Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P97318

- DAB1_MOUSE

UniProt

P97318 - DAB1_MOUSE

Protein

Disabled homolog 1

Gene

Dab1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 123 (01 Oct 2014)
      Sequence version 2 (01 Jun 1998)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Adapter molecule functioning in neural development. May regulate SIAH1 activity.1 Publication

    GO - Molecular functioni

    1. phospholipid binding Source: UniProtKB
    2. protein binding Source: UniProtKB
    3. SH2 domain binding Source: UniProtKB

    GO - Biological processi

    1. adult walking behavior Source: MGI
    2. cell-cell adhesion involved in neuronal-glial interactions involved in cerebral cortex radial glia guided migration Source: MGI
    3. central nervous system development Source: UniProtKB
    4. cerebellum structural organization Source: MGI
    5. cerebral cortex cell migration Source: MGI
    6. cerebral cortex radially oriented cell migration Source: MGI
    7. dendrite development Source: MGI
    8. Golgi localization Source: MGI
    9. intracellular signal transduction Source: UniProtKB
    10. lateral motor column neuron migration Source: UniProtKB
    11. midgut development Source: Ensembl
    12. negative regulation of astrocyte differentiation Source: MGI
    13. negative regulation of axonogenesis Source: MGI
    14. negative regulation of cell adhesion Source: MGI
    15. negative regulation of JAK-STAT cascade Source: MGI
    16. nervous system development Source: UniProtKB
    17. neuron migration Source: MGI
    18. positive regulation of neuron differentiation Source: MGI
    19. positive regulation of protein kinase activity Source: MGI
    20. radial glia guided migration of Purkinje cell Source: MGI
    21. response to drug Source: Ensembl
    22. small GTPase mediated signal transduction Source: MGI
    23. ventral spinal cord development Source: UniProtKB

    Keywords - Molecular functioni

    Developmental protein

    Keywords - Biological processi

    Differentiation, Neurogenesis

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Disabled homolog 1
    Gene namesi
    Name:Dab1
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 4

    Organism-specific databases

    MGIiMGI:108554. Dab1.

    Subcellular locationi

    GO - Cellular componenti

    1. apical part of cell Source: Ensembl
    2. brush border Source: Ensembl
    3. cytosol Source: Ensembl
    4. intracellular Source: UniProtKB
    5. membrane Source: Ensembl
    6. neuronal cell body Source: Ensembl
    7. neuron projection Source: Ensembl
    8. postsynaptic density Source: Ensembl

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi45 – 451K → A: Impairs binding to PtdIns(4,5)P2. 1 Publication
    Mutagenesisi82 – 821K → A: Abolishes binding to PtdIns(4,5)P2. 1 Publication
    Mutagenesisi114 – 1141S → T: Abolishes interaction with APLP1. 1 Publication
    Mutagenesisi136 – 1361H → R: Greatly impairs interaction with APLP1. 1 Publication
    Mutagenesisi158 – 1581F → V: Abolishes interaction with APLP1. 1 Publication
    Mutagenesisi185 – 1851Y → F: Reduces phosphorylation by SRC or downstream kinase; when associated with F-198 and F-200. Abolishes phosphorylation by SRC or downstream kinase; when associated with F-198; F-200; F-220 and F-232. 1 Publication
    Mutagenesisi198 – 1981Y → F: Reduces phosphorylation by SRC or downstream kinase; when associated with F-185 and F-200. Abolishes phosphorylation by SRC or downstream kinase; when associated with F-185; F-200; F-220 and F-232. 1 Publication
    Mutagenesisi200 – 2001Y → F: Reduces phosphorylation by SRC or downstream kinase; when associated with F-185 and F-198. Abolishes phosphorylation by SRC or downstream kinase; when associated with F-185; F-198; F-220 and F-232. 1 Publication
    Mutagenesisi220 – 2201Y → F: Reduces phosphorylation by SRC or downstream kinase; when associated with F-232. Abolishes phosphorylation by SRC or downstream kinase; when associated with F-185; F-198; F-200 and F-232. Abolishes interaction with CRKL SH2 domain; when associated with F-232. 2 Publications
    Mutagenesisi232 – 2321Y → F: Reduces phosphorylation by SRC or downstream kinase; when associated with F-220. Abolishes phosphorylation by SRC or downstream kinase; when associated with F-185; F-198; F-200 and F-220. Abolishes interaction with CRKL SH2 domain; when associated with F-220. 2 Publications

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 588588Disabled homolog 1PRO_0000079769Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei198 – 1981Phosphotyrosine2 Publications
    Modified residuei220 – 2201Phosphotyrosine2 Publications
    Modified residuei232 – 2321Phosphotyrosine2 Publications
    Modified residuei524 – 5241Phosphoserine; by CDK51 Publication

    Post-translational modificationi

    Phosphorylated on Tyr-198 and Tyr-220 upon reelin induction in embryonic neurons (PubMed:11279201). Also found phosphorylated on Tyr-232 upon reelin induction (PubMed:15062102). Also phosphorylated on Ser-524 independently of reelin signaling.4 Publications

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiP97318.
    PRIDEiP97318.

