Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P97412

- LYST_MOUSE

UniProt

P97412 - LYST_MOUSE

Protein

Lysosomal-trafficking regulator

Gene

Lyst

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 119 (01 Oct 2014)
      Sequence version 1 (01 May 1997)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May be required for sorting endosomal resident proteins into late multivesicular endosomes by a mechanism involving microtubules.

    GO - Biological processi

    1. blood coagulation Source: MGI
    2. defense response to bacterium Source: MGI
    3. defense response to protozoan Source: MGI
    4. defense response to virus Source: MGI
    5. leukocyte chemotaxis Source: MGI
    6. lysosome organization Source: MGI
    7. mast cell secretory granule organization Source: MGI
    8. melanosome organization Source: MGI
    9. microtubule-based process Source: MGI
    10. neutrophil mediated immunity Source: MGI
    11. phospholipid homeostasis Source: MGI
    12. phospholipid metabolic process Source: MGI
    13. pigmentation Source: MGI
    14. pigment granule organization Source: MGI
    15. positive regulation of natural killer cell activation Source: MGI
    16. response to drug Source: MGI
    17. secretion of lysosomal enzymes Source: MGI
    18. T cell mediated immunity Source: MGI

    Keywords - Biological processi

    Protein transport, Transport

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Lysosomal-trafficking regulator
    Alternative name(s):
    Beige protein
    CHS1 homolog
    Gene namesi
    Name:Lyst
    Synonyms:Bg, Chs1
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Unplaced

    Organism-specific databases

    MGIiMGI:107448. Lyst.

    Subcellular locationi

    Cytoplasm Curated

    GO - Cellular componenti

    1. cytosol Source: MGI

    Keywords - Cellular componenti

    Cytoplasm

    Pathology & Biotechi

    Involvement in diseasei

    Defects in Lyst are the cause of beige, an autosomal recessive disorder characterized by hypopigmentation, bleeding, immune cell dysfunction, abnormal intracellular transport to and from the lysosome, and giant inclusion bodies in a variety of cell types.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 37883788Lysosomal-trafficking regulatorPRO_0000051072Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei2099 – 20991PhosphoserineBy similarity
    Modified residuei2203 – 22031Phosphoserine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    PaxDbiP97412.
    PRIDEiP97412.

    PTM databases

    PhosphoSiteiP97412.

    Expressioni

    Gene expression databases

    CleanExiMM_LYST.
    GenevestigatoriP97412.

    Interactioni

    Subunit structurei

    Interacts with CENPJ, LIP8 and ZNF521.By similarity

    Protein-protein interaction databases

    IntActiP97412. 1 interaction.
    MINTiMINT-4100871.

    Structurei

    3D structure databases

    ProteinModelPortaliP97412.
    SMRiP97412. Positions 3010-3409, 3523-3770.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati662 – 70039WD 1Add
    BLAST
    Repeati1576 – 162045WD 2Add
    BLAST
    Domaini3126 – 3409284BEACHPROSITE-ProRule annotationAdd
    BLAST
    Repeati3550 – 358940WD 3Add
    BLAST
    Repeati3601 – 364040WD 4Add
    BLAST
    Repeati3643 – 368644WD 5Add
    BLAST
    Repeati3687 – 373145WD 6Add
    BLAST
    Repeati3736 – 377540WD 7Add
    BLAST

    Sequence similaritiesi

    Contains 1 BEACH domain.PROSITE-ProRule annotation
    Contains 7 WD repeats.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, WD repeat

    Phylogenomic databases

    eggNOGiCOG2319.
    HOGENOMiHOG000113425.
    HOVERGENiHBG006300.
    PhylomeDBiP97412.

