Reviewed,
UniProtKB/Swiss-Prot P97318 (DAB1_MOUSE)
Last modified
November 4, 2008.
Version 73.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Disabled homolog 1 | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 588 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Adapter molecule functioning in neural development. May regulate SIAH1 activity. |
| Subunit structure | Interacts with LRP1 By similarity. Associates with the SH2 domains of SRC, FYN and ABL. Interacts with DAB2IP and SIAH1. |
| Tissue specificity | Expressed mainly in brain. |
| Domain | The PID domain specifically binds to the Asn-Pro-Xaa-Tyr(P) motif found in many tyrosine-phosphorylated proteins. |
| Post-translational modification | Phosphorylated on Tyr-198 and Tyr-220 upon reelin induction in embryonic neurons. Also phosphorylated on Ser-524 independently of reelin signaling. |
| Sequence similarities | Contains 1 PID domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Aplp1 | Q03157 | 2 | EBI-81680,EBI-399929 | |
| Aplp2 | Q06335 | 1 | EBI-81680,EBI-446708 | |
| App | P12023 | 1 | EBI-81680,EBI-78814 | |
| Lrp1 | Q91ZX7 | 1 | EBI-81680,EBI-300955 | |
| Pcdh18 | Q8VHR0 | 2 | EBI-81680,EBI-399910 | |
| Siah1a | P61092 | 2 | EBI-81680,EBI-446761 |
Alternative products
| This entry describes 7 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform DAB588 (identifier: P97318-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Notes: No experimental confirmation available. | ||||||
| Isoform DAB197 (identifier: P97318-4) The sequence of this isoform differs from the canonical sequence as follows: 2-23: STETELQVAVKTSAKKDSRKKG → LC 200-217: YIVFEAGHEPIRDPETEE → VISEPRQGFACSCEGSFD 218-588: Missing. | ||||||
| Notes: No experimental confirmation available. | ||||||
| Isoform DAB204 (identifier: P97318-5) The sequence of this isoform differs from the canonical sequence as follows: 200-204: YIVFE → NLQKN 205-588: Missing. | ||||||
| Notes: No experimental confirmation available. | ||||||
| Isoform DAB217 (identifier: P97318-6) The sequence of this isoform differs from the canonical sequence as follows: 200-217: YIVFEAGHEPIRDPETEE → VISEPRQGFACSCEGSFD 218-588: Missing. | ||||||
| Isoform DAB271 (identifier: P97318-3) The sequence of this isoform differs from the canonical sequence as follows: 240-272: Missing. 275-304: AVTQLELFGDMSTPPDITSPPTPATPGDAF → SLVQSPAAERAEAESRTGPAEPGSILRPLG 305-588: Missing. | ||||||
| Isoform DAB553 (identifier: P97318-8) The sequence of this isoform differs from the canonical sequence as follows: 187-221: Missing. | ||||||
| Notes: No experimental confirmation available. | ||||||
| Isoform DAB555 (identifier: P97318-2) The sequence of this isoform differs from the canonical sequence as follows: 240-272: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 588 | 588 | Disabled homolog 1 | PRO_0000079769 | ||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||
| Domain | 36 – 189 | 154 | PID | |||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||
| Modified residue | 198 | 1 | Phosphotyrosine | |||||||||||||||||||||||||||||||||
| Modified residue | 220 | 1 | Phosphotyrosine | |||||||||||||||||||||||||||||||||
| Modified residue | 524 | 1 | Phosphoserine; by CDK5 | |||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||
| Alternative sequence | 2 – 23 | 22 | STETE…SRKKG → LC in isoform DAB197. | VSP_026205 | ||||||||||||||||||||||||||||||||
| Alternative sequence | 187 – 221 | 35 | Missing in isoform DAB553. | VSP_026206 | ||||||||||||||||||||||||||||||||
| Alternative sequence | 200 – 217 | 18 | YIVFE…PETEE → VISEPRQGFACSCEGSFD in isoform DAB197 and isoform DAB217. | VSP_003841 | ||||||||||||||||||||||||||||||||
| Alternative sequence | 200 – 204 | 5 | YIVFE → NLQKN in isoform DAB204. | VSP_026208 | ||||||||||||||||||||||||||||||||
| Alternative sequence | 205 – 588 | 384 | Missing in isoform DAB204. | VSP_026209 | ||||||||||||||||||||||||||||||||