    PTM databases

    PhosphoSiteiP97318.

    Expressioni

    Tissue specificityi

    Expressed mainly in brain.1 Publication

    Gene expression databases

    ArrayExpressiP97318.
    BgeeiP97318.
    CleanExiMM_DAB1.
    GenevestigatoriP97318.

    Interactioni

    Subunit structurei

    Associates with the SH2 domains of SRC, FYN and ABL. Interacts (phosphorylated on tyrosine residues) with CRK and CRKL (via respective SH2 domain). Interacts with DAB2IP, SIAH1, LRP1, LRP8 and VLDLR. Interacts with APLP1 (via NPXY motif).5 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    Aplp1Q031574EBI-81680,EBI-399929
    AppP120233EBI-81680,EBI-78814
    Dab2ipQ3UHC73EBI-81680,EBI-6306507
    Lrp1Q91ZX72EBI-81680,EBI-300955
    Lrp2A2ARV42EBI-81680,EBI-300875
    Pcdh18Q8VHR02EBI-81680,EBI-399910
    Siah1aP610923EBI-81680,EBI-446761

    Protein-protein interaction databases

    BioGridi199042. 14 interactions.
    DIPiDIP-30902N.
    IntActiP97318. 16 interactions.
    MINTiMINT-258594.

    Structurei

    Secondary structure

    1
    588
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi28 – 358
    Beta strandi40 – 5112
    Beta strandi53 – 553
    Helixi58 – 7619
    Turni77 – 793
    Beta strandi83 – 908
    Beta strandi93 – 986
    Turni99 – 1013
    Beta strandi104 – 1085
    Helixi110 – 1123
    Beta strandi113 – 1186
    Beta strandi125 – 1328
    Beta strandi137 – 1459
    Helixi148 – 16619
    Helixi170 – 1734

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1NTVX-ray1.50A23-174[»]
    1NU2X-ray1.90A23-174[»]
    1OQNX-ray2.30A/B25-183[»]
    ProteinModelPortaliP97318.
    SMRiP97318. Positions 23-174.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiP97318.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini36 – 189154PIDPROSITE-ProRule annotationAdd
    BLAST

    Domaini

    The PID domain specifically binds to the Asn-Pro-Xaa-Tyr(P) motif found in many tyrosine-phosphorylated proteins.

    Sequence similaritiesi

    Contains 1 PID domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG313182.
    GeneTreeiENSGT00520000055585.
    HOVERGENiHBG018945.
    InParanoidiP97318.
    OMAiFQMAQPP.
    OrthoDBiEOG7HQN7R.
    PhylomeDBiP97318.
    TreeFamiTF316724.

    Family and domain databases

    Gene3Di2.30.29.30. 1 hit.
    InterProiIPR011993. PH_like_dom.
    IPR006020. PTB/PI_dom.
    [Graphical view]
    PfamiPF00640. PID. 1 hit.
    [Graphical view]
    SMARTiSM00462. PTB. 1 hit.
    [Graphical view]
    PROSITEiPS01179. PID. 1 hit.
    [Graphical view]

    Sequences (7)i

    Sequence statusi: Complete.

    This entry describes 7 isoformsi produced by alternative splicing. Align

    Isoform DAB588 (identifier: P97318-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSTETELQVA VKTSAKKDSR KKGQDRSEAT LIKRFKGEGV RYKAKLIGID    50
    EVSAARGDKL CQDSMMKLKG VVAGARSKGE HKQKIFLTIS FGGIKIFDEK 100
    TGALQHHHAV HEISYIAKDI TDHRAFGYVC GKEGNHRFVA IKTAQAAEPV 150
    ILDLRDLFQL IYELKQREEL EKKAQKDKQC EQAVYQTILE EDVEDPVYQY 200
    IVFEAGHEPI RDPETEENIY QVPTSQKKEG VYDVPKSQPN SQPLEDFESR 250
    FAAATPNRNL SMDFDELLEA TKVSAVTQLE LFGDMSTPPD ITSPPTPATP 300
    GDAFLPSSSQ TLPGSADVFG SMSFGTAAVP SGYVAMGAVL PSFWGQQPLV 350
    QQQIAMGAQP PVAQVIPGAQ PIAWGQPGLF PATQQAWPTV AGQFPPAAFM 400
    PTQTVMPLAA AMFQGPLTPL ATVPGTNDSA RSSPQSDKPR QKMGKESFKD 450
    FQMVQPPPVP SRKPDQPSLT CTSEAFSSYF NKVGVAQDTD DCDDFDISQL 500
    NLTPVTSTTP STNSPPTPAP RQSSPSKSSA SHVSDPTADD IFEEGFESPS 550
    KSEEQEAPDG SQASSTSDPF GEPSGEPSGD NISPQDGS 588

    Note: No experimental confirmation available.

