P97318 (DAB1_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 109.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Disabled homolog 1 | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 588 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Adapter molecule functioning in neural development. May regulate SIAH1 activity. Ref.1 |
| Subunit structure | Associates with the SH2 domains of SRC, FYN and ABL. Interacts (phosphorylated on tyrosine residues) with CRK and CRKL (via respective SH2 domain). Interacts with DAB2IP, SIAH1, LRP1, LRP8 and VLDLR. Interacts with APLP1 (via NPXY motif). Ref.1 Ref.7 Ref.8 Ref.9 Ref.10 |
| Tissue specificity | Expressed mainly in brain. Ref.1 |
| Domain | The PID domain specifically binds to the Asn-Pro-Xaa-Tyr(P) motif found in many tyrosine-phosphorylated proteins. |
| Post-translational modification | Phosphorylated on Tyr-198 and Tyr-220 upon reelin induction in embryonic neurons (Ref.5). Also found phosphorylated on Tyr-232 upon reelin induction (Ref.8). Also phosphorylated on Ser-524 independently of reelin signaling. Ref.4 Ref.5 Ref.6 Ref.8 |
| Sequence similarities | Contains 1 PID domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Aplp1 | Q03157 | 4 | EBI-81680,EBI-399929 | |
| App | P12023 | 3 | EBI-81680,EBI-78814 | |
| Dab2ip | Q3UHC7 | 3 | EBI-81680,EBI-6306507 | |
| Lrp1 | Q91ZX7 | 2 | EBI-81680,EBI-300955 | |
| Lrp2 | A2ARV4 | 2 | EBI-81680,EBI-300875 | |
| Pcdh18 | Q8VHR0 | 2 | EBI-81680,EBI-399910 | |
| Siah1a | P61092 | 3 | EBI-81680,EBI-446761 |
Alternative products
| This entry describes 7 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform DAB588 (identifier: P97318-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform DAB197 (identifier: P97318-4) The sequence of this isoform differs from the canonical sequence as follows: 2-23: STETELQVAVKTSAKKDSRKKG → LC 200-217: YIVFEAGHEPIRDPETEE → VISEPRQGFACSCEGSFD 218-588: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform DAB204 (identifier: P97318-5) The sequence of this isoform differs from the canonical sequence as follows: 200-204: YIVFE → NLQKN 205-588: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform DAB217 (identifier: P97318-6) The sequence of this isoform differs from the canonical sequence as follows: 200-217: YIVFEAGHEPIRDPETEE → VISEPRQGFACSCEGSFD 218-588: Missing. | ||||||
| Isoform DAB271 (identifier: P97318-3) The sequence of this isoform differs from the canonical sequence as follows: 240-272: Missing. 275-304: AVTQLELFGDMSTPPDITSPPTPATPGDAF → SLVQSPAAERAEAESRTGPAEPGSILRPLG 305-588: Missing. | ||||||
| Isoform DAB553 (identifier: P97318-8) The sequence of this isoform differs from the canonical sequence as follows: 187-221: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform DAB555 (identifier: P97318-2) The sequence of this isoform differs from the canonical sequence as follows: 240-272: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 588 | 588 | Disabled homolog 1 | PRO_0000079769 | ||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||
| Domain | 36 – 189 | 154 | PID | |||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||
| Modified residue | 198 | 1 | Phosphotyrosine Ref.4 Ref.5 | |||||||||||||||||||||||||||||||||
| Modified residue | 220 | 1 | Phosphotyrosine Ref.5 Ref.8 | |||||||||||||||||||||||||||||||||
| Modified residue | 232 | 1 | Phosphotyrosine Ref.4 Ref.8 | |||||||||||||||||||||||||||||||||
| Modified residue | 524 | 1 | Phosphoserine; by CDK5 Ref.6 | |||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||
| Alternative sequence | 2 – 23 | 22 | STETE…SRKKG → LC in isoform DAB197. | VSP_026205 | ||||||||||||||||||||||||||||||||
