPGDRLIEDGCIHLISLGSKALMIQV → GMMAGSDLYTKILQIAACLSFKHIWQYFNVFFKCYSP
     1546-3788: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 37883788Lysosomal-trafficking regulator
PRO_0000051072

Regions

Repeat662 – 70039WD 1
Repeat1576 – 162045WD 2
Domain3126 – 3409284BEACH
Repeat3550 – 358940WD 3
Repeat3601 – 364040WD 4
Repeat3643 – 368644WD 5
Repeat3687 – 373145WD 6
Repeat3736 – 377540WD 7

Amino acid modifications

Modified residue20991Phosphoserine By similarity
Modified residue22031Phosphoserine Ref.6

Natural variations

Alternative sequence1509 – 154537EGDRP…LMIQV → GMMAGSDLYTKILQIAACLS FKHIWQYFNVFFKCYSP in isoform 2.
VSP_006783
Alternative sequence1546 – 37882243Missing in isoform 2.
VSP_006784

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified May 1, 1997. Version 1.
Checksum: F01BE837C676A750

FASTA3,788425,287
        10         20         30         40         50         60 
MSTDSNSLAR EFLIDVNQLC NAVVQRAEAR EEEEEETHMA TLGQYLVHGR GFLLLTKLNS 

        70         80         90        100        110        120 
IIDQALTCRE ELLTLLLSLL PLVWKIPVQE QQATDFNLPL SSDIILTKEK NSSLQKSTQG 

       130        140        150        160        170        180 
KLYLEGSAPS GQVSAKVNLF RKIRRQRKST HRYSVRDARK TQLSTSDSEG NSDEKSTVVS 

       190        200        210        220        230        240 
KHRRLHALPR FLTQSPKEGH LVAKPDPSAT KEQVLSDTMS VENSREVILR QDSNGDILSE 

       250        260        270        280        290        300 
PAALSILSNM NNSPFDLCHV LLSLLEKVCK FDIALNHNSS LALSVVPTLT EFLAGFGDCC 

       310        320        330        340        350        360 
NQSDTLEGQL VSAGWTEEPV ALVQRMLFRT VLHLMSVDVS TAEAMPESLR KNLTELLRAA 

       370        380        390        400        410        420 
LKIRACLEKQ PEPFSPRQKK TLQEVQEGFV FSKYRHRALL LPELLEGVLQ LLISCLQSAA 

       430        440        450        460        470        480 
SNPFYFSQAM DLVQEFIQHQ GFNLFGTAVL QMEWLLTRDG VPSEAAEHLK ALINSVIKIM 

       490        500        510        520        530        540 
STVKKVKSEQ LHHSMCTRKR HRRCEYSHFM QHHRDLSGLL VSAFKNQLSK SPFEETAEGD 

       550        560        570        580        590        600 
VQYPERCCCI AVCAHQCLRL LQQVSLSTTC VQILSGVHSV GICCCMDPKS VIAPLLHAFK 

       610        620        630        640        650        660 
LPALKAFQQH ILNVLSKLLV DQLGGAELSP RIKKAACNIC TVDSDQLAKL GETLQGTLCG 

       670        680        690        700        710        720 
AGPTSGLPSP SYRFQGILPS SGSEDLLWKW DALEAYQSFV FQEDRLHNIQ IANHICNLLQ 

       730        740        750        760        770        780 
KGNVVVQWKL YNYIFNPVLQ RGVELVHHCQ QLSIPSAQTH MCSQLKQYLP QEVLQIYLKT 

       790        800        810        820        830        840 
LPVLLKSRVI RDLFLSCNGV NHIIELNYLD GIRSHSLKAF ETLIVSLGEQ QKDAAVLDVD 

       850        860        870        880        890        900 
GLDIQQELPS LSVGPSLHKQ QASSDSPCSL RKFYASLREP DPKKRKTIHQ DVHINTINLF 

       910        920        930        940        950        960 
LCVAFLCVSK EADSDRESAN ESEDTSGYDS PPSEPLSHML PCLSLEDVVL PSPECLHHAA 

       970        980        990       1000       1010       1020 
DIWSMCRWIY MLNSVFQKQF HRLGGFQVCH ELIFMIIQKL FRSHTEDQGR RQGEMSRNEN 

      1030       1040       1050       1060       1070       1080 
QELIRISYPE LTLKGDVSSA TAPDLGFLRK SADSVRGFQS QPVLPTSAEQ IVATESVPGE 