    Length:588
    Mass (Da):63,578
    Last modified:June 1, 1998 - v2
    Checksum:i08404220792B1DB4
    GO
    Isoform DAB197 (identifier: P97318-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         2-23: STETELQVAVKTSAKKDSRKKG → LC
         200-217: YIVFEAGHEPIRDPETEE → VISEPRQGFACSCEGSFD
         218-588: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:197
    Mass (Da):22,236
    Checksum:i6AF789B4EC7FF6E9
    GO
    Isoform DAB204 (identifier: P97318-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         200-204: YIVFE → NLQKN
         205-588: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:204
    Mass (Da):23,077
    Checksum:i36271043EFC36BB4
    GO
    Isoform DAB217 (identifier: P97318-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         200-217: YIVFEAGHEPIRDPETEE → VISEPRQGFACSCEGSFD
         218-588: Missing.

    Show »
    Length:217
    Mass (Da):24,394
    Checksum:i17E7E398F5D1DC01
    GO
    Isoform DAB271 (identifier: P97318-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         240-272: Missing.
         275-304: AVTQLELFGDMSTPPDITSPPTPATPGDAF → SLVQSPAAERAEAESRTGPAEPGSILRPLG
         305-588: Missing.

    Show »
    Length:271
    Mass (Da):30,296
    Checksum:iFA4A8CE9812EB55C
    GO
    Isoform DAB553 (identifier: P97318-8) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         187-221: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:553
    Mass (Da):59,415
    Checksum:i8B281EE7C3CFD2F2
    GO
    Isoform DAB555 (identifier: P97318-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         240-272: Missing.

    Show »
    Length:555
    Mass (Da):59,838
    Checksum:i57A7130311954FE0
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti29 – 291A → R in BAB24163. (PubMed:16141072)Curated
    Sequence conflicti239 – 2391P → PVS in CAM17685. (PubMed:19468303)Curated
    Sequence conflicti239 – 2391P → PVS in CAM26758. (PubMed:19468303)Curated
    Sequence conflicti248 – 2481E → D in CAM17685. (PubMed:19468303)Curated
    Sequence conflicti248 – 2481E → D in CAM26758. (PubMed:19468303)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei2 – 2322STETE…SRKKG → LC in isoform DAB197. 1 PublicationVSP_026205Add
    BLAST
    Alternative sequencei187 – 22135Missing in isoform DAB553. CuratedVSP_026206Add
    BLAST
    Alternative sequencei200 – 21718YIVFE…PETEE → VISEPRQGFACSCEGSFD in isoform DAB197 and isoform DAB217. 2 PublicationsVSP_003841Add
    BLAST
    Alternative sequencei200 – 2045YIVFE → NLQKN in isoform DAB204. CuratedVSP_026208
    Alternative sequencei205 – 588384Missing in isoform DAB204. CuratedVSP_026209Add
    BLAST
    Alternative sequencei218 – 588371Missing in isoform DAB197 and isoform DAB217. 2 PublicationsVSP_003842Add
    BLAST
    Alternative sequencei240 – 27233Missing in isoform DAB555 and isoform DAB271. 1 PublicationVSP_003843Add
    BLAST
    Alternative sequencei275 – 30430AVTQL…PGDAF → SLVQSPAAERAEAESRTGPA EPGSILRPLG in isoform DAB271. 1 PublicationVSP_003844Add
    BLAST
    Alternative sequencei305 – 588284Missing in isoform DAB271. 1 PublicationVSP_003845Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Y08380 mRNA. Translation: CAA69663.1.
    Y08379 mRNA. Translation: CAA69662.1.
    Y08381 mRNA. Translation: CAA69664.1.
    Y08383 Genomic DNA. No translation available.
    AK005640 mRNA. Translation: BAB24163.1.
    AL627134, AL645483 Genomic DNA. Translation: CAM26758.1.
    AL627134, AL645483, AL669938 Genomic DNA. Translation: CAM26759.1.
    AL627134, AL645483, AL669938 Genomic DNA. Translation: CAM26760.1.
    AL627134, AL645483, AL669938 Genomic DNA. Translation: CAM26762.1.
    AL627134, AL645483, AL669938 Genomic DNA. Translation: CAM26765.1.
    AL645483, AL627134 Genomic DNA. Translation: CAM17685.1.
    AL645483, AL627134, AL669938 Genomic DNA. Translation: CAM17686.1.
    AL645483, AL627134, AL669938 Genomic DNA. Translation: CAM17687.1.
    AL645483, AL627134, AL669938 Genomic DNA. Translation: CAM17689.1.
    AL645483, AL627134, AL669938 Genomic DNA. Translation: CAM17690.1.
    AL669938, AL627134, AL645483 Genomic DNA. Translation: CAM19059.1.
    AL669938, AL627134, AL645483 Genomic DNA. Translation: CAM19060.1.
    AL669938, AL627134, AL645483 Genomic DNA. Translation: CAM19062.1.
    AL669938, AL627134, AL645483 Genomic DNA. Translation: CAM19063.1.
    CCDSiCCDS18413.1. [P97318-2]
    RefSeqiNP_034144.1. NM_010014.3. [P97318-6]
    NP_796233.2. NM_177259.4. [P97318-2]
    XP_006502794.1. XM_006502731.1. [P97318-2]
    UniGeneiMm.289682.

