P83510 (TNIK_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 101.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Traf2 and NCK-interacting protein kinase EC=2.7.11.1 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 1323 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Serine/threonine kinase that acts as an essential activator of the Wnt signaling pathway. Recruited to promoters of Wnt target genes and required to activate their expression. May act by phosphorylating TCF4/TCF7L2. Appears to act upstream of the JUN N-terminal pathway. May play a role in the response to environmental stress. Part of a signaling complex composed of NEDD4, RAP2A and TNIK which regulates neuronal dendrite extension and arborization during development. More generally, it may play a role in cytoskeletal rearrangements and regulate cell spreading By similarity. |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. UniProtKB Q9UKE5 |
| Subunit structure | Interacts (via the CNH domain) with RAP2A (GTP-bound form preferentially); the interaction is direct and required for the activation of TNIK by RAP2A. Interacts with NEDD4; recruits RAP2A to NEDD4. Interacts with TRAF2 and NCK. Interacts with TCF7L2/TCF4 and CTNNB1; the interaction is direct. Interacts with TANC1. Ref.7 Ref.8 |
| Subcellular location | Nucleus. Cytoplasm. Recycling endosome By similarity. Cytoplasm › cytoskeleton By similarity. Note: Associated with recycling endosomes and the cytoskeletal fraction upon RAP2A overexpression By similarity. Ref.7 |
| Post-translational modification | Autophosphorylated. Autophosphorylation is activated by RAP2A and induces association to the cytoskeletal fraction. Phosphorylates SMAD1 on Thr-322 By similarity. |
| Sequence similarities | Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily. Contains 1 CNH domain. Contains 1 protein kinase domain. |
| Sequence caution | The sequence BAC65588.2 differs from that shown. Reason: Probable cloning artifact. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P83510-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 2 (identifier: P83510-2) The sequence of this isoform differs from the canonical sequence as follows: 926-962: YGIGSSTKASFTPFVDPRVYQTSPTDEDEEDDESSAA → SLK | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1323 | 1323 | Traf2 and NCK-interacting protein kinase | PRO_0000086762 | |||||
Regions | |||||||||
| Domain | 25 – 289 | 265 | Protein kinase | ||||||
| Domain | 1010 – 1297 | 288 | CNH | ||||||
| Nucleotide binding | 31 – 39 | 9 | ATP By similarity UniProtKB O00506 | ||||||
| Region | 290 – 1010 | 721 | Mediates interaction with NEDD4 By similarity | ||||||
Sites | |||||||||
| Active site | 153 | 1 | Proton acceptor By similarity UniProtKB O00506 | ||||||
| Binding site | 54 | 1 | ATP By similarity UniProtKB O00506 | ||||||
Amino acid modifications | |||||||||
| Modified residue | 326 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 531 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 611 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 649 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 651 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 659 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 678 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 691 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 737 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 740 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 950 | 1 | Phosphothreonine Ref.5 | ||||||
Natural variations | |||||||||
| Alternative sequence | 926 – 962 | 37 | YGIGS…ESSAA → SLK in isoform 2. | VSP_007351 | |||||
Experimental info | |||||||||
| Sequence conflict | 735 | 1 | S → C in BAC40365. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-327 AND 735-1323 (ISOFORM 1). Strain: C57BL/6J and NOD. Tissue: Hypothalamus and Thymus. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 311-1323 (ISOFORM 1). Tissue: Embryo. |
| [3] | "Prediction of the coding sequences of mouse homologues of KIAA gene: II. The complete nucleotide sequences of 400 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries." Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S., Nakajima D., Nagase T., Ohara O., Koga H. DNA Res. 10:35-48(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 359-842 (ISOFORM 2). Tissue: Brain. |
| [4] | Okazaki N., Kikuno R., Nagase T., Ohara O., Koga H. Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases Cited for: SEQUENCE REVISION. |
| [5] | "Phosphoproteomic analysis of the developing mouse brain." Ballif B.A., Villen J., Beausoleil S.A., Schwartz D., Gygi S.P. Mol. Cell. Proteomics 3:1093-1101(2004) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-950, MASS SPECTROMETRY. Tissue: Embryonic brain. |
| [6] | "Solid tumor proteome and phosphoproteome analysis by high resolution mass spectrometry." Zanivan S., Gnad F., Wickstroem S.A., Geiger T., Macek B., Cox J., Faessler R., Mann M. J. Proteome Res. 7:5314-5326(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-740, MASS SPECTROMETRY. Tissue: Melanoma. |
| [7] | "The kinase TNIK is an essential activator of Wnt target genes." Mahmoudi T., Li V.S.W., Ng S.S., Taouatas N., Vries R.G.J., Mohammed S., Heck A.J., Clevers H. EMBO J. 28:3329-3340(2009) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH TCF7L2 AND CTNNB1, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [8] | "Regulation of Rap2A by the ubiquitin ligase Nedd4-1 controls neurite development." Kawabe H., Neeb A., Dimova K., Young S.M. Jr., Takeda M., Katsurabayashi S., Mitkovski M., Malakhova O.A., Zhang D.E., Umikawa M., Kariya K., Goebbels S., Nave K.A., Rosenmund C., Jahn O., Rhee J., Brose N. Neuron 65:358-372(2010) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NEDD4 AND RAP2A. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK039113 mRNA. Translation: BAC30241.1. AK041777 mRNA. Translation: BAC31061.2. AK088459 mRNA. Translation: BAC40365.1. BC050866 mRNA. No translation available. AK122306 Transcribed RNA. Translation: BAC65588.2. Sequence problems. |
| IPI | IPI00187510. IPI00989691. |
| RefSeq | NP_001156480.1. NM_001163008.1. |
| UniGene | Mm.126193. Mm.483052. |
3D structure databases | |
| ProteinModelPortal | P83510. |
| SMR | P83510. Positions 13-313. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-57467N. |
PTM databases | |
| PhosphoSite | P83510. |
Proteomic databases | |
| PaxDb | P83510. |
| PRIDE | P83510. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000159236; ENSMUSP00000124681; ENSMUSG00000027692. |
| GeneID | 665113. |
| KEGG | mmu:665113. |
| UCSC | uc008oty.1. mouse. |
Organism-specific databases | |
| CTD | 23043. |
| MGI | MGI:1916264. Tnik. |
| Rouge | Search... |
Phylogenomic databases | |
| eggNOG | COG0515. |
| GeneTree | ENSGT00680000099778. |
| HOGENOM | HOG000290708. |
| HOVERGEN | HBG036506. |
| KO | K08840. |
Gene expression databases | |
| ArrayExpress | P83510. |
| Bgee | P83510. |
| CleanEx | MM_TNIK. |
| Genevestigator | P83510. |
| GermOnline | ENSMUSG00000027692. Mus musculus. |
Family and domain databases | |
| InterPro | IPR001180. Citron. IPR011009. Kinase-like_dom. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR002290. Ser/Thr_dual-sp_kinase_dom. IPR008271. Ser/Thr_kinase_AS. [Graphical view] |
| Pfam | PF00780. CNH. 1 hit. PF00069. Pkinase. 1 hit. [Graphical view] |
| SMART | SM00036. CNH. 1 hit. SM00220. S_TKc. 1 hit. [Graphical view] |
| SUPFAM | SSF56112. Kinase_like. 1 hit. |
| PROSITE | PS50219. CNH. 1 hit. PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | TNIK. mouse. |
| NextBio | 426671. |
| SOURCE | Search... |
Entry information
| Entry name | TNIK_MOUSE | ||||||||
| Accession | Primary (citable) accession number: P83510 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
