P97305 (NFAC3_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 115.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Nuclear factor of activated T-cells, cytoplasmic 3 Short name=NF-ATc3 Short name=NFATc3 Alternative name(s): NFATx T-cell transcription factor NFAT4 Short name=NF-AT4 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 1075 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Acts as a regulator of transcriptional activation. Plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2 By similarity. |
| Subunit structure | Member of the multicomponent NFATC transcription complex that consists of at least two components, a pre-existing cytoplasmic component NFATC2 and an inducible nuclear component NFATC1. Other members such as NFATC4, NFATC3 or members of the activating protein-1 family, MAF, GATA4 and Cbp/p300 can also bind the complex. NFATC proteins bind to DNA as monomers. |
| Subcellular location | Cytoplasm. Nucleus. Note: Cytoplasmic for the phosphorylated form and nuclear after activation that is controlled by calcineurin-mediated dephosphorylation. Rapid nuclear exit of NFATC is thought to be one mechanism by which cells distinguish between sustained and transient calcium signals. The subcellular localization of NFATC plays a key role in the regulation of gene transcription. |
| Tissue specificity | Expressed in thymus. Weakly expressed in muscle, spleen and kidney. Also expressed in lymph node. |
| Domain | Rel Similarity Domain (RSD) allows DNA-binding and cooperative interactions with AP1 factors By similarity. |
| Post-translational modification | Phosphorylated by NFATC-kinase; dephosphorylated by calcineurin By similarity. |
| Sequence similarities | Contains 1 RHD (Rel-like) domain. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform X1 (identifier: P97305-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform X2 (identifier: P97305-2) The sequence of this isoform differs from the canonical sequence as follows: 1035-1075: VNEIIGRDMSQISVSQATEVMRDTPLPGPASPDLMTSHSAH → DQLISDLEHQPSGSTEKWSNHSEFSCPVPFWRI | ||||||
| Isoform Delta-X (identifier: P97305-3) The sequence of this isoform differs from the canonical sequence as follows: 468-497: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed By similarity | ||||||
| Chain | 2 – 1075 | 1074 | Nuclear factor of activated T-cells, cytoplasmic 3 | PRO_0000205181 | |||||
Regions | |||||||||
| Repeat | 207 – 223 | 17 | 1 | ||||||
| Repeat | 236 – 252 | 17 | 2 | ||||||
| Repeat | 292 – 308 | 17 | 3 | ||||||
| Domain | 415 – 596 | 182 | RHD | ||||||
| DNA binding | 444 – 451 | 8 | By similarity | ||||||
| Region | 109 – 114 | 6 | Calcineurin-binding | ||||||
| Region | 207 – 308 | 102 | 3 X SP repeats | ||||||
| Motif | 273 – 275 | 3 | Nuclear localization signal | ||||||
| Motif | 686 – 688 | 3 | Nuclear localization signal | ||||||
| Motif | 1031 – 1040 | 10 | Nuclear export signal | ||||||
| Compositional bias | 24 – 29 | 6 | Poly-Pro | ||||||
Amino acid modifications | |||||||||
| Modified residue | 2 | 1 | N-acetylthreonine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 468 – 497 | 30 | Missing in isoform Delta-X. | VSP_005603 | |||||
| Alternative sequence | 1035 – 1075 | 41 | VNEII…SHSAH → DQLISDLEHQPSGSTEKWSN HSEFSCPVPFWRI in isoform X2. | VSP_005604 | |||||
Experimental info | |||||||||
| Sequence conflict | 12 – 34 | 23 | LDFKL…GSRPA → PRRVLFSVSAQLPSRTRPGP SDL Ref.2 | ||||||
