Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Traf2 and NCK-interacting protein kinase

Gene

Tnik

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Serine/threonine kinase that acts as an essential activator of the Wnt signaling pathway. Recruited to promoters of Wnt target genes and required to activate their expression. May act by phosphorylating TCF4/TCF7L2. Appears to act upstream of the JUN N-terminal pathway. May play a role in the response to environmental stress. Part of a signaling complex composed of NEDD4, RAP2A and TNIK which regulates neuronal dendrite extension and arborization during development. More generally, it may play a role in cytoskeletal rearrangements and regulate cell spreading (By similarity).By similarity

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei54ATPPROSITE-ProRule annotation1
Active sitei153Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi31 – 39ATPPROSITE-ProRule annotation9

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Kinase, Serine/threonine-protein kinase, Transferase

Keywords - Biological processi

Neurogenesis, Wnt signaling pathway

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Traf2 and NCK-interacting protein kinase (EC:2.7.11.1)
Gene namesi
Name:Tnik
Synonyms:Kiaa0551
OrganismiMus musculus (Mouse)Imported
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 3

Organism-specific databases

MGIiMGI:1916264. Tnik.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Endosome, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000867621 – 1323Traf2 and NCK-interacting protein kinaseAdd BLAST1323

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei187PhosphothreonineCombined sources1
Modified residuei324PhosphoserineCombined sources1
Modified residuei326PhosphoserineCombined sources1
Modified residuei531PhosphoserineBy similarity1
Modified residuei541PhosphoserineCombined sources1
Modified residuei552PhosphothreonineCombined sources1
Modified residuei571PhosphoserineBy similarity1
Modified residuei579PhosphoserineBy similarity1
Modified residuei581PhosphoserineBy similarity1
Modified residuei611PhosphoserineCombined sources1
Modified residuei649PhosphoserineBy similarity1
Modified residuei651PhosphoserineBy similarity1
Modified residuei659PhosphoserineCombined sources1
Modified residuei672PhosphoserineBy similarity1
Modified residuei678PhosphoserineBy similarity1
Modified residuei691PhosphoserineBy similarity1
Modified residuei735PhosphoserineCombined sources1
Modified residuei737PhosphoserineBy similarity1
Modified residuei740PhosphoserineCombined sources1
Modified residuei922PhosphoserineBy similarity1

Post-translational modificationi

Autophosphorylated. Autophosphorylation is activated by RAP2A and induces association to the cytoskeletal fraction. Phosphorylates SMAD1 on Thr-322 (By similarity).By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiP83510.
PaxDbiP83510.
PeptideAtlasiP83510.
PRIDEiP83510.

PTM databases

iPTMnetiP83510.
PhosphoSitePlusiP83510.

Expressioni

Gene expression databases

BgeeiENSMUSG00000027692.
CleanExiMM_TNIK.
ExpressionAtlasiP83510. baseline and differential.
GenevisibleiP83510. MM.

Interactioni

Subunit structurei

Interacts (via the CNH domain) with RAP2A (GTP-bound form preferentially); the interaction is direct and required for the activation of TNIK by RAP2A. Interacts with NEDD4; recruits RAP2A to NEDD4. Interacts with TRAF2 and NCK. Interacts with TCF7L2/TCF4 and CTNNB1; the interaction is direct. Interacts with TANC1.2 Publications

Protein-protein interaction databases

BioGridi576981. 1 interactor.
DIPiDIP-57467N.
IntActiP83510. 3 interactors.
MINTiMINT-4138101.
STRINGi10090.ENSMUSP00000125081.

Structurei

3D structure databases

ProteinModelPortaliP83510.
SMRiP83510.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini25 – 289Protein kinasePROSITE-ProRule annotationAdd BLAST265
Domaini1010 – 1297CNHPROSITE-ProRule annotationAdd BLAST288

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni290 – 1010Mediates interaction with NEDD4By similarityAdd BLAST721

Sequence similaritiesi

Contains 1 CNH domain.PROSITE-ProRule annotation
Contains 1 protein kinase domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG0587. Eukaryota.
ENOG410XPHR. LUCA.
GeneTreeiENSGT00810000125351.
HOGENOMiHOG000290708.
HOVERGENiHBG036506.
InParanoidiP83510.
KOiK08840.

Family and domain databases

InterProiIPR001180. CNH_dom.
IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF00780. CNH. 1 hit.
PF00069. Pkinase. 1 hit.
[Graphical view]
SMARTiSM00036. CNH. 1 hit.
SM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF56112. SSF56112. 1 hit.
PROSITEiPS50219. CNH. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P83510-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASDSPARSL DEIDLSALRD PAGIFELVEL VGNGTYGQVY KGRHVKTGQL
60 70 80 90 100
AAIKVMDVTG DEEEEIKQEI NMLKKYSHHR NIATYYGAFI KKNPPGMDDQ
110 120 130 140 150
LWLVMEFCGA GSVTDLIKNT KGNTLKEEWI AYICREILRG LSHLHQHKVI
160 170 180 190 200
HRDIKGQNVL LTENAEVKLV DFGVSAQLDR TVGRRNTFIG TPYWMAPEVI
210 220 230 240 250
ACDENPDATY DFKSDLWSLG ITAIEMAEGA PPLCDMHPMR ALFLIPRNPA
260 270 280 290 300
PRLKSKKWSK KFQSFIESCL VKNHSQRPAT EQLMKHPFIR DQPNERQVRI
310 320 330 340 350
QLKDHIDRTK KKRGEKDETE YEYSGSEEEE EENDSGEPSS ILNLPGESTL
360 370 380 390 400
RRDFLRLQLA NKERSEALRR QQLEQQQREN EEHKRQLLAE RQKRIEEQKE
410 420 430 440 450
QRRRLEEQQR REKELRKQQE REQRRHYEEQ MRREEERRRA EHEQEYKRKQ
460 470 480 490 500
LEEQRQAERL QRQLKQERDY LVSLQHQRQE QRPLEKKPLY HYKEGMSPSE
510 520 530 540 550
KPAWAKEVEE RSRLNRQSSP AMPHKVANRI SDPNLPPRSE SFSISGVQPA
560 570 580 590 600
RTPPMLRPVD PQIPQLVAVK SQGPALTASQ SVHEQPTKGL SGFQEALNVT
610 620 630 640 650
SHRVEMPRQN SDPTSENPPL PTRIEKFDRS SWLRQEEDIP PKVPQRTTSI
660 670 680 690 700
SPALARKNSP GNGSALGPRL GSQPIRASNP DLRRTEPVLE SSLQRTSSGS
710 720 730 740 750
SSSSSTPSSQ PSSQGGSQPG SQAGSSERSR VRANSKSEGS PVLPHEPSKV
760 770 780 790 800
KPEESRDITR PSRPADLTAL AKELRELRIE ETNRPLKKVT DYSSSSEESE
810 820 830 840 850
SSEEEEEDGE SETHDGTVAV SDIPRLIPTG APGNNEQYNM GMVGTHGLET
860 870 880 890 900
SHADTFGGSI SREGTLMIRE TAEEKKRSGH SDSNGFAGHI NLPDLVQQSH
910 920 930 940 950
SPAGTPTEGL GRVSTHSQEM DSGAEYGIGS STKASFTPFV DPRVYQTSPT
960 970 980 990 1000
DEDEEDDESS AAALFTSELL RQEQAKLNEA RKISVVNVNP TNIRPHSDTP
1010 1020 1030 1040 1050
EIRKYKKRFN SEILCAALWG VNLLVGTENG LMLLDRSGQG KVYNLINRRR
1060 1070 1080 1090 1100
FQQMDVLEGL NVLVTISGKK NKLRVYYLSW LRNRILHNDP EVEKKQGWIT
1110 1120 1130 1140 1150
VGDLEGCIHY KVVKYERIKF LVIALKNAVE IYAWAPKPYH KFMAFKSFAD
1160 1170 1180 1190 1200
LQHKPLLVDL TVEEGQRLKV IFGSHTGFHV IDVDSGNSYD IYIPSHIQGN
1210 1220 1230 1240 1250
ITPHAIVILP KTDGMEMLVC YEDEGVYVNT YGRITKDVVL QWGEMPTSVA
1260 1270 1280 1290 1300
YIHSNQIMGW GEKAIEIRSV ETGHLDGVFM HKRAQRLKFL CERNDKVFFA
1310 1320
SVRSGGSSQV FFMTLNRNSM MNW
Note: No experimental confirmation available.
Length:1,323
Mass (Da):150,367
Last modified:July 24, 2007 - v2
Checksum:iB8289189530251D2
GO
Isoform 2 (identifier: P83510-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     926-962: YGIGSSTKASFTPFVDPRVYQTSPTDEDEEDDESSAA → SLK