    Family and domain databases

    Gene3Di1.10.1540.10. 1 hit.
    2.130.10.10. 1 hit.
    2.30.29.40. 1 hit.
    InterProiIPR016024. ARM-type_fold.
    IPR000409. BEACH_dom.
    IPR023362. PH-BEACH_dom.
    IPR015943. WD40/YVTN_repeat-like_dom.
    IPR001680. WD40_repeat.
    IPR019775. WD40_repeat_CS.
    IPR017986. WD40_repeat_dom.
    [Graphical view]
    PfamiPF02138. Beach. 1 hit.
    PF14844. PH_BEACH. 1 hit.
    PF00400. WD40. 2 hits.
    [Graphical view]
    SMARTiSM01026. Beach. 1 hit.
    SM00320. WD40. 4 hits.
    [Graphical view]
    SUPFAMiSSF48371. SSF48371. 5 hits.
    SSF50978. SSF50978. 1 hit.
    SSF81837. SSF81837. 1 hit.
    PROSITEiPS50197. BEACH. 1 hit.
    PS00678. WD_REPEATS_1. 1 hit.
    PS50082. WD_REPEATS_2. 1 hit.
    PS50294. WD_REPEATS_REGION. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Note: Additional isoforms seem to exist.

    Isoform 1 (identifier: P97412-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSTDSNSLAR EFLIDVNQLC NAVVQRAEAR EEEEEETHMA TLGQYLVHGR     50
    GFLLLTKLNS IIDQALTCRE ELLTLLLSLL PLVWKIPVQE QQATDFNLPL 100
    SSDIILTKEK NSSLQKSTQG KLYLEGSAPS GQVSAKVNLF RKIRRQRKST 150
    HRYSVRDARK TQLSTSDSEG NSDEKSTVVS KHRRLHALPR FLTQSPKEGH 200
    LVAKPDPSAT KEQVLSDTMS VENSREVILR QDSNGDILSE PAALSILSNM 250
    NNSPFDLCHV LLSLLEKVCK FDIALNHNSS LALSVVPTLT EFLAGFGDCC 300
    NQSDTLEGQL VSAGWTEEPV ALVQRMLFRT VLHLMSVDVS TAEAMPESLR 350
    KNLTELLRAA LKIRACLEKQ PEPFSPRQKK TLQEVQEGFV FSKYRHRALL 400
    LPELLEGVLQ LLISCLQSAA SNPFYFSQAM DLVQEFIQHQ GFNLFGTAVL 450
    QMEWLLTRDG VPSEAAEHLK ALINSVIKIM STVKKVKSEQ LHHSMCTRKR 500
    HRRCEYSHFM QHHRDLSGLL VSAFKNQLSK SPFEETAEGD VQYPERCCCI 550
    AVCAHQCLRL LQQVSLSTTC VQILSGVHSV GICCCMDPKS VIAPLLHAFK 600
    LPALKAFQQH ILNVLSKLLV DQLGGAELSP RIKKAACNIC TVDSDQLAKL 650
    GETLQGTLCG AGPTSGLPSP SYRFQGILPS SGSEDLLWKW DALEAYQSFV 700
    FQEDRLHNIQ IANHICNLLQ KGNVVVQWKL YNYIFNPVLQ RGVELVHHCQ 750
    QLSIPSAQTH MCSQLKQYLP QEVLQIYLKT LPVLLKSRVI RDLFLSCNGV 800
    NHIIELNYLD GIRSHSLKAF ETLIVSLGEQ QKDAAVLDVD GLDIQQELPS 850