| Alternative sequence | 187 – 221 | 35 | Missing in isoform DAB553. | VSP_026206 | ||||||||||||||||||||||||||||||||
| Alternative sequence | 200 – 217 | 18 | YIVFE…PETEE → VISEPRQGFACSCEGSFD in isoform DAB197 and isoform DAB217. | VSP_003841 | ||||||||||||||||||||||||||||||||
| Alternative sequence | 200 – 204 | 5 | YIVFE → NLQKN in isoform DAB204. | VSP_026208 | ||||||||||||||||||||||||||||||||
| Alternative sequence | 205 – 588 | 384 | Missing in isoform DAB204. | VSP_026209 | ||||||||||||||||||||||||||||||||
| Alternative sequence | 218 – 588 | 371 | Missing in isoform DAB197 and isoform DAB217. | VSP_003842 | ||||||||||||||||||||||||||||||||
| Alternative sequence | 240 – 272 | 33 | Missing in isoform DAB555 and isoform DAB271. | VSP_003843 | ||||||||||||||||||||||||||||||||
| Alternative sequence | 275 – 304 | 30 | AVTQL…PGDAF → SLVQSPAAERAEAESRTGPA EPGSILRPLG in isoform DAB271. | VSP_003844 | ||||||||||||||||||||||||||||||||
| Alternative sequence | 305 – 588 | 284 | Missing in isoform DAB271. | VSP_003845 | ||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||
| Mutagenesis | 45 | 1 | K → A: Impairs binding to PtdIns(4,5)P2. Ref.9 | |||||||||||||||||||||||||||||||||
| Mutagenesis | 82 | 1 | K → A: Abolishes binding to PtdIns(4,5)P2. Ref.9 | |||||||||||||||||||||||||||||||||
| Mutagenesis | 114 | 1 | S → T: Abolishes interaction with APLP1. Ref.9 | |||||||||||||||||||||||||||||||||
| Mutagenesis | 136 | 1 | H → R: Greatly impairs interaction with APLP1. Ref.9 | |||||||||||||||||||||||||||||||||
| Mutagenesis | 158 | 1 | F → V: Abolishes interaction with APLP1. Ref.9 | |||||||||||||||||||||||||||||||||
| Mutagenesis | 185 | 1 | Y → F: Reduces phosphorylation by SRC or downstream kinase; when associated with F-198 and F-200. Abolishes phosphorylation by SRC or downstream kinase; when associated with F-198; F-200; F-220 and F-232. Ref.4 | |||||||||||||||||||||||||||||||||
| Mutagenesis | 198 | 1 | Y → F: Reduces phosphorylation by SRC or downstream kinase; when associated with F-185 and F-200. Abolishes phosphorylation by SRC or downstream kinase; when associated with F-185; F-200; F-220 and F-232. Ref.4 | |||||||||||||||||||||||||||||||||
| Mutagenesis | 200 | 1 | Y → F: Reduces phosphorylation by SRC or downstream kinase; when associated with F-185 and F-198. Abolishes phosphorylation by SRC or downstream kinase; when associated with F-185; F-198; F-220 and F-232. Ref.4 | |||||||||||||||||||||||||||||||||
| Mutagenesis | 220 | 1 | Y → F: Reduces phosphorylation by SRC or downstream kinase; when associated with F-232. Abolishes phosphorylation by SRC or downstream kinase; when associated with F-185; F-198; F-200 and F-232. Abolishes interaction with CRKL SH2 domain; when associated with F-232. Ref.4 Ref.8 | |||||||||||||||||||||||||||||||||
| Mutagenesis | 232 | 1 | Y → F: Reduces phosphorylation by SRC or downstream kinase; when associated with F-220. Abolishes phosphorylation by SRC or downstream kinase; when associated with F-185; F-198; F-200 and F-220. Abolishes interaction with CRKL SH2 domain; when associated with F-220. Ref.4 Ref.8 | |||||||||||||||||||||||||||||||||
| Sequence conflict | 29 | 1 | A → R in BAB24163. Ref.2 | |||||||||||||||||||||||||||||||||
| Sequence conflict | 239 | 1 | P → PVS in CAM17685. Ref.3 | |||||||||||||||||||||||||||||||||
| Sequence conflict | 239 | 1 | P → PVS in CAM26758. Ref.3 | |||||||||||||||||||||||||||||||||
| Sequence conflict | 248 | 1 | E → D in CAM17685. Ref.3 | |||||||||||||||||||||||||||||||||
| Sequence conflict | 248 | 1 | E → D in CAM26758. Ref.3 | |||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||
| Helix | 28 – 35 | 8 | ||||||||||||||||||||||||||||||||||
| Beta strand | 40 – 51 | 12 | ||||||||||||||||||||||||||||||||||
