Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Disabled homolog 1

Gene

Dab1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Adapter molecule functioning in neural development. May regulate SIAH1 activity.1 Publication

GO - Molecular functioni

  • phospholipid binding Source: UniProtKB
  • SH2 domain binding Source: UniProtKB

GO - Biological processi

  • adult walking behavior Source: MGI
  • cell-cell adhesion involved in neuronal-glial interactions involved in cerebral cortex radial glia guided migration Source: MGI
  • central nervous system development Source: UniProtKB
  • cerebellum structural organization Source: MGI
  • cerebral cortex cell migration Source: MGI
  • cerebral cortex radially oriented cell migration Source: MGI
  • dendrite development Source: MGI
  • Golgi localization Source: MGI
  • intracellular signal transduction Source: UniProtKB
  • lateral motor column neuron migration Source: UniProtKB
  • midgut development Source: Ensembl
  • negative regulation of astrocyte differentiation Source: MGI
  • negative regulation of axonogenesis Source: MGI
  • negative regulation of cell adhesion Source: MGI
  • negative regulation of JAK-STAT cascade Source: MGI
  • nervous system development Source: UniProtKB
  • neuron migration Source: MGI
  • positive regulation of neuron differentiation Source: MGI
  • positive regulation of protein kinase activity Source: MGI
  • radial glia guided migration of Purkinje cell Source: MGI
  • response to drug Source: Ensembl
  • small GTPase mediated signal transduction Source: MGI
  • ventral spinal cord development Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Differentiation, Neurogenesis

Enzyme and pathway databases

ReactomeiR-MMU-8866376. Reelin signalling pathway.

Names & Taxonomyi

Protein namesi
Recommended name:
Disabled homolog 1
Gene namesi
Name:Dab1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 4

Organism-specific databases

MGIiMGI:108554. Dab1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi45K → A: Impairs binding to PtdIns(4,5)P2. 1 Publication1
Mutagenesisi82K → A: Abolishes binding to PtdIns(4,5)P2. 1 Publication1
Mutagenesisi114S → T: Abolishes interaction with APLP1. 1 Publication1
Mutagenesisi136H → R: Greatly impairs interaction with APLP1. 1 Publication1
Mutagenesisi158F → V: Abolishes interaction with APLP1. 1 Publication1
Mutagenesisi185Y → F: Reduces phosphorylation by SRC or downstream kinase; when associated with F-198 and F-200. Abolishes phosphorylation by SRC or downstream kinase; when associated with F-198; F-200; F-220 and F-232. 1 Publication1
Mutagenesisi198Y → F: Reduces phosphorylation by SRC or downstream kinase; when associated with F-185 and F-200. Abolishes phosphorylation by SRC or downstream kinase; when associated with F-185; F-200; F-220 and F-232. 1 Publication1
Mutagenesisi200Y → F: Reduces phosphorylation by SRC or downstream kinase; when associated with F-185 and F-198. Abolishes phosphorylation by SRC or downstream kinase; when associated with F-185; F-198; F-220 and F-232. 1 Publication1
Mutagenesisi220Y → F: Reduces phosphorylation by SRC or downstream kinase; when associated with F-232. Abolishes phosphorylation by SRC or downstream kinase; when associated with F-185; F-198; F-200 and F-232. Abolishes interaction with CRKL SH2 domain; when associated with F-232. 2 Publications1
Mutagenesisi232Y → F: Reduces phosphorylation by SRC or downstream kinase; when associated with F-220. Abolishes phosphorylation by SRC or downstream kinase; when associated with F-185; F-198; F-200 and F-220. Abolishes interaction with CRKL SH2 domain; when associated with F-220. 2 Publications1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000797691 – 588Disabled homolog 1Add BLAST588

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei198Phosphotyrosine2 Publications1
Modified residuei220Phosphotyrosine2 Publications1
Modified residuei232Phosphotyrosine2 Publications1
Modified residuei524Phosphoserine; by CDK51 Publication1

Post-translational modificationi

Phosphorylated on Tyr-198 and Tyr-220 upon reelin induction in embryonic neurons (PubMed:11279201). Also found phosphorylated on Tyr-232 upon reelin induction (PubMed:15062102). Also phosphorylated on Ser-524 independently of reelin signaling.4 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiP97318.
PRIDEiP97318.

PTM databases

iPTMnetiP97318.
PhosphoSitePlusiP97318.

Expressioni

Tissue specificityi

Expressed mainly in brain.1 Publication

Gene expression databases

BgeeiENSMUSG00000028519.
CleanExiMM_DAB1.
ExpressionAtlasiP97318. baseline and differential.
GenevisibleiP97318. MM.