    LSVGPSLHKQ QASSDSPCSL RKFYASLREP DPKKRKTIHQ DVHINTINLF 900
    LCVAFLCVSK EADSDRESAN ESEDTSGYDS PPSEPLSHML PCLSLEDVVL 950
    PSPECLHHAA DIWSMCRWIY MLNSVFQKQF HRLGGFQVCH ELIFMIIQKL 1000
    FRSHTEDQGR RQGEMSRNEN QELIRISYPE LTLKGDVSSA TAPDLGFLRK 1050
    SADSVRGFQS QPVLPTSAEQ IVATESVPGE RKAFMSQQSE TSLQSIRLLE 1100
    SLLDICLHSA RACQQKMELE LPSQGLSVEN ILCELREHLS QSKVAETELA 1150
    KPLFDALLRV ALGNHSADLG PGDAVTEKSH PSEEELLSQP GDFSEEAEDS 1200
    QCCSLKLLGE EEGYEADSES NPEDVDTQDD GVELNPEAEG FSGSIVSNNL 1250
    LENLTHGEII YPEICMLGLN LLSASKAKLD VLAHVFESFL KIVRQKEKNI 1300
    SLLIQQGTVK ILLGGFLNIL TQTNSDFQAC QRVLVDLLVS LMSSRTCSED 1350
    LTLLWRIFLE KSPCTEILLL GIHKIVESDF TMSPSQCLTF PFLHTPSLSN 1400
    GVLSQKPPGI LNSKALGLLR RARISRGKKE ADRESFPYRL LSSWHIAPIH 1450
    LPLLGQNCWP HLSEGFSVSL VGLMWNTSNE SESAAERGKR VKKRNKPSVL 1500
    EDSSFEGAEG DRPEVTESIN PGDRLIEDGC IHLISLGSKA LMIQVWADPH 1550
    SGTFIFRVCM DSNDDTKAVS LAQVESQENI FFPSKWQHLV LTYIQHPQGK 1600
    KNVHGEISIW VSGQRKTDVI LDFVLPRKTS LSSDSNKTFC MIGHCLTSQE 1650
    ESLQLAGKWD LGNLLLFNGA KIGSQEAFFL YACGPNYTSI MPCKYGQPVI 1700
    DYSKYINKDI LRCDEIRDLF MTKKEVDVGL LIESLSVVYT TCCPAQYTIY 1750
    EPVIRLKGQV KTQPSQRPFS SKEAQSILLE PSQLKGLQPT ECKAIQGILH 1800
    EIGGAGTFVF LFARVVELSS CEETQALALR VILSLIKYSQ QRTQELENCN 1850
    GLSMIHQVLV KQKCIVGFHI LKTLLEGCCG EEVIHVSEHG EFKLDVESHA 1900
    IIQDVKLLQE LLLDWKIWNK AEQGVWETLL AALEVLIRVE HHQQQFNIKQ 1950
    LLNAHVVHHF LLTCQVLQEH REGQLTSMPR EVCRSFVKII AEVLGSPPDL 2000
    ELLTVIFNFL LAVHPPTNTY VCHNPTNFYF SLHIDGKIFQ EKVQSLAYLR 2050
    HSSSGGQAFP SPGFLVISPS AFTAAPPEGT SSSNIVPQRM AAQMVRSRSL 2100
    PAFPTYLPLI RAQKLAASLG FSVDKLQNIA DANPEKQNLL GRPYALKTSK 2150
    EEAFISSCES AKTVCEMEAL LGAHASANGV SRGSPRFPRA RVDHKDVGTE 2200
    PRSDDDSPGD ESYPRRPDNL KGLASFQRSQ STVASLGLAF PSQNGSAVAS 2250
    RWPSLVDRNA DDWENFTFSP AYEASYNRAT STHSVIEDCL IPICCGLYEL 2300
    LSGVLLVLPD AMLEDVMDRI IQADILLVLV NHPSPAIQQG VIKLLHAYIN 2350
    RASKEQKDKF LKNRGFSLLA NQLYLHRGTQ ELLECFVEMF FGRPIGLDEE 2400
    FDLEEVKHME LFQKWSVIPV LGLIETSLYD NVLLHNALLL LLQVLNSCSK 2450
