SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P97412

- LYST_MOUSE

UniProt

P97412 - LYST_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Lysosomal-trafficking regulator
Gene
Lyst, Bg, Chs1
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

May be required for sorting endosomal resident proteins into late multivesicular endosomes by a mechanism involving microtubules.

GO - Biological processi

  1. T cell mediated immunity Source: MGI
  2. blood coagulation Source: MGI
  3. defense response to bacterium Source: MGI
  4. defense response to protozoan Source: MGI
  5. defense response to virus Source: MGI
  6. leukocyte chemotaxis Source: MGI
  7. lysosome organization Source: MGI
  8. mast cell secretory granule organization Source: MGI
  9. melanosome organization Source: MGI
  10. microtubule-based process Source: MGI
  11. neutrophil mediated immunity Source: MGI
  12. phospholipid homeostasis Source: MGI
  13. phospholipid metabolic process Source: MGI
  14. pigment granule organization Source: MGI
  15. pigmentation Source: MGI
  16. positive regulation of natural killer cell activation Source: MGI
  17. response to drug Source: MGI
  18. secretion of lysosomal enzymes Source: MGI
Complete GO annotation...

Keywords - Biological processi

Protein transport, Transport

Names & Taxonomyi

Protein namesi
Recommended name:
Lysosomal-trafficking regulator
Alternative name(s):
Beige protein
CHS1 homolog
Gene namesi
Name:Lyst
Synonyms:Bg, Chs1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Unplaced

Organism-specific databases

MGIiMGI:107448. Lyst.

Subcellular locationi

Cytoplasm Reviewed prediction

GO - Cellular componenti

  1. cytosol Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Involvement in diseasei

Defects in Lyst are the cause of beige, an autosomal recessive disorder characterized by hypopigmentation, bleeding, immune cell dysfunction, abnormal intracellular transport to and from the lysosome, and giant inclusion bodies in a variety of cell types.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 37883788Lysosomal-trafficking regulator
PRO_0000051072Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2099 – 20991Phosphoserine By similarity
Modified residuei2203 – 22031Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiP97412.
PRIDEiP97412.

PTM databases

PhosphoSiteiP97412.

Expressioni

Gene expression databases

CleanExiMM_LYST.
GenevestigatoriP97412.

Interactioni

Subunit structurei

Interacts with CENPJ, LIP8 and ZNF521 By similarity.

Protein-protein interaction databases

IntActiP97412. 1 interaction.
MINTiMINT-4100871.

Structurei

3D structure databases

ProteinModelPortaliP97412.
SMRiP97412. Positions 3010-3409, 3523-3770.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati662 – 70039WD 1
Add
BLAST
Repeati1576 – 162045WD 2
Add
BLAST
Domaini3126 – 3409284BEACH
Add
BLAST
Repeati3550 – 358940WD 3
Add
BLAST
Repeati3601 – 364040WD 4
Add
BLAST
Repeati3643 – 368644WD 5
Add
BLAST
Repeati3687 – 373145WD 6
Add
BLAST
Repeati3736 – 377540WD 7
Add
BLAST

Sequence similaritiesi

Contains 1 BEACH domain.
Contains 7 WD repeats.

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiCOG2319.
HOGENOMiHOG000113425.
HOVERGENiHBG006300.
PhylomeDBiP97412.

Family and domain databases

Gene3Di1.10.1540.10. 1 hit.
2.130.10.10. 1 hit.
2.30.29.40. 1 hit.
InterProiIPR016024. ARM-type_fold.
IPR000409. BEACH_dom.
IPR023362. PH-BEACH_dom.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF02138. Beach. 1 hit.
PF14844. PH_BEACH. 1 hit.
PF00400. WD40. 2 hits.
[Graphical view]
SMARTiSM01026. Beach. 1 hit.
SM00320. WD40. 4 hits.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 5 hits.
SSF50978. SSF50978. 1 hit.
SSF81837. SSF81837. 1 hit.
PROSITEiPS50197. BEACH. 1 hit.
PS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 1 hit.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Note: Additional isoforms seem to exist.