Interactioni

Subunit structurei

Associates with the SH2 domains of SRC, FYN and ABL. Interacts (phosphorylated on tyrosine residues) with CRK and CRKL (via respective SH2 domain). Interacts with DAB2IP, SIAH1, LRP1, LRP8 and VLDLR. Interacts with APLP1 (via NPXY motif).5 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
Aplp1Q031574EBI-81680,EBI-399929
AppP120233EBI-81680,EBI-78814
Dab2ipQ3UHC73EBI-81680,EBI-6306507
Lrp1Q91ZX72EBI-81680,EBI-300955
Lrp2A2ARV42EBI-81680,EBI-300875
Pcdh18Q8VHR02EBI-81680,EBI-399910
Siah1aP610923EBI-81680,EBI-446761

GO - Molecular functioni

  • SH2 domain binding Source: UniProtKB

Protein-protein interaction databases

BioGridi199042. 13 interactors.
DIPiDIP-30902N.
IntActiP97318. 16 interactors.
MINTiMINT-258594.

Structurei

Secondary structure

1588
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi28 – 35Combined sources8
Beta strandi40 – 51Combined sources12
Beta strandi53 – 55Combined sources3
Helixi58 – 76Combined sources19
Turni77 – 79Combined sources3
Beta strandi83 – 90Combined sources8
Beta strandi93 – 98Combined sources6
Turni99 – 101Combined sources3
Beta strandi104 – 108Combined sources5
Helixi110 – 112Combined sources3
Beta strandi113 – 118Combined sources6
Beta strandi125 – 132Combined sources8
Beta strandi137 – 145Combined sources9
Helixi148 – 166Combined sources19
Helixi170 – 173Combined sources4

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1NTVX-ray1.50A23-174[»]
1NU2X-ray1.90A23-174[»]
1OQNX-ray2.30A/B25-183[»]
ProteinModelPortaliP97318.
SMRiP97318.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP97318.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini36 – 189PIDPROSITE-ProRule annotationAdd BLAST154

Domaini

The PID domain specifically binds to the Asn-Pro-Xaa-Tyr(P) motif found in many tyrosine-phosphorylated proteins.

Sequence similaritiesi

Contains 1 PID domain.PROSITE-ProRule annotation

Phylogenomic databases

GeneTreeiENSGT00520000055585.
HOVERGENiHBG018945.
InParanoidiP97318.
KOiK20054.
OMAiFQMAQPP.
PhylomeDBiP97318.
TreeFamiTF316724.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR011993. PH_dom-like.
IPR006020. PTB/PI_dom.
[Graphical view]
PfamiPF00640. PID. 1 hit.
[Graphical view]
SMARTiSM00462. PTB. 1 hit.
[Graphical view]
SUPFAMiSSF50729. SSF50729. 1 hit.
PROSITEiPS01179. PID. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform DAB588 (identifier: P97318-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSTETELQVA VKTSAKKDSR KKGQDRSEAT LIKRFKGEGV RYKAKLIGID
60 70 80 90 100
EVSAARGDKL CQDSMMKLKG VVAGARSKGE HKQKIFLTIS FGGIKIFDEK
110 120 130 140 150
TGALQHHHAV HEISYIAKDI TDHRAFGYVC GKEGNHRFVA IKTAQAAEPV
160 170 180 190 200
ILDLRDLFQL IYELKQREEL EKKAQKDKQC EQAVYQTILE EDVEDPVYQY
210 220 230 240 250
IVFEAGHEPI RDPETEENIY QVPTSQKKEG VYDVPKSQPN SQPLEDFESR
260 270 280 290 300
FAAATPNRNL SMDFDELLEA TKVSAVTQLE LFGDMSTPPD ITSPPTPATP
310 320 330 340 350
GDAFLPSSSQ TLPGSADVFG SMSFGTAAVP SGYVAMGAVL PSFWGQQPLV
360 370 380 390 400
QQQIAMGAQP PVAQVIPGAQ PIAWGQPGLF PATQQAWPTV AGQFPPAAFM
410 420 430 440 450
PTQTVMPLAA AMFQGPLTPL ATVPGTNDSA RSSPQSDKPR QKMGKESFKD
460 470 480 490 500
FQMVQPPPVP SRKPDQPSLT CTSEAFSSYF NKVGVAQDTD DCDDFDISQL
510 520 530 540 550
NLTPVTSTTP STNSPPTPAP RQSSPSKSSA SHVSDPTADD IFEEGFESPS
560 570 580
KSEEQEAPDG SQASSTSDPF GEPSGEPSGD NISPQDGS
Note: No experimental confirmation available.
Length:588
Mass (Da):63,578
Last modified:June 1, 1998 - v2
Checksum:i08404220792B1DB4
GO
Isoform DAB197 (identifier: P97318-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2-23: STETELQVAVKTSAKKDSRKKG → LC
     200-217: YIVFEAGHEPIRDPETEE → VISEPRQGFACSCEGSFD
     218-588: Missing.