      1090       1100       1110       1120       1130       1140 
RKAFMSQQSE TSLQSIRLLE SLLDICLHSA RACQQKMELE LPSQGLSVEN ILCELREHLS 

      1150       1160       1170       1180       1190       1200 
QSKVAETELA KPLFDALLRV ALGNHSADLG PGDAVTEKSH PSEEELLSQP GDFSEEAEDS 

      1210       1220       1230       1240       1250       1260 
QCCSLKLLGE EEGYEADSES NPEDVDTQDD GVELNPEAEG FSGSIVSNNL LENLTHGEII 

      1270       1280       1290       1300       1310       1320 
YPEICMLGLN LLSASKAKLD VLAHVFESFL KIVRQKEKNI SLLIQQGTVK ILLGGFLNIL 

      1330       1340       1350       1360       1370       1380 
TQTNSDFQAC QRVLVDLLVS LMSSRTCSED LTLLWRIFLE KSPCTEILLL GIHKIVESDF 

      1390       1400       1410       1420       1430       1440 
TMSPSQCLTF PFLHTPSLSN GVLSQKPPGI LNSKALGLLR RARISRGKKE ADRESFPYRL 

      1450       1460       1470       1480       1490       1500 
LSSWHIAPIH LPLLGQNCWP HLSEGFSVSL VGLMWNTSNE SESAAERGKR VKKRNKPSVL 

      1510       1520       1530       1540       1550       1560 
EDSSFEGAEG DRPEVTESIN PGDRLIEDGC IHLISLGSKA LMIQVWADPH SGTFIFRVCM 

      1570       1580       1590       1600       1610       1620 
DSNDDTKAVS LAQVESQENI FFPSKWQHLV LTYIQHPQGK KNVHGEISIW VSGQRKTDVI 

      1630       1640       1650       1660       1670       1680 
LDFVLPRKTS LSSDSNKTFC MIGHCLTSQE ESLQLAGKWD LGNLLLFNGA KIGSQEAFFL 

      1690       1700       1710       1720       1730       1740 
YACGPNYTSI MPCKYGQPVI DYSKYINKDI LRCDEIRDLF MTKKEVDVGL LIESLSVVYT 

      1750       1760       1770       1780       1790       1800 
TCCPAQYTIY EPVIRLKGQV KTQPSQRPFS SKEAQSILLE PSQLKGLQPT ECKAIQGILH 

      1810       1820       1830       1840       1850       1860 
EIGGAGTFVF LFARVVELSS CEETQALALR VILSLIKYSQ QRTQELENCN GLSMIHQVLV 

      1870       1880       1890       1900       1910       1920 
KQKCIVGFHI LKTLLEGCCG EEVIHVSEHG EFKLDVESHA IIQDVKLLQE LLLDWKIWNK 

      1930       1940       1950       1960       1970       1980 
AEQGVWETLL AALEVLIRVE HHQQQFNIKQ LLNAHVVHHF LLTCQVLQEH REGQLTSMPR 

      1990       2000       2010       2020       2030       2040 
EVCRSFVKII AEVLGSPPDL ELLTVIFNFL LAVHPPTNTY VCHNPTNFYF SLHIDGKIFQ 

      2050       2060       2070       2080       2090       2100 
EKVQSLAYLR HSSSGGQAFP SPGFLVISPS AFTAAPPEGT SSSNIVPQRM AAQMVRSRSL 

      2110       2120       2130       2140       2150       2160 
PAFPTYLPLI RAQKLAASLG FSVDKLQNIA DANPEKQNLL GRPYALKTSK EEAFISSCES 

      2170       2180       2190       2200       2210       2220 
AKTVCEMEAL LGAHASANGV SRGSPRFPRA RVDHKDVGTE PRSDDDSPGD ESYPRRPDNL 

      2230       2240       2250       2260       2270       2280 
KGLASFQRSQ STVASLGLAF PSQNGSAVAS RWPSLVDRNA DDWENFTFSP AYEASYNRAT 

      2290       2300       2310       2320       2330       2340 
STHSVIEDCL IPICCGLYEL LSGVLLVLPD AMLEDVMDRI IQADILLVLV NHPSPAIQQG 

      2350       2360       2370       2380       2390       2400 
VIKLLHAYIN RASKEQKDKF LKNRGFSLLA NQLYLHRGTQ ELLECFVEMF FGRPIGLDEE 

      2410       2420       2430       2440       2450       2460 
FDLEEVKHME LFQKWSVIPV LGLIETSLYD NVLLHNALLL LLQVLNSCSK VADMLLDNGL 