| Beta strand | 53 – 55 | 3 | ||||||||||||||||||||||||||||||||||
| Helix | 58 – 76 | 19 | ||||||||||||||||||||||||||||||||||
| Turn | 77 – 79 | 3 | ||||||||||||||||||||||||||||||||||
| Beta strand | 83 – 90 | 8 | ||||||||||||||||||||||||||||||||||
| Beta strand | 93 – 98 | 6 | ||||||||||||||||||||||||||||||||||
| Turn | 99 – 101 | 3 | ||||||||||||||||||||||||||||||||||
| Beta strand | 104 – 108 | 5 | ||||||||||||||||||||||||||||||||||
| Helix | 110 – 112 | 3 | ||||||||||||||||||||||||||||||||||
| Beta strand | 113 – 118 | 6 | ||||||||||||||||||||||||||||||||||
| Beta strand | 125 – 132 | 8 | ||||||||||||||||||||||||||||||||||
| Beta strand | 137 – 145 | 9 | ||||||||||||||||||||||||||||||||||
| Helix | 148 – 166 | 19 | ||||||||||||||||||||||||||||||||||
| Helix | 170 – 173 | 4 | ||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Mouse disabled (mDab1): a Src binding protein implicated in neuronal development." Howell B.W., Gertler F.B., Cooper J.A. EMBO J. 16:121-132(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS DAB217; DAB271 AND DAB555), FUNCTION, SUBUNIT, TISSUE SPECIFICITY. Tissue: Embryonic brain. |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM DAB197). Strain: C57BL/6J. Tissue: Testis. |
| [3] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [4] | "Dab1 tyrosine phosphorylation sites relay positional signals during mouse brain development." Howell B.W., Herrick T.M., Hildebrand J.D., Zhang Y., Cooper J.A. Curr. Biol. 10:877-885(2000) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT TYR-198 AND TYR-232, MUTAGENESIS OF TYR-185; TYR-198; TYR-200; TYR-220 AND TYR-232. |
| [5] | "Identification of reelin-induced sites of tyrosyl phosphorylation on disabled 1." Keshvara L., Benhayon D., Magdaleno S., Curran T. J. Biol. Chem. 276:16008-16014(2001) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT TYR-198 AND TYR-220. |
| [6] | "Cyclin-dependent kinase 5 phosphorylates disabled 1 independently of reelin signaling." Keshvara L., Magdaleno S., Benhayon D., Curran T. J. Neurosci. 22:4869-4877(2002) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT SER-524. |
| [7] | "Inhibition of ubiquitin ligase Siah-1A by disabled-1." Park T.-J., Hamanaka H., Ohshima T., Watanabe N., Mikoshiba K., Nukina N. Biochem. Biophys. Res. Commun. 302:671-678(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SIAH1. |
| [8] | "Activation of a Dab1/CrkL/C3G/Rap1 pathway in Reelin-stimulated neurons." Ballif B.A., Arnaud L., Arthur W.T., Guris D., Imamoto A., Cooper J.A. Curr. Biol. 14:606-610(2004) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT TYR-220 AND TYR-232, INTERACTION WITH CRK AND CRKL, MUTAGENESIS OF TYR-220 AND TYR-232. |
| [9] | "Crystal structures of the Dab homology domains of mouse disabled 1 and 2." Yun M., Keshvara L., Park C.G., Zhang Y.M., Dickerson J.B., Zheng J., Rock C.O., Curran T., Park H.W. J. Biol. Chem. 278:36572-36581(2003) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS) OF 25-183, INTERACTION WITH PHOSPHATIDYLINOSITIDES AND APLP1, MUTAGENESIS OF LYS-45; LYS-82; SER-114; HIS-136 AND PHE-158. |
| [10] | "Origins of peptide selectivity and phosphoinositide binding revealed by structures of disabled-1 PTB domain complexes." Stolt P.C., Jeon H., Song H.K., Herz J., Eck M.J., Blacklow S.C. Structure 11:569-579(2003) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.9 ANGSTROMS) OF 23-174, INTERACTION WITH LRP8 AND VLDLR. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | Y08380 mRNA. Translation: CAA69663.1. Y08379 mRNA. Translation: CAA69662.1. Y08381 mRNA. Translation: CAA69664.1. Y08383 Genomic DNA. No translation available. AK005640 mRNA. Translation: BAB24163.1. AL627134, AL645483 Genomic DNA. Translation: CAM26758.1. AL627134, AL645483, AL669938 Genomic DNA. Translation: CAM26759.1. AL627134, AL645483, AL669938 Genomic DNA. Translation: CAM26760.1. AL627134, AL645483, AL669938 Genomic DNA. Translation: CAM26762.1. AL627134, AL645483, AL669938 Genomic DNA. Translation: CAM26765.1. AL645483, AL627134 Genomic DNA. Translation: CAM17685.1. AL645483, AL627134, AL669938 Genomic DNA. Translation: CAM17686.1. AL645483, AL627134, AL669938 Genomic DNA. Translation: CAM17687.1. AL645483, AL627134, AL669938 Genomic DNA. Translation: CAM17689.1. AL645483, AL627134, AL669938 Genomic DNA. Translation: CAM17690.1. AL669938, AL627134, AL645483 Genomic DNA. Translation: CAM19059.1. AL669938, AL627134, AL645483 Genomic DNA. Translation: CAM19060.1. AL669938, AL627134, AL645483 Genomic DNA. Translation: CAM19062.1. AL669938, AL627134, AL645483 Genomic DNA. Translation: CAM19063.1. | ||||||||||||||||||||||||
| IPI | IPI00123898. IPI00230573. IPI00230574. IPI00230575. IPI00750727. IPI00849536. IPI00850021. | ||||||||||||||||||||||||
| RefSeq | NP_034144.1. NM_010014.2. NP_796233.2. NM_177259.3. | ||||||||||||||||||||||||
| UniGene | Mm.289682. | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| ProteinModelPortal | P97318. | ||||||||||||||||||||||||
| SMR | P97318. Positions 23-174. | ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| DIP | DIP-30902N. | ||||||||||||||||||||||||
| IntAct | P97318. 15 interactions. | ||||||||||||||||||||||||
| MINT | MINT-258594. | ||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||
| PhosphoSite | P97318. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PRIDE | P97318. | ||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENSMUST00000106826; ENSMUSP00000102439; ENSMUSG00000028519. ENSMUST00000106827; ENSMUSP00000102440; ENSMUSG00000028519. ENSMUST00000106830; ENSMUSP00000102443; ENSMUSG00000028519. ENSMUST00000143644; ENSMUSP00000118650; ENSMUSG00000028519. | ||||||||||||||||||||||||
| GeneID | 13131. | ||||||||||||||||||||||||
| KEGG | mmu:13131. | ||||||||||||||||||||||||
| UCSC | uc008txu.1. mouse. uc008txv.1. mouse. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 1600. | ||||||||||||||||||||||||
| MGI | MGI:108554. Dab1. | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| eggNOG | NOG313182. | ||||||||||||||||||||||||
| GeneTree | ENSGT00520000055585. | ||||||||||||||||||||||||
| HOVERGEN | HBG018945. | ||||||||||||||||||||||||
| InParanoid | P97318. | ||||||||||||||||||||||||
| OMA | AAFMPTQ. | ||||||||||||||||||||||||
| OrthoDB | EOG4TB4BG. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| ArrayExpress | P97318. | ||||||||||||||||||||||||
| Bgee | P97318. | ||||||||||||||||||||||||
| CleanEx | MM_DAB1. | ||||||||||||||||||||||||
| Genevestigator | P97318. | ||||||||||||||||||||||||
| GermOnline | ENSMUSG00000028519. Mus musculus. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| Gene3D | 2.30.29.30. 1 hit. | ||||||||||||||||||||||||
| InterPro | IPR011993. PH_like_dom. IPR006020. PTyr_interaction_dom. [Graphical view] | ||||||||||||||||||||||||
| Pfam | PF00640. PID. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| SMART | SM00462. PTB. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| PROSITE | PS01179. PID. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other | |||||||||||||||||||||||||
| ChiTaRS | DAB1. mouse. | ||||||||||||||||||||||||
| EvolutionaryTrace | P97318. | ||||||||||||||||||||||||
| NextBio | 283176. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | DAB1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: P97318 Secondary accession number(s): A2A963 Q9DAP9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
