Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

28S ribosomal protein S25, mitochondrial

Gene

MRPS25

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Ribonucleoprotein, Ribosomal protein

Enzyme and pathway databases

ReactomeiREACT_267634. Mitochondrial translation initiation.
REACT_268133. Mitochondrial translation elongation.
REACT_268261. Mitochondrial translation termination.

Names & Taxonomyi

Protein namesi
Recommended name:
28S ribosomal protein S25, mitochondrial
Short name:
MRP-S25
Short name:
S25mt
Gene namesi
Name:MRPS25
Synonyms:RPMS25
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:14511. MRPS25.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Mitochondrion

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA31013.

Polymorphism and mutation databases

BioMutaiMRPS25.
DMDMi13633894.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 17317328S ribosomal protein S25, mitochondrialPRO_0000087708Add
BLAST

Proteomic databases

MaxQBiP82663.
PaxDbiP82663.
PRIDEiP82663.

Expressioni

Gene expression databases

BgeeiP82663.
CleanExiHS_MRPS25.
ExpressionAtlasiP82663. baseline and differential.
GenevisibleiP82663. HS.

Organism-specific databases

HPAiHPA043490.

Interactioni

Subunit structurei

Component of the mitochondrial ribosome small subunit (28S) which comprises a 12S rRNA and about 30 distinct proteins.

Protein-protein interaction databases

BioGridi122180. 25 interactions.
IntActiP82663. 4 interactions.
MINTiMINT-8052188.
STRINGi9606.ENSP00000253686.

Structurei

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3J9Melectron microscopy3.50AT1-173[»]
ProteinModelPortaliP82663.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the ribosomal protein S25/L51 family.Curated

Phylogenomic databases

eggNOGiNOG330435.
GeneTreeiENSGT00640000091558.
HOGENOMiHOG000007270.
HOVERGENiHBG002378.
InParanoidiP82663.
KOiK17404.
OMAiVFWNIPQ.
OrthoDBiEOG7NCV4X.
PhylomeDBiP82663.
TreeFamiTF300292.

Family and domain databases

Gene3Di3.40.30.10. 1 hit.
InterProiIPR007741. Ribosome/NADH_DH.
IPR012336. Thioredoxin-like_fold.
[Graphical view]
PfamiPF05047. L51_S25_CI-B8. 1 hit.
[Graphical view]
SMARTiSM00916. L51_S25_CI-B8. 1 hit.
[Graphical view]
SUPFAMiSSF52833. SSF52833. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P82663-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPMKGRFPIR RTLQYLSQGN VVFKDSVKVM TVNYNTHGEL GEGARKFVFF
60 70 80 90 100
NIPQIQYKNP WVQIMMFKNM TPSPFLRFYL DSGEQVLVDV ETKSNKEIME
110 120 130 140 150
HIRKILGKNE ETLREEEEEK KQLSHPANFG PRKYCLRECI CEVEGQVPCP
160 170
SLVPLPKEMR GKYKAALKAD AQD
Length:173
Mass (Da):20,116
Last modified:March 1, 2001 - v1
Checksum:i78BB282C1539FA4C
GO
Isoform 2 (identifier: P82663-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     111-173: ETLREEEEEK...KAALKADAQD → HYLAAPSKPVSSAVVPVTQEAEAGGSLEPRRLRLE

Note: No experimental confirmation available.
Show »
Length:145
Mass (Da):16,644
Checksum:iF6951457D5BB2DEA
GO
Isoform 3 (identifier: P82663-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     81-129: DSGEQVLVDV...KKQLSHPANF → GKPSGKRRRR...APAWCHYPRR
     130-173: Missing.

Note: No experimental confirmation available.
Show »
Length:129
Mass (Da):14,953
Checksum:iC539192C27905D47
GO

Sequence cautioni

The sequence BAB15723.1 differs from that shown. Reason: Erroneous initiation. Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei81 – 12949DSGEQ…HPANF → GKPSGKRRRRKSSFLTQPTS ALESTACGSASVKWKGRCPA PAWCHYPRR in isoform 3. 1 PublicationVSP_056422Add
BLAST
Alternative sequencei111 – 17363ETLRE…ADAQD → HYLAAPSKPVSSAVVPVTQE AEAGGSLEPRRLRLE in isoform 2. 1 PublicationVSP_056423Add
BLAST
Alternative sequencei130 – 17344Missing in isoform 3. 1 PublicationVSP_056424Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK024702 mRNA. Translation: BAB14968.1.
AK024433 mRNA. Translation: BAB15723.1. Different initiation.
AK294123 mRNA. Translation: BAG57456.1.
AK298791 mRNA. Translation: BAG60928.1.
AC090954 Genomic DNA. No translation available.
BC003590 mRNA. Translation: AAH03590.1.
CCDSiCCDS2622.1. [P82663-1]
RefSeqiNP_071942.1. NM_022497.3. [P82663-1]
UniGeneiHs.657764.
Hs.715617.