Note: No experimental confirmation available.
Show »
Length:197
Mass (Da):22,236
Checksum:i6AF789B4EC7FF6E9
GO
Isoform DAB204 (identifier: P97318-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     200-204: YIVFE → NLQKN
     205-588: Missing.

Note: No experimental confirmation available.
Show »
Length:204
Mass (Da):23,077
Checksum:i36271043EFC36BB4
GO
Isoform DAB217 (identifier: P97318-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     200-217: YIVFEAGHEPIRDPETEE → VISEPRQGFACSCEGSFD
     218-588: Missing.

Show »
Length:217
Mass (Da):24,394
Checksum:i17E7E398F5D1DC01
GO
Isoform DAB271 (identifier: P97318-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     240-272: Missing.
     275-304: AVTQLELFGDMSTPPDITSPPTPATPGDAF → SLVQSPAAERAEAESRTGPAEPGSILRPLG
     305-588: Missing.

Show »
Length:271
Mass (Da):30,296
Checksum:iFA4A8CE9812EB55C
GO
Isoform DAB553 (identifier: P97318-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     187-221: Missing.

Note: No experimental confirmation available.
Show »
Length:553
Mass (Da):59,415
Checksum:i8B281EE7C3CFD2F2
GO
Isoform DAB555 (identifier: P97318-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     240-272: Missing.

Show »
Length:555
Mass (Da):59,838
Checksum:i57A7130311954FE0
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti29A → R in BAB24163 (PubMed:16141072).Curated1
Sequence conflicti239P → PVS in CAM17685 (PubMed:19468303).Curated1
Sequence conflicti239P → PVS in CAM26758 (PubMed:19468303).Curated1
Sequence conflicti248E → D in CAM17685 (PubMed:19468303).Curated1
Sequence conflicti248E → D in CAM26758 (PubMed:19468303).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0262052 – 23STETE…SRKKG → LC in isoform DAB197. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_026206187 – 221Missing in isoform DAB553. CuratedAdd BLAST35
Alternative sequenceiVSP_003841200 – 217YIVFE…PETEE → VISEPRQGFACSCEGSFD in isoform DAB197 and isoform DAB217. 2 PublicationsAdd BLAST18
Alternative sequenceiVSP_026208200 – 204YIVFE → NLQKN in isoform DAB204. Curated5
Alternative sequenceiVSP_026209205 – 588Missing in isoform DAB204. CuratedAdd BLAST384
Alternative sequenceiVSP_003842218 – 588Missing in isoform DAB197 and isoform DAB217. 2 PublicationsAdd BLAST371
Alternative sequenceiVSP_003843240 – 272Missing in isoform DAB555 and isoform DAB271. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_003844275 – 304AVTQL…PGDAF → SLVQSPAAERAEAESRTGPA EPGSILRPLG in isoform DAB271. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_003845305 – 588Missing in isoform DAB271. 1 PublicationAdd BLAST284

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y08380 mRNA. Translation: CAA69663.1.
Y08379 mRNA. Translation: CAA69662.1.
Y08381 mRNA. Translation: CAA69664.1.
Y08383 Genomic DNA. No translation available.
AK005640 mRNA. Translation: BAB24163.1.
AL627134, AL645483 Genomic DNA. Translation: CAM26758.1.
AL627134, AL645483, AL669938 Genomic DNA. Translation: CAM26759.1.
AL627134, AL645483, AL669938 Genomic DNA. Translation: CAM26760.1.
AL627134, AL645483, AL669938 Genomic DNA. Translation: CAM26762.1.
AL627134, AL645483, AL669938 Genomic DNA. Translation: CAM26765.1.
AL645483, AL627134 Genomic DNA. Translation: CAM17685.1.
AL645483, AL627134, AL669938 Genomic DNA. Translation: CAM17686.1.
AL645483, AL627134, AL669938 Genomic DNA. Translation: CAM17687.1.
AL645483, AL627134, AL669938 Genomic DNA. Translation: CAM17689.1.
AL645483, AL627134, AL669938 Genomic DNA. Translation: CAM17690.1.
AL669938, AL627134, AL645483 Genomic DNA. Translation: CAM19059.1.
AL669938, AL627134, AL645483 Genomic DNA. Translation: CAM19060.1.
AL669938, AL627134, AL645483 Genomic DNA. Translation: CAM19062.1.
AL669938, AL627134, AL645483 Genomic DNA. Translation: CAM19063.1.
CCDSiCCDS18413.1. [P97318-2]
RefSeqiNP_034144.1. NM_010014.3. [P97318-6]
NP_796233.2. NM_177259.4. [P97318-2]
XP_011238731.1. XM_011240429.2. [P97318-2]
UniGeneiMm.289682.