    VADMLLDNGL LYVLCNTVAA LNGLEKNIPV NEYKLLACDI QQLFIAVTIH 2500
    ACSSSGTQYF RVIEDLIVLL GYLHNSKNKR TQNMALALQL RVLQAALEFI 2550
    RSTANHDSES PVHSPSAHRH SVPPKRRSIA GSRKFPLAQT ESLLMKMRSV 2600
    ASDELHSMMQ RRMSQEHPSQ ASEAELAQRL QRLTILAVNR IIYQELNSDI 2650
    IDILRTPENT SQSKTSVSQT EISEEDMHHE QPSVYNPFQK EMLTYLLDGF 2700
    KVCIGSSKTS VSKQQWTKIL GSCKETLRDQ LGRLLAHILS PTHTVQERKQ 2750
    ILEIVHEPAH QDILRDCLSP SPQHGAKLVL YLSELIHNHQ DELSEEEMDT 2800
    AELLMNALKL CGHKCIPPSA PSKPELIKII REEQKKYESE ESVSKGSWQK 2850
    TVNNNQQSLF QRLDFKSKDI SKIAADITQA VSLSQGIERK KVIQHIRGMY 2900
    KVDLSASRHW QECIQQLTHD RAVWYDPIYY PTSWQLDPTE GPNRERRRLQ 2950
    RCYLTIPNKY LLRDRQKSEG VLRPPLSYLF EDKTHSSFSS TVKDKAASES 3000
    IRVNRRCISV APSRETAGEL LLGKCGMYFV EDNASDAVES SSLQGELEPA 3050
    SFSWTYEEIK EVHRRWWQLR DNAVEIFLTN GRTLLLAFDN NKVRDDVYQS 3100
    ILTNNLPNLL EYGNITALTN LWYSGQITNF EYLTHLNKHA GRSFNDLMQY 3150
    PVFPFILSDY VSETLDLNDP SIYRNLSKPI AVQYKEKEDR YVDTYKYLEE 3200
    EYRKGAREDD PMPPVQPYHY GSHYSNSGTV LHFLVRMPPF TKMFLAYQDQ 3250
    SFDIPDRTFH STNTTWRLSS FESMTDVKEL IPEFFYLPEF LVNREGFDFG 3300
    VRQNGERVNH VNLPPWARND PRLFILIHRQ ALESDHVSQN ICHWIDLVFG 3350
    YKQKGKASVQ AINVFHPATY FGMDVSAVED PVQRRALETM IKTYGQTPRQ 3400
    LFHTAHASRP GAKLNIEGEL PAAVGLLVQF AFRETREPVK EVTHPSPLSW 3450
    IKGLKWGEYV GSPSAPVPVV CFSQPHGERF GSLQALPTRA ICGLSRNFCL 3500
    LMTYNKEQGV RSMNNTNIQW SAILSWGYAD NILRLKSKQS EPPINFIQSS 3550
    QQHQVTSCAW VPDSCQLFTG SKCGVITAYT NRLTSSTPSE IEMESQMHLY 3600
    GHTEEITGLC VCKPYSVMIS VSRDGTCIVW DLNRLCYVQS LAGHKSPVTA 3650
    VSASETSGDI ATVCDSAGGG SDLRLWTVNG DLVGHVHCRE IICSVAFSNQ 3700
    PEGVSINVIA GGLENGIVRL WSTWDLKPVR EITFPKSNKP IISLTFSCDG 3750
    HHLYTANSEG TVIAWCRKDQ QRVKLPMFYS FLSSYAAG 3788
    Length:3,788
    Mass (Da):425,287
    Last modified:May 1, 1997 - v1
    Checksum:iF01BE837C676A750
    GO
    Isoform 2 (identifier: P97412-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1509-1545: EGDRPEVTESINPGDRLIEDGCIHLISLGSKALMIQV → GMMAGSDLYTKILQIAACLSFKHIWQYFNVFFKCYSP
         1546-3788: Missing.