Genome annotation databases

EnsembliENST00000253686; ENSP00000253686; ENSG00000131368. [P82663-1]
ENST00000444840; ENSP00000407733; ENSG00000131368. [P82663-3]
ENST00000449354; ENSP00000390882; ENSG00000131368. [P82663-2]
GeneIDi64432.
KEGGihsa:64432.
UCSCiuc003bzl.3. human. [P82663-1]
uc011avl.2. human.
uc011avm.1. human.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK024702 mRNA. Translation: BAB14968.1.
AK024433 mRNA. Translation: BAB15723.1. Different initiation.
AK294123 mRNA. Translation: BAG57456.1.
AK298791 mRNA. Translation: BAG60928.1.
AC090954 Genomic DNA. No translation available.
BC003590 mRNA. Translation: AAH03590.1.
CCDSiCCDS2622.1. [P82663-1]
RefSeqiNP_071942.1. NM_022497.3. [P82663-1]
UniGeneiHs.657764.
Hs.715617.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3J9Melectron microscopy3.50AT1-173[»]
ProteinModelPortaliP82663.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122180. 25 interactions.
IntActiP82663. 4 interactions.
MINTiMINT-8052188.
STRINGi9606.ENSP00000253686.

Polymorphism and mutation databases

BioMutaiMRPS25.
DMDMi13633894.

Proteomic databases

MaxQBiP82663.
PaxDbiP82663.
PRIDEiP82663.

Protocols and materials databases

DNASUi64432.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000253686; ENSP00000253686; ENSG00000131368. [P82663-1]
ENST00000444840; ENSP00000407733; ENSG00000131368. [P82663-3]
ENST00000449354; ENSP00000390882; ENSG00000131368. [P82663-2]
GeneIDi64432.
KEGGihsa:64432.
UCSCiuc003bzl.3. human. [P82663-1]
uc011avl.2. human.
uc011avm.1. human.

Organism-specific databases

CTDi64432.
GeneCardsiGC03M015083.
HGNCiHGNC:14511. MRPS25.
HPAiHPA043490.
MIMi611987. gene.
neXtProtiNX_P82663.
PharmGKBiPA31013.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG330435.
GeneTreeiENSGT00640000091558.
HOGENOMiHOG000007270.
HOVERGENiHBG002378.
InParanoidiP82663.
KOiK17404.
OMAiVFWNIPQ.
OrthoDBiEOG7NCV4X.
PhylomeDBiP82663.
TreeFamiTF300292.

Enzyme and pathway databases

ReactomeiREACT_267634. Mitochondrial translation initiation.
REACT_268133. Mitochondrial translation elongation.
REACT_268261. Mitochondrial translation termination.

Miscellaneous databases

ChiTaRSiMRPS25. human.
GeneWikiiMRPS25.
GenomeRNAii64432.
NextBioi35471506.
PROiP82663.
SOURCEiSearch...

Gene expression databases

BgeeiP82663.
CleanExiHS_MRPS25.
ExpressionAtlasiP82663. baseline and differential.
GenevisibleiP82663. HS.

Family and domain databases

Gene3Di3.40.30.10. 1 hit.
InterProiIPR007741. Ribosome/NADH_DH.
IPR012336. Thioredoxin-like_fold.
[Graphical view]
PfamiPF05047. L51_S25_CI-B8. 1 hit.
[Graphical view]
SMARTiSM00916. L51_S25_CI-B8. 1 hit.
[Graphical view]
SUPFAMiSSF52833. SSF52833. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3).
    Tissue: Brain cortex.
  2. "Characterization of long cDNA clones from human adult spleen."
    Hattori A., Okumura K., Nagase T., Kikuno R., Hirosawa M., Ohara O.
    DNA Res. 7:357-366(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Spleen.
  3. "The DNA sequence, annotation and analysis of human chromosome 3."
    Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
    , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
    Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Lung.
  5. "A proteomics approach to the identification of mammalian mitochondrial small subunit ribosomal proteins."
    Koc E.C., Burkhart W., Blackburn K., Moseley A., Koc H., Spremulli L.L.
    J. Biol. Chem. 275:32585-32591(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION.
  6. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiRT25_HUMAN
AccessioniPrimary (citable) accession number: P82663
Secondary accession number(s): B4DFJ5, B4DQG6, Q9H7P5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: March 1, 2001
Last modified: June 24, 2015
This is version 122 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. Ribosomal proteins
    Ribosomal proteins families and list of entries
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.