      2470       2480       2490       2500       2510       2520 
LYVLCNTVAA LNGLEKNIPV NEYKLLACDI QQLFIAVTIH ACSSSGTQYF RVIEDLIVLL 

      2530       2540       2550       2560       2570       2580 
GYLHNSKNKR TQNMALALQL RVLQAALEFI RSTANHDSES PVHSPSAHRH SVPPKRRSIA 

      2590       2600       2610       2620       2630       2640 
GSRKFPLAQT ESLLMKMRSV ASDELHSMMQ RRMSQEHPSQ ASEAELAQRL QRLTILAVNR 

      2650       2660       2670       2680       2690       2700 
IIYQELNSDI IDILRTPENT SQSKTSVSQT EISEEDMHHE QPSVYNPFQK EMLTYLLDGF 

      2710       2720       2730       2740       2750       2760 
KVCIGSSKTS VSKQQWTKIL GSCKETLRDQ LGRLLAHILS PTHTVQERKQ ILEIVHEPAH 

      2770       2780       2790       2800       2810       2820 
QDILRDCLSP SPQHGAKLVL YLSELIHNHQ DELSEEEMDT AELLMNALKL CGHKCIPPSA 

      2830       2840       2850       2860       2870       2880 
PSKPELIKII REEQKKYESE ESVSKGSWQK TVNNNQQSLF QRLDFKSKDI SKIAADITQA 

      2890       2900       2910       2920       2930       2940 
VSLSQGIERK KVIQHIRGMY KVDLSASRHW QECIQQLTHD RAVWYDPIYY PTSWQLDPTE 

      2950       2960       2970       2980       2990       3000 
GPNRERRRLQ RCYLTIPNKY LLRDRQKSEG VLRPPLSYLF EDKTHSSFSS TVKDKAASES 

      3010       3020       3030       3040       3050       3060 
IRVNRRCISV APSRETAGEL LLGKCGMYFV EDNASDAVES SSLQGELEPA SFSWTYEEIK 

      3070       3080       3090       3100       3110       3120 
EVHRRWWQLR DNAVEIFLTN GRTLLLAFDN NKVRDDVYQS ILTNNLPNLL EYGNITALTN 

      3130       3140       3150       3160       3170       3180 
LWYSGQITNF EYLTHLNKHA GRSFNDLMQY PVFPFILSDY VSETLDLNDP SIYRNLSKPI 

      3190       3200       3210       3220       3230       3240 
AVQYKEKEDR YVDTYKYLEE EYRKGAREDD PMPPVQPYHY GSHYSNSGTV LHFLVRMPPF 

      3250       3260       3270       3280       3290       3300 
TKMFLAYQDQ SFDIPDRTFH STNTTWRLSS FESMTDVKEL IPEFFYLPEF LVNREGFDFG 

      3310       3320       3330       3340       3350       3360 
VRQNGERVNH VNLPPWARND PRLFILIHRQ ALESDHVSQN ICHWIDLVFG YKQKGKASVQ 

      3370       3380       3390       3400       3410       3420 
AINVFHPATY FGMDVSAVED PVQRRALETM IKTYGQTPRQ LFHTAHASRP GAKLNIEGEL 

      3430       3440       3450       3460       3470       3480 
PAAVGLLVQF AFRETREPVK EVTHPSPLSW IKGLKWGEYV GSPSAPVPVV CFSQPHGERF 

      3490       3500       3510       3520       3530       3540 
GSLQALPTRA ICGLSRNFCL LMTYNKEQGV RSMNNTNIQW SAILSWGYAD NILRLKSKQS 

      3550       3560       3570       3580       3590       3600 
EPPINFIQSS QQHQVTSCAW VPDSCQLFTG SKCGVITAYT NRLTSSTPSE IEMESQMHLY 

      3610       3620       3630       3640       3650       3660 
GHTEEITGLC VCKPYSVMIS VSRDGTCIVW DLNRLCYVQS LAGHKSPVTA VSASETSGDI 

      3670       3680       3690       3700       3710       3720 
ATVCDSAGGG SDLRLWTVNG DLVGHVHCRE IICSVAFSNQ PEGVSINVIA GGLENGIVRL 

      3730       3740       3750       3760       3770       3780 
WSTWDLKPVR EITFPKSNKP IISLTFSCDG HHLYTANSEG TVIAWCRKDQ QRVKLPMFYS 


FLSSYAAG 

« Hide

Isoform 2 [UniParc].

Checksum: A346094C0E5C419A
Show »

FASTA1,545172,458

References

« Hide 'large scale' references
[1]"Identification of mutations in two major mRNA isoforms of the Chediak-Higashi syndrome gene in human and mouse."
Barbosa M.D.F.S., Barrat F.J., Tchernev V.T., Nguyen Q.A., Mishra V.S., Colman S.D., Pastural E., Dufourcq-Lagelouse R., Fischer A., Holcombe R.F., Wallace M.R., Brandt S.J., De Saint Basile G., Kingsmore S.F.
Hum. Mol. Genet. 6:1091-1098(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[2]"Identification of the homologous beige and Chediak-Higashi syndrome genes."
Barbosa M.D.F.S., Nguyen Q.A., Tchernev V.T., Ashley J.A., Detter J.C., Blaydes S.M., Brandt S.J., Chotai D., Hodgman C., Solari R.C.E.S., Lovett M., Kingsmore S.F.
Nature 382:262-265(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
Strain: C57BL/6J.
[3]Erratum
Barbosa M.D.F.S., Nguyen Q.A., Tchernev V.T., Ashley J.A., Detter J.C., Blaydes S.M., Brandt S.J., Chotai D., Hodgman C., Solari R.C.E.S., Lovett M., Kingsmore S.F.
Nature 385:97-97(1997)
[4]"Identification of the murine beige gene by YAC complementation and positional cloning."
Perou C.M., Moore K.J., Nagle D.L., Misumi D.J., Woolf E.A., McGrail S.H., Holmgren L., Brody T.B., Dussault B.J., Monroe C.A., Duyk G.M., Pryor R.J., Li L., Justice M.J., Kaplan J.
Nat. Genet. 13:303-308(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1428-3788 (ISOFORM 1).
Strain: C57BL/6J.
[5]"Comprehensive identification of phosphorylation sites in postsynaptic density preparations."
Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L.
Mol. Cell. Proteomics 5:914-922(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Brain.
[6]"Large-scale phosphorylation analysis of mouse liver."
Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-2203, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Liver.
[7]"Large scale localization of protein phosphorylation by use of electron capture dissociation mass spectrometry."
Sweet S.M., Bailey C.M., Cunningham D.L., Heath J.K., Cooper H.J.
Mol. Cell. Proteomics 8:904-912(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Embryonic fibroblast.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U70015 mRNA. Translation: AAC53011.1.
L77884 mRNA. Translation: AAL40134.1.
U52461 mRNA. Translation: AAB60778.1.
PIRT30851.
RefSeqNP_034878.2. NM_010748.2.
UniGeneMm.342337.

3D structure databases

ProteinModelPortalP97412.
SMRP97412. Positions 3010-3409, 3549-3770.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

IntActP97412. 1 interaction.
MINTMINT-4100871.

PTM databases

PhosphoSiteP97412.

Proteomic databases

PaxDbP97412.
PRIDEP97412.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

GeneID17101.
KEGGmmu:17101.

Organism-specific databases

CTD1130.
MGIMGI:107448. Lyst.

Phylogenomic databases

eggNOGCOG2319.
HOGENOMHOG000113425.
HOVERGENHBG006300.
PhylomeDBP97412.

Gene expression databases

CleanExMM_LYST.
GenevestigatorP97412.

Family and domain databases

Gene3D1.10.1540.10. 1 hit.
2.130.10.10. 1 hit.
2.30.29.40. 1 hit.
InterProIPR016024. ARM-type_fold.
IPR000409. BEACH_dom.
IPR023362. PH-BEACH_dom.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamPF02138. Beach. 1 hit.
PF14844. PH_BEACH. 1 hit.
PF00400. WD40. 2 hits.
[Graphical view]
SMARTSM01026. Beach. 1 hit.
SM00320. WD40. 4 hits.
[Graphical view]
SUPFAMSSF48371. SSF48371. 5 hits.
SSF50978. SSF50978. 1 hit.
SSF81837. SSF81837. 1 hit.
PROSITEPS50197. BEACH. 1 hit.
PS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 1 hit.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSLYST. mouse.
NextBio291244.
PROP97412.
SOURCESearch...

Entry information

Entry nameLYST_MOUSE
AccessionPrimary (citable) accession number: P97412
Secondary accession number(s): Q62403, Q8VBS6
Entry history
Integrated into UniProtKB/Swiss-Prot: November 15, 2002
Last sequence update: May 1, 1997
Last modified: April 16, 2014
This is version 117 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot