Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nuclear factor of activated T-cells, cytoplasmic 3

Gene

Nfatc3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Acts as a regulator of transcriptional activation. Plays a role in the inducible expression of cytokine genes in T-cells, especially in the induction of the IL-2 (By similarity).By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi444 – 451By similarity8

GO - Molecular functioni

GO - Biological processi

  • blood vessel remodeling Source: MGI
  • calcineurin-NFAT signaling cascade Source: MGI
  • cardiac muscle hypertrophy in response to stress Source: MGI
  • cellular respiration Source: MGI
  • cellular response to calcium ion Source: MGI
  • cellular response to lithium ion Source: MGI
  • heart development Source: MGI
  • muscle cell development Source: MGI
  • myotube cell development Source: MGI
  • myotube differentiation Source: MGI
  • negative regulation of pri-miRNA transcription from RNA polymerase II promoter Source: MGI
  • patterning of blood vessels Source: MGI
  • positive regulation of transcription from RNA polymerase II promoter Source: UniProtKB
  • regulation of store-operated calcium entry Source: MGI
  • regulation of transcription, DNA-templated Source: MGI
  • response to hypoxia Source: MGI
  • skeletal muscle fiber development Source: MGI
  • smooth muscle cell differentiation Source: MGI
  • T cell differentiation Source: MGI
  • thymus development Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Activator

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear factor of activated T-cells, cytoplasmic 3
Short name:
NF-ATc3
Short name:
NFATc3
Alternative name(s):
NFATx
T-cell transcription factor NFAT4
Short name:
NF-AT4
Gene namesi
Name:Nfatc3
Synonyms:Nfat4
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:103296. Nfatc3.

Subcellular locationi

  • Cytoplasm
  • Nucleus

  • Note: Cytoplasmic for the phosphorylated form and nuclear after activation that is controlled by calcineurin-mediated dephosphorylation. Rapid nuclear exit of NFATC is thought to be one mechanism by which cells distinguish between sustained and transient calcium signals. The subcellular localization of NFATC plays a key role in the regulation of gene transcription.

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • cytosol Source: MGI
  • nucleolus Source: MGI
  • nucleoplasm Source: MGI
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00002051812 – 1075Nuclear factor of activated T-cells, cytoplasmic 3Add BLAST1074

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylthreonineBy similarity1
Modified residuei344PhosphoserineCombined sources1
Modified residuei372PhosphoserineBy similarity1
Modified residuei1065PhosphoserineBy similarity1

Post-translational modificationi

Phosphorylated by NFATC-kinase; dephosphorylated by calcineurin.By similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiP97305.
PaxDbiP97305.
PRIDEiP97305.

PTM databases

iPTMnetiP97305.
PhosphoSitePlusiP97305.

Expressioni

Tissue specificityi

Expressed in thymus. Weakly expressed in muscle, spleen and kidney. Also expressed in lymph node.

Interactioni

Subunit structurei

Member of the multicomponent NFATC transcription complex that consists of at least two components, a pre-existing cytoplasmic component NFATC2 and an inducible nuclear component NFATC1. Other members such as NFATC4, NFATC3 or members of the activating protein-1 family, MAF, GATA4 and Cbp/p300 can also bind the complex. NFATC proteins bind to DNA as monomers.

GO - Molecular functioni

  • transcription factor binding Source: MGI

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000104931.

Structurei

3D structure databases

ProteinModelPortaliP97305.
SMRiP97305.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati207 – 2231Add BLAST17
Repeati236 – 2522Add BLAST17
Repeati292 – 3083Add BLAST17
Domaini415 – 596RHDPROSITE-ProRule annotationAdd BLAST182

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni109 – 114Calcineurin-binding6
Regioni207 – 3083 X SP repeatsAdd BLAST102

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi273 – 275Nuclear localization signal3
Motifi686 – 688Nuclear localization signal3
Motifi1031 – 1040Nuclear export signal10

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi24 – 29Poly-Pro6

Domaini

Rel Similarity Domain (RSD) allows DNA-binding and cooperative interactions with AP1 factors.By similarity

Sequence similaritiesi

Contains 1 RHD (Rel-like) domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiENOG410IIAD. Eukaryota.
ENOG4111EMW. LUCA.
HOGENOMiHOG000231780.
HOVERGENiHBG069754.
InParanoidiP97305.
PhylomeDBiP97305.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
2.60.40.340. 1 hit.
InterProiIPR013783. Ig-like_fold.
IPR014756. Ig_E-set.
IPR002909. IPT.
IPR008366. NFAT.
IPR008967. p53-like_TF_DNA-bd.
IPR032397. RHD_dimer.
IPR011539. RHD_DNA_bind_dom.
[Graphical view]
PANTHERiPTHR12533. PTHR12533. 1 hit.
PfamiPF16179. RHD_dimer. 1 hit.
PF00554. RHD_DNA_bind. 1 hit.
[Graphical view]
PRINTSiPR01789. NUCFACTORATC.
SMARTiSM00429. IPT. 1 hit.
[Graphical view]
SUPFAMiSSF49417. SSF49417. 1 hit.
SSF81296. SSF81296. 1 hit.
PROSITEiPS50254. REL_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform X1 (identifier: P97305-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTTANCGAHD ELDFKLVFGE DGAPAPPPPG SRPADLEPDD CASIYIFNVD
60 70 80 90 100
PPPSTLTTPL CLPHHGLPSH SSVLSPSFQL QSHKNYEGTC EIPESKYSPL
110 120 130 140 150
GGPKPFECPS IQFTSISPNC QQELDAHEDD LQINDPEREF LERPSRDHLY
160 170 180 190 200
LPLEPSYRES SLSPSPASSI SSRSWFSDAS SCESLSHIYD DVDSELNEAA
210 220 230 240 250
ARFTLGSPLT SPGGSPGGCP GEESWHQQYG SGHSLSPRQS PCHSPRSSIT
260 270 280 290 300
DENWLSPRPA SGPSSRPTSP CGKRRHSSAE VCYAGSLSPH HSPVPSPGHS
310 320 330 340 350
PRGSVTEDTW LTAPVHTGSG LSPAPFPFQY CVETDIPLKT RKTSEDQAAI
360 370 380 390 400
LPGKLEICSD DQGNLSPSRE TSVDDGLGSQ YPLKKDSSGD QFLSVPSPFT
410 420 430 440 450
WSKPKPGHTP IFRTSSLPPL DWPLPTHFGQ CELKIEVQPK THHRAHYETE
460 470 480 490 500
GSRGAVKAST GGHPVVKLLG YSEKPINLQM FIGTADDRYL RPHAFYQVHR
510 520 530 540 550
ITGKTVATAS QEIIIASTKV LEIPLLPENN MSASIDCAGI LKLRNSDIEL
560 570 580 590 600
RKGETDIGRK NTRVRLVFRV HIPQPSGKVL SLQIASIPVE CSQRSAQELP
610 620 630 640 650
HIEKYSINSC SVNGGHEMIV TGSNFLPESK IIFLEKGQDG GPHWEVEGKI
660 670 680 690 700
IREKCQGAHI VLEVPPYHNP AVTSAVQVHF YLCNGKRKKS QSQRFTYTPV
710 720 730 740 750
LMKQEQREDT DLPSVPSLPV PHSAQAQRPS SETGHPHDRA MSAPGGLLCQ
760 770 780 790 800
VQPAYTSMVA STHLPQLQCR DEGAGKEQHI ATSSVMHQPF QVTPTSPIGS
810 820 830 840 850
SYQSIQTSMY NGPTCLPVNP ASSQEFDPVL FQQDAALSSL VNLGCQPLSP
860 870 880 890 900
IPFHSSNSDA TGHLLAHSPH SVQTPPHLQS MGYHCSNAGQ TALSSPVADQ
910 920 930 940 950
ITGQPSSHLQ PITYCPSHPG SATAASPAAS HPLASSPISG PSSPQLQPMP
960 970 980 990 1000
YQSPSSGTAS SPSPTTRMHS GQHSTQAQST GQGGLSVPSS LVCHSLCDPA
1010 1020 1030 1040 1050
SFPPGGATVS IKPEPEDQEP NFATIGLQDI TLDDVNEIIG RDMSQISVSQ
1060 1070
ATEVMRDTPL PGPASPDLMT SHSAH
Length:1,075
Mass (Da):115,451
Last modified:May 1, 1997 - v1
Checksum:i4ED38C9AA6F452BB
GO
Isoform X2 (identifier: P97305-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1035-1075: VNEIIGRDMSQISVSQATEVMRDTPLPGPASPDLMTSHSAH → DQLISDLEHQPSGSTEKWSNHSEFSCPVPFWRI

Show »
Length:1,067
Mass (Da):114,932
Checksum:iD3F228D966EE4C3C
GO
Isoform Delta-X (identifier: P97305-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     468-497: Missing.