Isoform 1 (identifier: P97412-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MSTDSNSLAR EFLIDVNQLC NAVVQRAEAR EEEEEETHMA TLGQYLVHGR     50
GFLLLTKLNS IIDQALTCRE ELLTLLLSLL PLVWKIPVQE QQATDFNLPL 100
SSDIILTKEK NSSLQKSTQG KLYLEGSAPS GQVSAKVNLF RKIRRQRKST 150
HRYSVRDARK TQLSTSDSEG NSDEKSTVVS KHRRLHALPR FLTQSPKEGH 200
LVAKPDPSAT KEQVLSDTMS VENSREVILR QDSNGDILSE PAALSILSNM 250
NNSPFDLCHV LLSLLEKVCK FDIALNHNSS LALSVVPTLT EFLAGFGDCC 300
NQSDTLEGQL VSAGWTEEPV ALVQRMLFRT VLHLMSVDVS TAEAMPESLR 350
KNLTELLRAA LKIRACLEKQ PEPFSPRQKK TLQEVQEGFV FSKYRHRALL 400
LPELLEGVLQ LLISCLQSAA SNPFYFSQAM DLVQEFIQHQ GFNLFGTAVL 450
QMEWLLTRDG VPSEAAEHLK ALINSVIKIM STVKKVKSEQ LHHSMCTRKR 500
HRRCEYSHFM QHHRDLSGLL VSAFKNQLSK SPFEETAEGD VQYPERCCCI 550
AVCAHQCLRL LQQVSLSTTC VQILSGVHSV GICCCMDPKS VIAPLLHAFK 600
LPALKAFQQH ILNVLSKLLV DQLGGAELSP RIKKAACNIC TVDSDQLAKL 650
GETLQGTLCG AGPTSGLPSP SYRFQGILPS SGSEDLLWKW DALEAYQSFV 700
FQEDRLHNIQ IANHICNLLQ KGNVVVQWKL YNYIFNPVLQ RGVELVHHCQ 750
QLSIPSAQTH MCSQLKQYLP QEVLQIYLKT LPVLLKSRVI RDLFLSCNGV 800
NHIIELNYLD GIRSHSLKAF ETLIVSLGEQ QKDAAVLDVD GLDIQQELPS 850
LSVGPSLHKQ QASSDSPCSL RKFYASLREP DPKKRKTIHQ DVHINTINLF 900
LCVAFLCVSK EADSDRESAN ESEDTSGYDS PPSEPLSHML PCLSLEDVVL 950
PSPECLHHAA DIWSMCRWIY MLNSVFQKQF HRLGGFQVCH ELIFMIIQKL 1000
FRSHTEDQGR RQGEMSRNEN QELIRISYPE LTLKGDVSSA TAPDLGFLRK 1050
SADSVRGFQS QPVLPTSAEQ IVATESVPGE RKAFMSQQSE TSLQSIRLLE 1100
SLLDICLHSA RACQQKMELE LPSQGLSVEN ILCELREHLS QSKVAETELA 1150
KPLFDALLRV ALGNHSADLG PGDAVTEKSH PSEEELLSQP GDFSEEAEDS 1200
QCCSLKLLGE EEGYEADSES NPEDVDTQDD GVELNPEAEG FSGSIVSNNL 1250
LENLTHGEII YPEICMLGLN LLSASKAKLD VLAHVFESFL KIVRQKEKNI 1300
SLLIQQGTVK ILLGGFLNIL TQTNSDFQAC QRVLVDLLVS LMSSRTCSED 1350
LTLLWRIFLE KSPCTEILLL GIHKIVESDF TMSPSQCLTF PFLHTPSLSN 1400
GVLSQKPPGI LNSKALGLLR RARISRGKKE ADRESFPYRL LSSWHIAPIH 1450
LPLLGQNCWP HLSEGFSVSL VGLMWNTSNE SESAAERGKR VKKRNKPSVL 1500
EDSSFEGAEG DRPEVTESIN PGDRLIEDGC IHLISLGSKA LMIQVWADPH 1550
SGTFIFRVCM DSNDDTKAVS LAQVESQENI FFPSKWQHLV LTYIQHPQGK 1600
KNVHGEISIW VSGQRKTDVI LDFVLPRKTS LSSDSNKTFC MIGHCLTSQE 1650
ESLQLAGKWD LGNLLLFNGA KIGSQEAFFL YACGPNYTSI MPCKYGQPVI 1700
DYSKYINKDI LRCDEIRDLF MTKKEVDVGL LIESLSVVYT TCCPAQYTIY 1750
EPVIRLKGQV KTQPSQRPFS SKEAQSILLE PSQLKGLQPT ECKAIQGILH 1800
EIGGAGTFVF LFARVVELSS CEETQALALR VILSLIKYSQ QRTQELENCN 1850
GLSMIHQVLV KQKCIVGFHI LKTLLEGCCG EEVIHVSEHG EFKLDVESHA 1900
IIQDVKLLQE LLLDWKIWNK AEQGVWETLL AALEVLIRVE HHQQQFNIKQ 1950
LLNAHVVHHF LLTCQVLQEH REGQLTSMPR EVCRSFVKII AEVLGSPPDL 2000
ELLTVIFNFL LAVHPPTNTY VCHNPTNFYF SLHIDGKIFQ EKVQSLAYLR 2050
HSSSGGQAFP SPGFLVISPS AFTAAPPEGT SSSNIVPQRM AAQMVRSRSL 2100
PAFPTYLPLI RAQKLAASLG FSVDKLQNIA DANPEKQNLL GRPYALKTSK 2150
EEAFISSCES AKTVCEMEAL LGAHASANGV SRGSPRFPRA RVDHKDVGTE 2200
PRSDDDSPGD ESYPRRPDNL KGLASFQRSQ STVASLGLAF PSQNGSAVAS 2250
RWPSLVDRNA DDWENFTFSP AYEASYNRAT STHSVIEDCL IPICCGLYEL 2300
LSGVLLVLPD AMLEDVMDRI IQADILLVLV NHPSPAIQQG VIKLLHAYIN 2350
RASKEQKDKF LKNRGFSLLA NQLYLHRGTQ ELLECFVEMF FGRPIGLDEE 2400
FDLEEVKHME LFQKWSVIPV LGLIETSLYD NVLLHNALLL LLQVLNSCSK 2450
VADMLLDNGL LYVLCNTVAA LNGLEKNIPV NEYKLLACDI QQLFIAVTIH 2500
ACSSSGTQYF RVIEDLIVLL GYLHNSKNKR TQNMALALQL RVLQAALEFI 2550
RSTANHDSES PVHSPSAHRH SVPPKRRSIA GSRKFPLAQT ESLLMKMRSV 2600
ASDELHSMMQ RRMSQEHPSQ ASEAELAQRL QRLTILAVNR IIYQELNSDI 2650
IDILRTPENT SQSKTSVSQT EISEEDMHHE QPSVYNPFQK EMLTYLLDGF 2700
KVCIGSSKTS VSKQQWTKIL GSCKETLRDQ LGRLLAHILS PTHTVQERKQ 2750
ILEIVHEPAH QDILRDCLSP SPQHGAKLVL YLSELIHNHQ DELSEEEMDT 2800
AELLMNALKL CGHKCIPPSA PSKPELIKII REEQKKYESE ESVSKGSWQK 2850
TVNNNQQSLF QRLDFKSKDI SKIAADITQA VSLSQGIERK KVIQHIRGMY 2900
KVDLSASRHW QECIQQLTHD RAVWYDPIYY PTSWQLDPTE GPNRERRRLQ 2950
RCYLTIPNKY LLRDRQKSEG VLRPPLSYLF EDKTHSSFSS TVKDKAASES 3000
IRVNRRCISV APSRETAGEL LLGKCGMYFV EDNASDAVES SSLQGELEPA 3050
SFSWTYEEIK EVHRRWWQLR DNAVEIFLTN GRTLLLAFDN NKVRDDVYQS 3100
ILTNNLPNLL EYGNITALTN LWYSGQITNF EYLTHLNKHA GRSFNDLMQY 3150
PVFPFILSDY VSETLDLNDP SIYRNLSKPI AVQYKEKEDR YVDTYKYLEE 3200
EYRKGAREDD PMPPVQPYHY GSHYSNSGTV LHFLVRMPPF TKMFLAYQDQ 3250
SFDIPDRTFH STNTTWRLSS FESMTDVKEL IPEFFYLPEF LVNREGFDFG 3300
VRQNGERVNH VNLPPWARND PRLFILIHRQ ALESDHVSQN ICHWIDLVFG 3350
YKQKGKASVQ AINVFHPATY FGMDVSAVED PVQRRALETM IKTYGQTPRQ 3400
LFHTAHASRP GAKLNIEGEL PAAVGLLVQF AFRETREPVK EVTHPSPLSW 3450
IKGLKWGEYV GSPSAPVPVV CFSQPHGERF GSLQALPTRA ICGLSRNFCL 3500
LMTYNKEQGV RSMNNTNIQW SAILSWGYAD NILRLKSKQS EPPINFIQSS 3550
QQHQVTSCAW VPDSCQLFTG SKCGVITAYT NRLTSSTPSE IEMESQMHLY 3600
GHTEEITGLC VCKPYSVMIS VSRDGTCIVW DLNRLCYVQS LAGHKSPVTA 3650
VSASETSGDI ATVCDSAGGG SDLRLWTVNG DLVGHVHCRE IICSVAFSNQ 3700
PEGVSINVIA GGLENGIVRL WSTWDLKPVR EITFPKSNKP IISLTFSCDG 3750
HHLYTANSEG TVIAWCRKDQ QRVKLPMFYS FLSSYAAG 3788
Length:3,788
Mass (Da):425,287
Last modified:May 1, 1997 - v1
Checksum:iF01BE837C676A750
GO
Isoform 2 (identifier: P97412-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1509-1545: EGDRPEVTESINPGDRLIEDGCIHLISLGSKALMIQV → GMMAGSDLYTKILQIAACLSFKHIWQYFNVFFKCYSP
     1546-3788: Missing.

