Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Matrix-remodeling-associated protein 7

Gene

MXRA7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Matrix-remodeling-associated protein 7
Alternative name(s):
Transmembrane anchor protein 1
Gene namesi
Name:MXRA7
Synonyms:TMAP1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

EuPathDBiHostDB:ENSG00000182534.13
HGNCiHGNC:7541 MXRA7
neXtProtiNX_P84157

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei7 – 27HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000182534
PharmGKBiPA31342

Polymorphism and mutation databases

BioMutaiMXRA7
DMDMi52783434

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000725861 – 204Matrix-remodeling-associated protein 7Add BLAST204

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei191PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiP84157
MaxQBiP84157
PaxDbiP84157
PeptideAtlasiP84157
PRIDEiP84157

PTM databases

iPTMnetiP84157
PhosphoSitePlusiP84157

Expressioni

Gene expression databases

BgeeiENSG00000182534
CleanExiHS_MXRA7
ExpressionAtlasiP84157 baseline and differential
GenevisibleiP84157 HS

Organism-specific databases

HPAiHPA044819

Interactioni

Protein-protein interaction databases

BioGridi136132, 5 interactors
IntActiP84157, 4 interactors
MINTiP84157
STRINGi9606.ENSP00000348050

Structurei

3D structure databases

ProteinModelPortaliP84157
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410J1F3 Eukaryota
ENOG410Y304 LUCA
GeneTreeiENSGT00530000064433
HOGENOMiHOG000060262
InParanoidiP84157
OMAiSPEPACT
PhylomeDBiP84157
TreeFamiTF336065

Family and domain databases

InterProiView protein in InterPro
IPR026622 Mxra7
PANTHERiPTHR21845 PTHR21845, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P84157-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEAPAELLAA LPALATALAL LLAWLLVRRG AAASPEPARA PPEPAPPAEA
60 70 80 90 100
TGAPAPSRPC APEPAASPAG PEEPGEPAGL GELGEPAGPG EPEGPGDPAA
110 120 130 140 150
APAEAEEQAV EARQEEEQDL DGEKGPSSEG PEEEDGEGFS FKYSPGKLRG
160 170 180 190 200
NQYKKMMTKE ELEEEQRVQK EQLAAIFKLM KDNKETFGEM SDGDVQEQLR

LYDM
Note: No experimental confirmation available.
Length:204
Mass (Da):21,466
Last modified:September 13, 2004 - v1
Checksum:i3298195FCAC7AECF
GO
Isoform 2 (identifier: P84157-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     168-170: VQK → TEE
     171-204: Missing.

Note: No experimental confirmation available.
Show »
Length:170
Mass (Da):17,493
Checksum:iD3A7979306B63163
GO
Isoform 3 (identifier: P84157-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     168-204: VQKEQLAAIFKLMKDNKETFGEMSDGDVQEQLRLYDM → IELTSDLTSL

Note: No experimental confirmation available.
Show »
Length:177
Mass (Da):18,207
Checksum:iA0F859727A3949CF
GO

Sequence cautioni

The sequence AW888225 differs from that shown. Reason: Frameshift at several positions.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti80L → V (Ref. 3) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_024252168 – 204VQKEQ…RLYDM → IELTSDLTSL in isoform 3. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_022589168 – 170VQK → TEE in isoform 2. 1 Publication3
Alternative sequenceiVSP_022590171 – 204Missing in isoform 2. 1 PublicationAdd BLAST34

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC005837 Genomic DNA No translation available.
BC053983 mRNA Translation: AAH53983.1
AW888225 mRNA No translation available.
CCDSiCCDS32745.1 [P84157-1]
CCDS32746.1 [P84157-3]
CCDS45786.1 [P84157-2]
RefSeqiNP_001008528.1, NM_001008528.2 [P84157-1]
NP_001008529.1, NM_001008529.2 [P84157-3]
NP_940932.2, NM_198530.3 [P84157-2]
UniGeneiHs.250723
Hs.597019
Hs.655266

Genome annotation databases

EnsembliENST00000355797; ENSP00000348050; ENSG00000182534 [P84157-1]
ENST00000375036; ENSP00000364176; ENSG00000182534 [P84157-3]
ENST00000449428; ENSP00000391466; ENSG00000182534 [P84157-2]
GeneIDi439921
KEGGihsa:439921
UCSCiuc002jsk.2 human [P84157-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiMXRA7_HUMAN
AccessioniPrimary (citable) accession number: P84157
Secondary accession number(s): Q0P5W3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 27, 2004
Last sequence update: September 13, 2004
Last modified: May 23, 2018
This is version 106 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health