| Alternative sequence | 218 – 588 | 371 | Missing in isoform DAB197 and isoform DAB217. | VSP_003842 | ||||||||||||||||||||||||||||||||
| Alternative sequence | 240 – 272 | 33 | Missing in isoform DAB555 and isoform DAB271. | VSP_003843 | ||||||||||||||||||||||||||||||||
| Alternative sequence | 275 – 304 | 30 | AVTQL…PGDAF → SLVQSPAAERAEAESRTGPA EPGSILRPLG in isoform DAB271. | VSP_003844 | ||||||||||||||||||||||||||||||||
| Alternative sequence | 305 – 588 | 284 | Missing in isoform DAB271. | VSP_003845 | ||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||
| Sequence conflict | 29 | 1 | A → R in BAB24163. Ref.2 | |||||||||||||||||||||||||||||||||
| Sequence conflict | 239 | 1 | P → PVS in CAM17685 and CAM26758. Ref.3 | |||||||||||||||||||||||||||||||||
| Sequence conflict | 248 | 1 | E → D in CAM17685 and CAM26758. Ref.3 | |||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||
| Helix | 28 – 35 | 8 | ||||||||||||||||||||||||||||||||||
| Beta strand | 40 – 51 | 12 | ||||||||||||||||||||||||||||||||||
| Beta strand | 53 – 55 | 3 | ||||||||||||||||||||||||||||||||||
| Helix | 58 – 76 | 19 | ||||||||||||||||||||||||||||||||||
| Turn | 77 – 79 | 3 | ||||||||||||||||||||||||||||||||||
| Beta strand | 83 – 90 | 8 | ||||||||||||||||||||||||||||||||||
| Beta strand | 93 – 98 | 6 | ||||||||||||||||||||||||||||||||||
| Turn | 99 – 101 | 3 | ||||||||||||||||||||||||||||||||||
| Beta strand | 104 – 108 | 5 | ||||||||||||||||||||||||||||||||||
| Helix | 110 – 112 | 3 | ||||||||||||||||||||||||||||||||||
| Beta strand | 113 – 118 | 6 | ||||||||||||||||||||||||||||||||||
| Beta strand | 125 – 132 | 8 | ||||||||||||||||||||||||||||||||||
| Beta strand | 137 – 145 | 9 | ||||||||||||||||||||||||||||||||||
| Helix | 148 – 166 | 19 | ||||||||||||||||||||||||||||||||||
| Helix | 170 – 173 | 4 | ||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Mouse disabled (mDab1): a Src binding protein implicated in neuronal development." Howell B.W., Gertler F.B., Cooper J.A. EMBO J. 16:121-132(1997) [PubMed: 9009273] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS DAB217; DAB271 AND DAB555), FUNCTION, SUBUNIT, TISSUE SPECIFICITY. Tissue: Embryonic brain. |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM DAB197). Strain: C57BL/6J. Tissue: Testis. |
| [3] | The mouse genome sequencing consortium Submitted (JAN-2007) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [4] | "Identification of reelin-induced sites of tyrosyl phosphorylation on disabled 1." Keshvara L., Benhayon D., Magdaleno S., Curran T. J. Biol. Chem. 276:16008-16014(2001) [PubMed: 11279201] [Abstract] Cited for: PHOSPHORYLATION AT TYR-198 AND TYR-220. |
| [5] | "Cyclin-dependent kinase 5 phosphorylates disabled 1 independently of reelin signaling." Keshvara L., Magdaleno S., Benhayon D., Curran T. J. Neurosci. 22:4869-4877(2002) [PubMed: 12077184] [Abstract] Cited for: PHOSPHORYLATION AT SER-524. |
| [6] | "Inhibition of ubiquitin ligase Siah-1A by disabled-1." Park T.-J., Hamanaka H., Ohshima T., Watanabe N., Mikoshiba K., Nukina N. Biochem. Biophys. Res. Commun. 302:671-678(2003) [PubMed: 12646221] [Abstract] Cited for: INTERACTION WITH SIAH1. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| Y08380 mRNA. Translation: CAA69663.1. Y08379 mRNA. Translation: CAA69662.1. Y08381 mRNA. Translation: CAA69664.1. Y08383 Genomic DNA. No translation available. AK005640 mRNA. Translation: BAB24163.1. AL627134, AL645483 Genomic DNA. Translation: CAM26758.1. AL627134, AL645483, AL669938 Genomic DNA. Translation: CAM26759.1. AL627134, AL645483, AL669938 Genomic DNA. Translation: CAM26760.1. AL627134, AL645483, AL669938 Genomic DNA. Translation: CAM26762.1. AL627134, AL645483, AL669938 Genomic DNA. Translation: CAM26765.1. AL645483, AL627134 Genomic DNA. Translation: CAM17685.1. AL645483, AL627134, AL669938 Genomic DNA. Translation: | |

Clusters with