Genome annotation databases

EnsembliENSMUST00000106826; ENSMUSP00000102439; ENSMUSG00000028519. [P97318-4]
ENSMUST00000106827; ENSMUSP00000102440; ENSMUSG00000028519. [P97318-5]
ENSMUST00000106830; ENSMUSP00000102443; ENSMUSG00000028519. [P97318-2]
GeneIDi13131.
KEGGimmu:13131.
UCSCiuc008txu.1. mouse. [P97318-5]
uc008txv.2. mouse. [P97318-6]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y08380 mRNA. Translation: CAA69663.1.
Y08379 mRNA. Translation: CAA69662.1.
Y08381 mRNA. Translation: CAA69664.1.
Y08383 Genomic DNA. No translation available.
AK005640 mRNA. Translation: BAB24163.1.
AL627134, AL645483 Genomic DNA. Translation: CAM26758.1.
AL627134, AL645483, AL669938 Genomic DNA. Translation: CAM26759.1.
AL627134, AL645483, AL669938 Genomic DNA. Translation: CAM26760.1.
AL627134, AL645483, AL669938 Genomic DNA. Translation: CAM26762.1.
AL627134, AL645483, AL669938 Genomic DNA. Translation: CAM26765.1.
AL645483, AL627134 Genomic DNA. Translation: CAM17685.1.
AL645483, AL627134, AL669938 Genomic DNA. Translation: CAM17686.1.
AL645483, AL627134, AL669938 Genomic DNA. Translation: CAM17687.1.
AL645483, AL627134, AL669938 Genomic DNA. Translation: CAM17689.1.
AL645483, AL627134, AL669938 Genomic DNA. Translation: CAM17690.1.
AL669938, AL627134, AL645483 Genomic DNA. Translation: CAM19059.1.
AL669938, AL627134, AL645483 Genomic DNA. Translation: CAM19060.1.
AL669938, AL627134, AL645483 Genomic DNA. Translation: CAM19062.1.
AL669938, AL627134, AL645483 Genomic DNA. Translation: CAM19063.1.
CCDSiCCDS18413.1. [P97318-2]
RefSeqiNP_034144.1. NM_010014.3. [P97318-6]
NP_796233.2. NM_177259.4. [P97318-2]
XP_011238731.1. XM_011240429.2. [P97318-2]
UniGeneiMm.289682.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1NTVX-ray1.50A23-174[»]
1NU2X-ray1.90A23-174[»]
1OQNX-ray2.30A/B25-183[»]
ProteinModelPortaliP97318.
SMRiP97318.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi199042. 13 interactors.
DIPiDIP-30902N.
IntActiP97318. 16 interactors.
MINTiMINT-258594.

PTM databases

iPTMnetiP97318.
PhosphoSitePlusiP97318.

Proteomic databases

MaxQBiP97318.
PRIDEiP97318.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000106826; ENSMUSP00000102439; ENSMUSG00000028519. [P97318-4]
ENSMUST00000106827; ENSMUSP00000102440; ENSMUSG00000028519. [P97318-5]
ENSMUST00000106830; ENSMUSP00000102443; ENSMUSG00000028519. [P97318-2]
GeneIDi13131.
KEGGimmu:13131.
UCSCiuc008txu.1. mouse. [P97318-5]
uc008txv.2. mouse. [P97318-6]

Organism-specific databases

CTDi1600.
MGIiMGI:108554. Dab1.

Phylogenomic databases

GeneTreeiENSGT00520000055585.
HOVERGENiHBG018945.
InParanoidiP97318.
KOiK20054.
OMAiFQMAQPP.
PhylomeDBiP97318.
TreeFamiTF316724.

Enzyme and pathway databases

ReactomeiR-MMU-8866376. Reelin signalling pathway.

Miscellaneous databases

ChiTaRSiDab1. mouse.
EvolutionaryTraceiP97318.
PROiP97318.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000028519.
CleanExiMM_DAB1.
ExpressionAtlasiP97318. baseline and differential.
GenevisibleiP97318. MM.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR011993. PH_dom-like.
IPR006020. PTB/PI_dom.
[Graphical view]
PfamiPF00640. PID. 1 hit.
[Graphical view]
SMARTiSM00462. PTB. 1 hit.
[Graphical view]
SUPFAMiSSF50729. SSF50729. 1 hit.
PROSITEiPS01179. PID. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiDAB1_MOUSE
AccessioniPrimary (citable) accession number: P97318
Secondary accession number(s): A2A963
, A2A964, A2A965, A2A966, A2A967, A2A970, P97316, P97317, Q9DAP9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 11, 2002
Last sequence update: June 1, 1998
Last modified: November 2, 2016
This is version 140 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.