P84157 (MXRA7_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 63.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Matrix-remodeling-associated protein 7 Alternative name(s): Transmembrane anchor protein 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 204 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Subcellular location | Membrane; Single-pass membrane protein Potential. |
| Sequence caution | The sequence AW888225 differs from that shown. Reason: Frameshift at several positions. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane Transmembrane helix |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P84157-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 2 (identifier: P84157-2) The sequence of this isoform differs from the canonical sequence as follows: 168-170: VQK → TEE 171-204: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: P84157-3) The sequence of this isoform differs from the canonical sequence as follows: 168-204: VQKEQLAAIFKLMKDNKETFGEMSDGDVQEQLRLYDM → IELTSDLTSL | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 204 | 204 | Matrix-remodeling-associated protein 7 | PRO_0000072586 | |||||
Regions | |||||||||
| Transmembrane | 7 – 27 | 21 | Helical; Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 128 | 1 | Phosphoserine Ref.5 | ||||||
Natural variations | |||||||||
| Alternative sequence | 168 – 204 | 37 | VQKEQ…RLYDM → IELTSDLTSL in isoform 3. | VSP_024252 | |||||
| Alternative sequence | 168 – 170 | 3 | VQK → TEE in isoform 2. | VSP_022589 | |||||
| Alternative sequence | 171 – 204 | 34 | Missing in isoform 2. | VSP_022590 | |||||
Experimental info | |||||||||
| Sequence conflict | 80 | 1 | L → V Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage." Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. Nusbaum C.Nature 440:1045-1049(2006) [PubMed: 16625196] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Skin. |
| [3] | "Matrix-remodeling associated genes identified by co-expression." Walker M.G., Volkmuth W. Submitted (MAY-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 75-204 (ISOFORM 3). |
| [4] | "Characterising unknown proteins by location proteomics." Southan C., Hearath A., Rohlff C. Submitted (AUG-2004) to UniProtKB Cited for: IDENTIFICATION. |
| [5] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-128, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AC005837 Genomic DNA. No translation available. BC053983 mRNA. Translation: AAH53983.1. AW888225 mRNA. No translation available. |
| IPI | IPI00397645. IPI00465377. IPI00514725. |
| RefSeq | NP_001008528.1. NM_001008528.1. NP_001008529.1. NM_001008529.1. NP_940932.2. NM_198530.2. |
| UniGene | Hs.250723. Hs.597019. Hs.707692. |
3D structure databases | |
| ProteinModelPortal | P84157. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | P84157. |
PTM databases | |
| PhosphoSite | P84157. |
Polymorphism databases | |
| DMDM | 52783434. |
Proteomic databases | |
| PRIDE | P84157. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000355797; ENSP00000348050; ENSG00000182534. |
| GeneID | 439921. |
| KEGG | hsa:439921. |
| UCSC | uc002jsk.1. human. uc002jsl.1. human. uc002jsm.1. human. |
Organism-specific databases | |
| CTD | 439921. |
| GeneCards | GC17M074671. |
| HGNC | HGNC:7541. MXRA7. |
| HPA | HPA044819. |
| neXtProt | NX_P84157. |
| PharmGKB | PA31342. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG21436. |
| GeneTree | ENSGT00530000064433. |
| OMA | CAPEPAG. |
| OrthoDB | EOG4M0F3G. |
Gene expression databases | |
| ArrayExpress | P84157. |
| Bgee | P84157. |
| CleanEx | HS_MXRA7. |
| Genevestigator | P84157. |
| GermOnline | ENSG00000182534. Homo sapiens. |
Family and domain databases | |
| ProtoNet | Search... |
Other | |
| NextBio | 108734. |
Entry information
| Entry name | MXRA7_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P84157 Secondary accession number(s): Q0P5W3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |

Clusters with