Note: No experimental confirmation available.
Show »
Length:1,289
Mass (Da):146,713
Checksum:iA41F95CC9AC436D8
GO

Sequence cautioni

The sequence BAC65588 differs from that shown. Probable cloning artifact.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti735S → C in BAC40365 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_007351926 – 962YGIGS…ESSAA → SLK in isoform 2. 1 PublicationAdd BLAST37

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK039113 mRNA. Translation: BAC30241.1.
AK041777 mRNA. Translation: BAC31061.2.
AK088459 mRNA. Translation: BAC40365.1.
BC050866 mRNA. No translation available.
AK122306 Transcribed RNA. Translation: BAC65588.2. Sequence problems.
CCDSiCCDS50879.1. [P83510-1]
RefSeqiNP_001156480.1. NM_001163008.1. [P83510-1]
UniGeneiMm.126193.
Mm.483052.

Genome annotation databases

EnsembliENSMUST00000159236; ENSMUSP00000124681; ENSMUSG00000027692. [P83510-1]
GeneIDi665113.
KEGGimmu:665113.
UCSCiuc008oty.1. mouse. [P83510-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK039113 mRNA. Translation: BAC30241.1.
AK041777 mRNA. Translation: BAC31061.2.
AK088459 mRNA. Translation: BAC40365.1.
BC050866 mRNA. No translation available.
AK122306 Transcribed RNA. Translation: BAC65588.2. Sequence problems.
CCDSiCCDS50879.1. [P83510-1]
RefSeqiNP_001156480.1. NM_001163008.1. [P83510-1]
UniGeneiMm.126193.
Mm.483052.

3D structure databases

ProteinModelPortaliP83510.
SMRiP83510.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi576981. 1 interactor.
DIPiDIP-57467N.
IntActiP83510. 3 interactors.
MINTiMINT-4138101.
STRINGi10090.ENSMUSP00000125081.

PTM databases

iPTMnetiP83510.
PhosphoSitePlusiP83510.

Proteomic databases

MaxQBiP83510.
PaxDbiP83510.
PeptideAtlasiP83510.
PRIDEiP83510.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000159236; ENSMUSP00000124681; ENSMUSG00000027692. [P83510-1]
GeneIDi665113.
KEGGimmu:665113.
UCSCiuc008oty.1. mouse. [P83510-1]

Organism-specific databases

CTDi23043.
MGIiMGI:1916264. Tnik.
RougeiSearch...

Phylogenomic databases

eggNOGiKOG0587. Eukaryota.
ENOG410XPHR. LUCA.
GeneTreeiENSGT00810000125351.
HOGENOMiHOG000290708.
HOVERGENiHBG036506.
InParanoidiP83510.
KOiK08840.

Miscellaneous databases

ChiTaRSiTnik. mouse.
PROiP83510.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000027692.
CleanExiMM_TNIK.
ExpressionAtlasiP83510. baseline and differential.
GenevisibleiP83510. MM.

Family and domain databases

InterProiIPR001180. CNH_dom.
IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF00780. CNH. 1 hit.
PF00069. Pkinase. 1 hit.
[Graphical view]
SMARTiSM00036. CNH. 1 hit.
SM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF56112. SSF56112. 1 hit.
PROSITEiPS50219. CNH. 1 hit.
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTNIK_MOUSE
AccessioniPrimary (citable) accession number: P83510
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 30, 2003
Last sequence update: July 24, 2007
Last modified: November 30, 2016
This is version 137 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.