Show »
Length:1,045
Mass (Da):111,911
Checksum:i8C7DB1A257C2BE6E
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti12 – 34LDFKL…GSRPA → PRRVLFSVSAQLPSRTRPGP SDL (PubMed:9017603).CuratedAdd BLAST23
Sequence conflicti57 – 61TTPLC → NSSLG in AAA93249 (PubMed:9017603).Curated5
Sequence conflicti68P → LQ (PubMed:9017603).Curated1
Sequence conflicti82 – 83SH → GY in AAA93249 (PubMed:9017603).Curated2
Sequence conflicti90 – 93CEIP → GDIS in AAA93249 (PubMed:9017603).Curated4
Sequence conflicti113F → I in AAA93249 (PubMed:9017603).Curated1
Sequence conflicti121 – 124QQEL → HQGT in AAA93249 (PubMed:9017603).Curated4
Sequence conflicti132Q → H in AAA93249 (PubMed:9017603).Curated1
Sequence conflicti140F → Y in AAA93249 (PubMed:9017603).Curated1
Sequence conflicti641G → R in AAA93249 (PubMed:9017603).Curated1
Sequence conflicti646V → A in AAA93249 (PubMed:9017603).Curated1
Sequence conflicti707 – 734REDTD…SSETG → KEKTQICLQFHLCLCLILPS PEALLRDR in AAA93249 (PubMed:9017603).CuratedAdd BLAST28
Sequence conflicti746G → S in AAA93249 (PubMed:9017603).Curated1
Sequence conflicti1075H → Q in AAA93249 (PubMed:9017603).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_005603468 – 497Missing in isoform Delta-X. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_0056041035 – 1075VNEII…SHSAH → DQLISDLEHQPSGSTEKWSN HSEFSCPVPFWRI in isoform X2. 1 PublicationAdd BLAST41

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D85612 mRNA. Translation: BAA12833.1.
U28807 mRNA. Translation: AAA93249.1.
UniGeneiMm.383185.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D85612 mRNA. Translation: BAA12833.1.
U28807 mRNA. Translation: AAA93249.1.
UniGeneiMm.383185.

3D structure databases

ProteinModelPortaliP97305.
SMRiP97305.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000104931.

PTM databases

iPTMnetiP97305.
PhosphoSitePlusiP97305.

Proteomic databases

MaxQBiP97305.
PaxDbiP97305.
PRIDEiP97305.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Organism-specific databases

MGIiMGI:103296. Nfatc3.

Phylogenomic databases

eggNOGiENOG410IIAD. Eukaryota.
ENOG4111EMW. LUCA.
HOGENOMiHOG000231780.
HOVERGENiHBG069754.
InParanoidiP97305.
PhylomeDBiP97305.

Miscellaneous databases

PROiP97305.
SOURCEiSearch...

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
2.60.40.340. 1 hit.
InterProiIPR013783. Ig-like_fold.
IPR014756. Ig_E-set.
IPR002909. IPT.
IPR008366. NFAT.
IPR008967. p53-like_TF_DNA-bd.
IPR032397. RHD_dimer.
IPR011539. RHD_DNA_bind_dom.
[Graphical view]
PANTHERiPTHR12533. PTHR12533. 1 hit.
PfamiPF16179. RHD_dimer. 1 hit.
PF00554. RHD_DNA_bind. 1 hit.
[Graphical view]
PRINTSiPR01789. NUCFACTORATC.
SMARTiSM00429. IPT. 1 hit.
[Graphical view]
SUPFAMiSSF49417. SSF49417. 1 hit.
SSF81296. SSF81296. 1 hit.
PROSITEiPS50254. REL_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiNFAC3_MOUSE
AccessioniPrimary (citable) accession number: P97305
Secondary accession number(s): Q60896
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: May 1, 1997
Last modified: November 2, 2016
This is version 140 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.