Show »
Length:1,545
Mass (Da):172,458
Checksum:iA346094C0E5C419A
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1509 – 154537EGDRP…LMIQV → GMMAGSDLYTKILQIAACLS FKHIWQYFNVFFKCYSP in isoform 2.
VSP_006783Add
BLAST
Alternative sequencei1546 – 37882243Missing in isoform 2.
VSP_006784Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U70015 mRNA. Translation: AAC53011.1.
L77884 mRNA. Translation: AAL40134.1.
U52461 mRNA. Translation: AAB60778.1.
PIRiT30851.
RefSeqiNP_034878.2. NM_010748.2.
UniGeneiMm.342337.

Genome annotation databases

GeneIDi17101.
KEGGimmu:17101.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U70015 mRNA. Translation: AAC53011.1 .
L77884 mRNA. Translation: AAL40134.1 .
U52461 mRNA. Translation: AAB60778.1 .
PIRi T30851.
RefSeqi NP_034878.2. NM_010748.2.
UniGenei Mm.342337.

3D structure databases

ProteinModelPortali P97412.
SMRi P97412. Positions 3010-3409, 3523-3770.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

IntActi P97412. 1 interaction.
MINTi MINT-4100871.

PTM databases

PhosphoSitei P97412.

Proteomic databases

PaxDbi P97412.
PRIDEi P97412.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 17101.
KEGGi mmu:17101.

Organism-specific databases

CTDi 1130.
MGIi MGI:107448. Lyst.

Phylogenomic databases

eggNOGi COG2319.
HOGENOMi HOG000113425.
HOVERGENi HBG006300.
PhylomeDBi P97412.

Miscellaneous databases

ChiTaRSi LYST. mouse.
NextBioi 291244.
PROi P97412.
SOURCEi Search...

Gene expression databases

CleanExi MM_LYST.
Genevestigatori P97412.

Family and domain databases

Gene3Di 1.10.1540.10. 1 hit.
2.130.10.10. 1 hit.
2.30.29.40. 1 hit.
InterProi IPR016024. ARM-type_fold.
IPR000409. BEACH_dom.
IPR023362. PH-BEACH_dom.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view ]
Pfami PF02138. Beach. 1 hit.
PF14844. PH_BEACH. 1 hit.
PF00400. WD40. 2 hits.
[Graphical view ]
SMARTi SM01026. Beach. 1 hit.
SM00320. WD40. 4 hits.
[Graphical view ]
SUPFAMi SSF48371. SSF48371. 5 hits.
SSF50978. SSF50978. 1 hit.
SSF81837. SSF81837. 1 hit.
PROSITEi PS50197. BEACH. 1 hit.
PS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 1 hit.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Strain: C57BL/6J.
  3. Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1428-3788 (ISOFORM 1).
    Strain: C57BL/6J.
  4. "Comprehensive identification of phosphorylation sites in postsynaptic density preparations."
    Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L.
    Mol. Cell. Proteomics 5:914-922(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain.
  5. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-2203, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  6. "Large scale localization of protein phosphorylation by use of electron capture dissociation mass spectrometry."
    Sweet S.M., Bailey C.M., Cunningham D.L., Heath J.K., Cooper H.J.
    Mol. Cell. Proteomics 8:904-912(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Embryonic fibroblast.

Entry informationi

Entry nameiLYST_MOUSE
AccessioniPrimary (citable) accession number: P97412
Secondary accession number(s): Q62403, Q8VBS6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 15, 2002
Last sequence update: May 1, 1997
Last modified: June 11, 2014
This is version 118 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi