Reviewed,
UniProtKB/Swiss-Prot P90986 (TY3H_CAEEL)
Last modified
January 19, 2010.
Version 69.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Tyrosine 3-monooxygenase EC=1.14.16.2 Alternative name(s): Tyrosine 3-hydroxylase Short name=TH | ||||
| Gene names |
| ||||
| Organism | Caenorhabditis elegans [Complete proteome] | ||||
| Taxonomic identifier | 6239 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Nematoda › Chromadorea › Rhabditida › Rhabditoidea › Rhabditidae › Peloderinae › Caenorhabditis |
Protein attributes
| Sequence length | 454 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Catalytic activity | L-tyrosine + tetrahydrobiopterin + O2 = 3,4-dihydroxy-L-phenylalanine + 4a-hydroxytetrahydrobiopterin. |
| Cofactor | Fe2+ ion. |
| Pathway | Catecholamine biosynthesis; dopamine biosynthesis; dopamine from L-tyrosine: step 1/2. |
| Sequence similarities | Belongs to the biopterin-dependent aromatic amino acid hydroxylase family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Catecholamine biosynthesis Neurotransmitter biosynthesis |
| Coding sequence diversity | Alternative splicing |
| Ligand | Iron Metal-binding |
| Molecular function | Monooxygenase Oxidoreductase |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | aromatic amino acid family metabolic process Inferred from electronic annotation. Source: InterPro catecholamine biosynthetic processInferred from electronic annotation. Source: UniProtKB-KW neurotransmitter biosynthetic processInferred from electronic annotation. Source: UniProtKB-KW oxidation reductionInferred from electronic annotation. Source: UniProtKB-KW |
| Molecular function | iron ion binding Inferred from electronic annotation. Source: UniProtKB-KW tyrosine 3-monooxygenase activityInferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform b (identifier: P90986-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confimation available. | ||||||
| Isoform a (identifier: P90986-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MFLRYMRRRGSGEDHEEEPRGVTVIATKVAENSKNPRRYSLVHQASCETQHHKGIRRQNTIQHRKQLTDQM 324-454: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 454 | 454 | Tyrosine 3-monooxygenase | PRO_0000205565 | |||||
Sites | |||||||||
| Metal binding | 282 | 1 | Iron By similarity | ||||||
| Metal binding | 287 | 1 | Iron By similarity | ||||||
| Metal binding | 327 | 1 | Iron By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MFLRYMRRRGSGEDHEEEPR GVTVIATKVAENSKNPRRYS LVHQASCETQHHKGIRRQNT IQHRKQLTDQM in isoform a. | VSP_013645 | |||||
| Alternative sequence | 324 – 454 | 131 | Missing in isoform a. | VSP_013646 | |||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Genome sequence of the nematode C. elegans: a platform for investigating biology." The C. elegans sequencing consortium Science 282:2012-2018(1998) [PubMed: 9851916] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], ALTERNATIVE SPLICING. Strain: Bristol N2. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U80836 Genomic DNA. Translation: AAV58889.1. U80836 Genomic DNA. Translation: AAV58890.1. |
| PIR | T25453. |
| RefSeq | NP_493688.3. NP_871903.2. |
| UniGene | Cel.8024 |
3D structure databases | |
| SMR | P90986. Positions 116-448. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | P90986. |
Proteomic databases | |
| PRIDE | P90986. |
Genome annotation databases | |
| Ensembl | B0432.5b; B0432.5b; B0432.5; Caenorhabditis elegans. [Genome view] |
| GeneID | 173411. |
| KEGG | cel:B0432.5. |
| UCSC | B0432.5a. c. elegans. |
Organism-specific databases | |
| CTD | 173411. |
| WormBase | WBGene00000296. cat-2. |
| WormPep | B0432.5a. CE32103. [WorfDB] B0432.5b. CE37742. [WorfDB] |
Phylogenomic databases | |
| eggNOG | meNOG04044. |
| HOGENOM | HBG484724. |
| InParanoid | P90986. |
| OMA | CSDAPEH. |
| PhylomeDB | P90986. |
Enzyme and pathway databases | |
| BRENDA | 1.14.16.2. 672. |
Gene expression databases | |
| ArrayExpress | P90986. |
Family and domain databases | |
| InterPro | IPR001273. ArAA_hydroxylase. IPR018301. ArAA_hydroxylase_Fe/CU_BS. IPR019774. Aromatic-AA_hydroxylase_C. IPR019773. Tyrosine_3-monooxygenase-like. [Graphical view] |
| Gene3D | G3DSA:1.10.800.10. Aaa_hydroxylase. 1 hit. |
| PANTHER | PTHR11473. Aaa_hydroxylase. 1 hit. |
| Pfam | PF00351. Biopterin_H. 1 hit. [Graphical view] |
| PIRSF | PIRSF000336. TH. 1 hit. |
| PRINTS | PR00372. FYWHYDRXLASE. |
| PROSITE | PS00367. BIOPTERIN_HYDROXYL. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 879535. |
Entry information
| Entry name | TY3H_CAEEL | ||||||||
| Accession | Primary (citable) accession number: P90986 Secondary accession number(s): Q5R3Y3, Q5R3Y4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | Caenorhabditis annotation project | ||||||||
Relevant documents
| Caenorhabditis elegans Caenorhabditis elegans: entries, gene names and cross-references to WormPep |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with


