Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Matrix-remodeling-associated protein 7

Gene

MXRA7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Matrix-remodeling-associated protein 7
Alternative name(s):
Transmembrane anchor protein 1
Gene namesi
Name:MXRA7
Synonyms:TMAP1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:7541. MXRA7.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei7 – 2721HelicalSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA31342.

Polymorphism and mutation databases

BioMutaiMXRA7.
DMDMi52783434.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 204204Matrix-remodeling-associated protein 7PRO_0000072586Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei191 – 1911PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiP84157.
MaxQBiP84157.
PaxDbiP84157.
PRIDEiP84157.

PTM databases

iPTMnetiP84157.
PhosphoSiteiP84157.

Expressioni

Gene expression databases

BgeeiP84157.
CleanExiHS_MXRA7.
ExpressionAtlasiP84157. baseline and differential.
GenevisibleiP84157. HS.

Organism-specific databases

HPAiHPA044819.

Interactioni

Protein-protein interaction databases

BioGridi136132. 5 interactions.
IntActiP84157. 1 interaction.
STRINGi9606.ENSP00000348050.

Structurei

3D structure databases

ProteinModelPortaliP84157.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410J1F3. Eukaryota.
ENOG410Y304. LUCA.
GeneTreeiENSGT00530000064433.
HOGENOMiHOG000060262.
InParanoidiP84157.
OMAiSPEPACT.
PhylomeDBiP84157.
TreeFamiTF336065.

Family and domain databases

InterProiIPR026622. Mxra7.
[Graphical view]
PANTHERiPTHR21845. PTHR21845. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P84157-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEAPAELLAA LPALATALAL LLAWLLVRRG AAASPEPARA PPEPAPPAEA
60 70 80 90 100
TGAPAPSRPC APEPAASPAG PEEPGEPAGL GELGEPAGPG EPEGPGDPAA
110 120 130 140 150
APAEAEEQAV EARQEEEQDL DGEKGPSSEG PEEEDGEGFS FKYSPGKLRG
160 170 180 190 200
NQYKKMMTKE ELEEEQRVQK EQLAAIFKLM KDNKETFGEM SDGDVQEQLR

LYDM
Note: No experimental confirmation available.
Length:204
Mass (Da):21,466
Last modified:September 13, 2004 - v1
Checksum:i3298195FCAC7AECF
GO
Isoform 2 (identifier: P84157-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     168-170: VQK → TEE
     171-204: Missing.

Note: No experimental confirmation available.
Show »
Length:170
Mass (Da):17,493
Checksum:iD3A7979306B63163
GO
Isoform 3 (identifier: P84157-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     168-204: VQKEQLAAIFKLMKDNKETFGEMSDGDVQEQLRLYDM → IELTSDLTSL

Note: No experimental confirmation available.
Show »
Length:177
Mass (Da):18,207
Checksum:iA0F859727A3949CF
GO

Sequence cautioni

The sequence AW888225 differs from that shown. Reason: Frameshift at several positions. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti80 – 801L → V (Ref. 3) Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei168 – 20437VQKEQ…RLYDM → IELTSDLTSL in isoform 3. 1 PublicationVSP_024252Add
BLAST
Alternative sequencei168 – 1703VQK → TEE in isoform 2. 1 PublicationVSP_022589
Alternative sequencei171 – 20434Missing in isoform 2. 1 PublicationVSP_022590Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC005837 Genomic DNA. No translation available.
BC053983 mRNA. Translation: AAH53983.1.
AW888225 mRNA. No translation available.
CCDSiCCDS32745.1. [P84157-1]
CCDS32746.1. [P84157-3]
CCDS45786.1. [P84157-2]
RefSeqiNP_001008528.1. NM_001008528.2. [P84157-1]
NP_001008529.1. NM_001008529.2. [P84157-3]
NP_940932.2. NM_198530.3. [P84157-2]
UniGeneiHs.250723.
Hs.597019.
Hs.655266.

Genome annotation databases

EnsembliENST00000355797; ENSP00000348050; ENSG00000182534. [P84157-1]
ENST00000375036; ENSP00000364176; ENSG00000182534. [P84157-3]
ENST00000449428; ENSP00000391466; ENSG00000182534. [P84157-2]
GeneIDi439921.
KEGGihsa:439921.
UCSCiuc002jsk.2. human. [P84157-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC005837 Genomic DNA. No translation available.
BC053983 mRNA. Translation: AAH53983.1.
AW888225 mRNA. No translation available.
CCDSiCCDS32745.1. [P84157-1]
CCDS32746.1. [P84157-3]
CCDS45786.1. [P84157-2]
RefSeqiNP_001008528.1. NM_001008528.2. [P84157-1]
NP_001008529.1. NM_001008529.2. [P84157-3]
NP_940932.2. NM_198530.3. [P84157-2]
UniGeneiHs.250723.
Hs.597019.
Hs.655266.

3D structure databases

ProteinModelPortaliP84157.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi136132. 5 interactions.
IntActiP84157. 1 interaction.
STRINGi9606.ENSP00000348050.

PTM databases

iPTMnetiP84157.
PhosphoSiteiP84157.

Polymorphism and mutation databases

BioMutaiMXRA7.
DMDMi52783434.

Proteomic databases

EPDiP84157.
MaxQBiP84157.
PaxDbiP84157.
PRIDEiP84157.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000355797; ENSP00000348050; ENSG00000182534. [P84157-1]
ENST00000375036; ENSP00000364176; ENSG00000182534. [P84157-3]
ENST00000449428; ENSP00000391466; ENSG00000182534. [P84157-2]
GeneIDi439921.
KEGGihsa:439921.
UCSCiuc002jsk.2. human. [P84157-1]

Organism-specific databases

CTDi439921.
GeneCardsiMXRA7.
H-InvDBHIX0027170.
HIX0029965.
HGNCiHGNC:7541. MXRA7.
HPAiHPA044819.
neXtProtiNX_P84157.
PharmGKBiPA31342.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410J1F3. Eukaryota.
ENOG410Y304. LUCA.
GeneTreeiENSGT00530000064433.
HOGENOMiHOG000060262.
InParanoidiP84157.
OMAiSPEPACT.
PhylomeDBiP84157.
TreeFamiTF336065.

Miscellaneous databases

ChiTaRSiMXRA7. human.
GenomeRNAii439921.
NextBioi108734.
PROiP84157.

Gene expression databases

BgeeiP84157.
CleanExiHS_MXRA7.
ExpressionAtlasiP84157. baseline and differential.
GenevisibleiP84157. HS.

Family and domain databases

InterProiIPR026622. Mxra7.
[Graphical view]
PANTHERiPTHR21845. PTHR21845. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Skin.
  3. "Matrix-remodeling associated genes identified by co-expression."
    Walker M.G., Volkmuth W.
    Submitted (MAY-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 75-204 (ISOFORM 3).
  4. "Characterising unknown proteins by location proteomics."
    Southan C., Hearath A., Rohlff C.
    Submitted (AUG-2004) to UniProtKB
    Cited for: IDENTIFICATION.
  5. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  6. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiMXRA7_HUMAN
AccessioniPrimary (citable) accession number: P84157
Secondary accession number(s): Q0P5W3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 27, 2004
Last sequence update: September 13, 2004
Last modified: March 16, 2016
This is version 95 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.