    Genome annotation databases

    EnsembliENSMUST00000106826; ENSMUSP00000102439; ENSMUSG00000028519. [P97318-4]
    ENSMUST00000106827; ENSMUSP00000102440; ENSMUSG00000028519. [P97318-5]
    ENSMUST00000106830; ENSMUSP00000102443; ENSMUSG00000028519. [P97318-2]
    GeneIDi13131.
    KEGGimmu:13131.
    UCSCiuc008txu.1. mouse. [P97318-5]
    uc008txv.1. mouse. [P97318-6]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    Y08380 mRNA. Translation: CAA69663.1 .
    Y08379 mRNA. Translation: CAA69662.1 .
    Y08381 mRNA. Translation: CAA69664.1 .
    Y08383 Genomic DNA. No translation available.
    AK005640 mRNA. Translation: BAB24163.1 .
    AL627134 , AL645483 Genomic DNA. Translation: CAM26758.1 .
    AL627134 , AL645483 , AL669938 Genomic DNA. Translation: CAM26759.1 .
    AL627134 , AL645483 , AL669938 Genomic DNA. Translation: CAM26760.1 .
    AL627134 , AL645483 , AL669938 Genomic DNA. Translation: CAM26762.1 .
    AL627134 , AL645483 , AL669938 Genomic DNA. Translation: CAM26765.1 .
    AL645483 , AL627134 Genomic DNA. Translation: CAM17685.1 .
    AL645483 , AL627134 , AL669938 Genomic DNA. Translation: CAM17686.1 .
    AL645483 , AL627134 , AL669938 Genomic DNA. Translation: CAM17687.1 .
    AL645483 , AL627134 , AL669938 Genomic DNA. Translation: CAM17689.1 .
    AL645483 , AL627134 , AL669938 Genomic DNA. Translation: CAM17690.1 .
    AL669938 , AL627134 , AL645483 Genomic DNA. Translation: CAM19059.1 .
    AL669938 , AL627134 , AL645483 Genomic DNA. Translation: CAM19060.1 .
    AL669938 , AL627134 , AL645483 Genomic DNA. Translation: CAM19062.1 .
    AL669938 , AL627134 , AL645483 Genomic DNA. Translation: CAM19063.1 .
    CCDSi CCDS18413.1. [P97318-2 ]
    RefSeqi NP_034144.1. NM_010014.3. [P97318-6 ]
    NP_796233.2. NM_177259.4. [P97318-2 ]
    XP_006502794.1. XM_006502731.1. [P97318-2 ]
    UniGenei Mm.289682.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1NTV X-ray 1.50 A 23-174 [» ]
    1NU2 X-ray 1.90 A 23-174 [» ]
    1OQN X-ray 2.30 A/B 25-183 [» ]
    ProteinModelPortali P97318.
    SMRi P97318. Positions 23-174.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 199042. 14 interactions.
    DIPi DIP-30902N.
    IntActi P97318. 16 interactions.
    MINTi MINT-258594.

    PTM databases

    PhosphoSitei P97318.