    Show »
    Length:1,545
    Mass (Da):172,458
    Checksum:iA346094C0E5C419A
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1509 – 154537EGDRP…LMIQV → GMMAGSDLYTKILQIAACLS FKHIWQYFNVFFKCYSP in isoform 2. 1 PublicationVSP_006783Add
    BLAST
    Alternative sequencei1546 – 37882243Missing in isoform 2. 1 PublicationVSP_006784Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U70015 mRNA. Translation: AAC53011.1.
    L77884 mRNA. Translation: AAL40134.1.
    U52461 mRNA. Translation: AAB60778.1.
    PIRiT30851.
    RefSeqiNP_034878.2. NM_010748.2.
    UniGeneiMm.342337.

    Genome annotation databases

    GeneIDi17101.
    KEGGimmu:17101.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U70015 mRNA. Translation: AAC53011.1 .
    L77884 mRNA. Translation: AAL40134.1 .
    U52461 mRNA. Translation: AAB60778.1 .
    PIRi T30851.
    RefSeqi NP_034878.2. NM_010748.2.
    UniGenei Mm.342337.

    3D structure databases

    ProteinModelPortali P97412.
    SMRi P97412. Positions 3010-3409, 3523-3770.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    IntActi P97412. 1 interaction.
    MINTi MINT-4100871.

    PTM databases

    PhosphoSitei P97412.

    Proteomic databases

    PaxDbi P97412.
    PRIDEi P97412.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    GeneIDi 17101.
    KEGGi mmu:17101.

    Organism-specific databases

    CTDi 1130.
    MGIi MGI:107448. Lyst.

    Phylogenomic databases

    eggNOGi COG2319.
    HOGENOMi HOG000113425.
    HOVERGENi HBG006300.
    PhylomeDBi P97412.

    Miscellaneous databases

    ChiTaRSi LYST. mouse.
    NextBioi 291244.
    PROi P97412.
    SOURCEi Search...

    Gene expression databases

    CleanExi MM_LYST.
    Genevestigatori P97412.

    Family and domain databases

    Gene3Di 1.10.1540.10. 1 hit.
    2.130.10.10. 1 hit.
    2.30.29.40. 1 hit.
    InterProi IPR016024. ARM-type_fold.
    IPR000409. BEACH_dom.
    IPR023362. PH-BEACH_dom.
    IPR015943. WD40/YVTN_repeat-like_dom.
    IPR001680. WD40_repeat.
    IPR019775. WD40_repeat_CS.
    IPR017986. WD40_repeat_dom.
    [Graphical view ]
    Pfami PF02138. Beach. 1 hit.
    PF14844. PH_BEACH. 1 hit.
    PF00400. WD40. 2 hits.
    [Graphical view ]
    SMARTi SM01026. Beach. 1 hit.
    SM00320. WD40. 4 hits.
    [Graphical view ]
    SUPFAMi SSF48371. SSF48371. 5 hits.
    SSF50978. SSF50978. 1 hit.
    SSF81837. SSF81837. 1 hit.
    PROSITEi PS50197. BEACH. 1 hit.
    PS00678. WD_REPEATS_1. 1 hit.
    PS50082. WD_REPEATS_2. 1 hit.
    PS50294. WD_REPEATS_REGION. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
      Strain: C57BL/6J.
    3. Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1428-3788 (ISOFORM 1).
      Strain: C57BL/6J.
    4. "Comprehensive identification of phosphorylation sites in postsynaptic density preparations."
      Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L.
      Mol. Cell. Proteomics 5:914-922(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Brain.
    5. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-2203, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Liver.
    6. "Large scale localization of protein phosphorylation by use of electron capture dissociation mass spectrometry."
      Sweet S.M., Bailey C.M., Cunningham D.L., Heath J.K., Cooper H.J.
      Mol. Cell. Proteomics 8:904-912(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Embryonic fibroblast.

    Entry informationi

    Entry nameiLYST_MOUSE
    AccessioniPrimary (citable) accession number: P97412
    Secondary accession number(s): Q62403, Q8VBS6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 15, 2002
    Last sequence update: May 1, 1997
    Last modified: October 1, 2014
    This is version 119 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3