| Sequence conflict | 57 – 61 | 5 | TTPLC → NSSLG in AAA93249. Ref.2 | ||||||
| Sequence conflict | 68 | 1 | P → LQ Ref.2 | ||||||
| Sequence conflict | 82 – 83 | 2 | SH → GY in AAA93249. Ref.2 | ||||||
| Sequence conflict | 90 – 93 | 4 | CEIP → GDIS in AAA93249. Ref.2 | ||||||
| Sequence conflict | 113 | 1 | F → I in AAA93249. Ref.2 | ||||||
| Sequence conflict | 121 – 124 | 4 | QQEL → HQGT in AAA93249. Ref.2 | ||||||
| Sequence conflict | 132 | 1 | Q → H in AAA93249. Ref.2 | ||||||
| Sequence conflict | 140 | 1 | F → Y in AAA93249. Ref.2 | ||||||
| Sequence conflict | 641 | 1 | G → R in AAA93249. Ref.2 | ||||||
| Sequence conflict | 646 | 1 | V → A in AAA93249. Ref.2 | ||||||
| Sequence conflict | 707 – 734 | 28 | REDTD…SSETG → KEKTQICLQFHLCLCLILPS PEALLRDR in AAA93249. Ref.2 | ||||||
| Sequence conflict | 746 | 1 | G → S in AAA93249. Ref.2 | ||||||
| Sequence conflict | 1075 | 1 | H → Q in AAA93249. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| [1] | "NFATc3, a lymphoid-specific NFATc family member that is calcium-regulated and exhibits distinct DNA binding specificity." Ho S.N., Thomas D.J., Timmerman L.A., Li X., Francke U., Crabtree G.R. J. Biol. Chem. 270:19898-19907(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM X1). Tissue: Thymus. |
| [2] | "Calcineurin-dependent nuclear translocation of a murine transcription factor NFATx: molecular cloning and functional characterization." Liu J., Koyano-Nakagawa N., Amasaki Y., Saito-Ohara F., Ikeuchi T., Imai S., Takano T., Arai N., Yokota T., Arai K. Mol. Biol. Cell 8:157-170(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 12-1075 (ISOFORMS X1; X2 AND DELTA-X). Tissue: Thymic lymphoma. |
| [3] | "Generic signals and specific outcomes: signaling through Ca2+, calcineurin, and NF-AT." Crabtree G.R. Cell 96:611-614(1999) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | D85612 mRNA. Translation: BAA12833.1. U28807 mRNA. Translation: AAA93249.1. |
| IPI | IPI00123845. IPI00225469. IPI00225470. |
| UniGene | Mm.383185. |
3D structure databases | |
| ProteinModelPortal | P97305. |
| SMR | P97305. Positions 419-700. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | P97305. |
Proteomic databases | |
| PRIDE | P97305. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Organism-specific databases | |
| MGI | MGI:103296. Nfatc3. |
Phylogenomic databases | |
| eggNOG | NOG70055. |
| HOGENOM | HOG000231780. |
| HOVERGEN | HBG069754. |
| InParanoid | P97305. |
Gene expression databases | |
| Genevestigator | P97305. |
| GermOnline | ENSMUSG00000031902. Mus musculus. |
Family and domain databases | |
| Gene3D | 2.60.40.10. 1 hit. 2.60.40.340. 1 hit. |
| InterPro | IPR013783. Ig-like_fold. IPR014756. Ig_E-set. IPR002909. IPT_TIG_rcpt. IPR008366. NFAT. IPR008967. p53-like_TF_DNA-bd. IPR011539. RHD. [Graphical view] |
| PANTHER | PTHR12533. PTHR12533. 1 hit. |
| Pfam | PF00554. RHD. 1 hit. [Graphical view] |
| PRINTS | PR01789. NUCFACTORATC. |
| SMART | SM00429. IPT. 1 hit. [Graphical view] |
| SUPFAM | SSF81296. Ig_E-set. 1 hit. SSF49417. P53_like_DNA_bnd. 1 hit. |
| PROSITE | PS01204. REL_1. False negative. PS50254. REL_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| SOURCE | Search... |
Entry information
| Entry name | NFAC3_MOUSE | ||||||||
| Accession | Primary (citable) accession number: P97305 Secondary accession number(s): Q60896 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