    Proteomic databases

    MaxQBi P97318.
    PRIDEi P97318.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000106826 ; ENSMUSP00000102439 ; ENSMUSG00000028519 . [P97318-4 ]
    ENSMUST00000106827 ; ENSMUSP00000102440 ; ENSMUSG00000028519 . [P97318-5 ]
    ENSMUST00000106830 ; ENSMUSP00000102443 ; ENSMUSG00000028519 . [P97318-2 ]
    GeneIDi 13131.
    KEGGi mmu:13131.
    UCSCi uc008txu.1. mouse. [P97318-5 ]
    uc008txv.1. mouse. [P97318-6 ]

    Organism-specific databases

    CTDi 1600.
    MGIi MGI:108554. Dab1.

    Phylogenomic databases

    eggNOGi NOG313182.
    GeneTreei ENSGT00520000055585.
    HOVERGENi HBG018945.
    InParanoidi P97318.
    OMAi FQMAQPP.
    OrthoDBi EOG7HQN7R.
    PhylomeDBi P97318.
    TreeFami TF316724.

    Miscellaneous databases

    ChiTaRSi DAB1. mouse.
    EvolutionaryTracei P97318.
    NextBioi 283176.
    PROi P97318.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P97318.
    Bgeei P97318.
    CleanExi MM_DAB1.
    Genevestigatori P97318.

    Family and domain databases

    Gene3Di 2.30.29.30. 1 hit.
    InterProi IPR011993. PH_like_dom.
    IPR006020. PTB/PI_dom.
    [Graphical view ]
    Pfami PF00640. PID. 1 hit.
    [Graphical view ]
    SMARTi SM00462. PTB. 1 hit.
    [Graphical view ]
    PROSITEi PS01179. PID. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Mouse disabled (mDab1): a Src binding protein implicated in neuronal development."
      Howell B.W., Gertler F.B., Cooper J.A.
      EMBO J. 16:121-132(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS DAB217; DAB271 AND DAB555), FUNCTION, SUBUNIT, TISSUE SPECIFICITY.
      Tissue: Embryonic brain.
    2. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM DAB197).
      Strain: C57BL/6J.
      Tissue: Testis.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    4. "Dab1 tyrosine phosphorylation sites relay positional signals during mouse brain development."
      Howell B.W., Herrick T.M., Hildebrand J.D., Zhang Y., Cooper J.A.
      Curr. Biol. 10:877-885(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION AT TYR-198 AND TYR-232, MUTAGENESIS OF TYR-185; TYR-198; TYR-200; TYR-220 AND TYR-232.
    5. "Identification of reelin-induced sites of tyrosyl phosphorylation on disabled 1."
      Keshvara L., Benhayon D., Magdaleno S., Curran T.
      J. Biol. Chem. 276:16008-16014(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION AT TYR-198 AND TYR-220.
    6. "Cyclin-dependent kinase 5 phosphorylates disabled 1 independently of reelin signaling."
      Keshvara L., Magdaleno S., Benhayon D., Curran T.
      J. Neurosci. 22:4869-4877(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION AT SER-524.
    7. Cited for: INTERACTION WITH SIAH1.
    8. "Activation of a Dab1/CrkL/C3G/Rap1 pathway in Reelin-stimulated neurons."
      Ballif B.A., Arnaud L., Arthur W.T., Guris D., Imamoto A., Cooper J.A.
      Curr. Biol. 14:606-610(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION AT TYR-220 AND TYR-232, INTERACTION WITH CRK AND CRKL, MUTAGENESIS OF TYR-220 AND TYR-232.
    9. "Crystal structures of the Dab homology domains of mouse disabled 1 and 2."
      Yun M., Keshvara L., Park C.G., Zhang Y.M., Dickerson J.B., Zheng J., Rock C.O., Curran T., Park H.W.
      J. Biol. Chem. 278:36572-36581(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS) OF 25-183, INTERACTION WITH PHOSPHATIDYLINOSITIDES AND APLP1, MUTAGENESIS OF LYS-45; LYS-82; SER-114; HIS-136 AND PHE-158.
    10. "Origins of peptide selectivity and phosphoinositide binding revealed by structures of disabled-1 PTB domain complexes."
      Stolt P.C., Jeon H., Song H.K., Herz J., Eck M.J., Blacklow S.C.
      Structure 11:569-579(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (1.9 ANGSTROMS) OF 23-174, INTERACTION WITH LRP8 AND VLDLR.

    Entry informationi

    Entry nameiDAB1_MOUSE
    AccessioniPrimary (citable) accession number: P97318
    Secondary accession number(s): A2A963
    , A2A964, A2A965, A2A966, A2A967, A2A970, P97316, P97317, Q9DAP9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 11, 2002
    Last sequence update: June 1, 1998
    Last modified: October 1, 2014
    This is version 123 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3