Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P82663

- RT25_HUMAN

UniProt

P82663 - RT25_HUMAN

Protein

28S ribosomal protein S25, mitochondrial

Gene

MRPS25

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 115 (01 Oct 2014)
      Sequence version 1 (01 Mar 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Keywords - Molecular functioni

    Ribonucleoprotein, Ribosomal protein

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    28S ribosomal protein S25, mitochondrial
    Short name:
    MRP-S25
    Short name:
    S25mt
    Gene namesi
    Name:MRPS25
    Synonyms:RPMS25
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 3

    Organism-specific databases

    HGNCiHGNC:14511. MRPS25.

    Subcellular locationi

    GO - Cellular componenti

    1. mitochondrion Source: HPA
    2. ribosome Source: UniProtKB-KW

    Keywords - Cellular componenti

    Mitochondrion

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA31013.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 17317328S ribosomal protein S25, mitochondrialPRO_0000087708Add
    BLAST

    Proteomic databases

    MaxQBiP82663.
    PaxDbiP82663.
    PRIDEiP82663.

    Expressioni

    Gene expression databases

    ArrayExpressiP82663.
    BgeeiP82663.
    CleanExiHS_MRPS25.
    GenevestigatoriP82663.

    Organism-specific databases

    HPAiHPA043490.

    Interactioni

    Subunit structurei

    Component of the mitochondrial ribosome small subunit (28S) which comprises a 12S rRNA and about 30 distinct proteins.

    Protein-protein interaction databases

    BioGridi122180. 15 interactions.
    IntActiP82663. 4 interactions.
    MINTiMINT-8052188.
    STRINGi9606.ENSP00000253686.

    Structurei

    3D structure databases

    ProteinModelPortaliP82663.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the ribosomal protein S25/L51 family.Curated

    Phylogenomic databases

    eggNOGiNOG330435.
    HOGENOMiHOG000007270.
    HOVERGENiHBG002378.
    InParanoidiP82663.
    KOiK17404.
    OMAiNGITHND.
    OrthoDBiEOG7NCV4X.
    PhylomeDBiP82663.
    TreeFamiTF300292.

    Family and domain databases

    Gene3Di3.40.30.10. 1 hit.
    InterProiIPR007741. Ribosome/NADH_DH.
    IPR012336. Thioredoxin-like_fold.
    [Graphical view]
    PfamiPF05047. L51_S25_CI-B8. 1 hit.
    [Graphical view]
    SMARTiSM00916. L51_S25_CI-B8. 1 hit.
    [Graphical view]
    SUPFAMiSSF52833. SSF52833. 1 hit.

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P82663-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MPMKGRFPIR RTLQYLSQGN VVFKDSVKVM TVNYNTHGEL GEGARKFVFF    50
    NIPQIQYKNP WVQIMMFKNM TPSPFLRFYL DSGEQVLVDV ETKSNKEIME 100
    HIRKILGKNE ETLREEEEEK KQLSHPANFG PRKYCLRECI CEVEGQVPCP 150
    SLVPLPKEMR GKYKAALKAD AQD 173
    Length:173
    Mass (Da):20,116
    Last modified:March 1, 2001 - v1
    Checksum:i78BB282C1539FA4C
    GO
    Isoform 2 (identifier: P82663-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         111-173: ETLREEEEEK...KAALKADAQD → HYLAAPSKPVSSAVVPVTQEAEAGGSLEPRRLRLE

    Note: No experimental confirmation available.

    Show »
    Length:145
    Mass (Da):16,644
    Checksum:iF6951457D5BB2DEA
    GO
    Isoform 3 (identifier: P82663-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         81-129: DSGEQVLVDV...KKQLSHPANF → GKPSGKRRRR...APAWCHYPRR
         130-173: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:129
    Mass (Da):14,953
    Checksum:iC539192C27905D47
    GO

    Sequence cautioni

    The sequence BAB15723.1 differs from that shown. Reason: Erroneous initiation.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei81 – 12949DSGEQ…HPANF → GKPSGKRRRRKSSFLTQPTS ALESTACGSASVKWKGRCPA PAWCHYPRR in isoform 3. 1 PublicationVSP_056422Add
    BLAST
    Alternative sequencei111 – 17363ETLRE…ADAQD → HYLAAPSKPVSSAVVPVTQE AEAGGSLEPRRLRLE in isoform 2. 1 PublicationVSP_056423Add
    BLAST
    Alternative sequencei130 – 17344Missing in isoform 3. 1 PublicationVSP_056424Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK024702 mRNA. Translation: BAB14968.1.
    AK024433 mRNA. Translation: BAB15723.1. Different initiation.
    AK294123 mRNA. Translation: BAG57456.1.
    AK298791 mRNA. Translation: BAG60928.1.
    AC090954 Genomic DNA. No translation available.
    BC003590 mRNA. Translation: AAH03590.1.
    CCDSiCCDS2622.1.
    RefSeqiNP_071942.1. NM_022497.3.
    UniGeneiHs.657764.
    Hs.715617.

    Genome annotation databases

    EnsembliENST00000253686; ENSP00000253686; ENSG00000131368.
    ENST00000444840; ENSP00000407733; ENSG00000131368.
    ENST00000449354; ENSP00000390882; ENSG00000131368.
    GeneIDi64432.
    KEGGihsa:64432.
    UCSCiuc003bzl.3. human.

    Polymorphism databases

    DMDMi13633894.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK024702 mRNA. Translation: BAB14968.1 .
    AK024433 mRNA. Translation: BAB15723.1 . Different initiation.
    AK294123 mRNA. Translation: BAG57456.1 .
    AK298791 mRNA. Translation: BAG60928.1 .
    AC090954 Genomic DNA. No translation available.
    BC003590 mRNA. Translation: AAH03590.1 .
    CCDSi CCDS2622.1.
    RefSeqi NP_071942.1. NM_022497.3.
    UniGenei Hs.657764.
    Hs.715617.

    3D structure databases

    ProteinModelPortali P82663.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 122180. 15 interactions.
    IntActi P82663. 4 interactions.
    MINTi MINT-8052188.
    STRINGi 9606.ENSP00000253686.

    Polymorphism databases

    DMDMi 13633894.

    Proteomic databases

    MaxQBi P82663.
    PaxDbi P82663.
    PRIDEi P82663.

    Protocols and materials databases

    DNASUi 64432.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000253686 ; ENSP00000253686 ; ENSG00000131368 .
    ENST00000444840 ; ENSP00000407733 ; ENSG00000131368 .
    ENST00000449354 ; ENSP00000390882 ; ENSG00000131368 .
    GeneIDi 64432.
    KEGGi hsa:64432.
    UCSCi uc003bzl.3. human.

    Organism-specific databases

    CTDi 64432.
    GeneCardsi GC03M015083.
    HGNCi HGNC:14511. MRPS25.
    HPAi HPA043490.
    MIMi 611987. gene.
    neXtProti NX_P82663.
    PharmGKBi PA31013.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG330435.
    HOGENOMi HOG000007270.
    HOVERGENi HBG002378.
    InParanoidi P82663.
    KOi K17404.
    OMAi NGITHND.
    OrthoDBi EOG7NCV4X.
    PhylomeDBi P82663.
    TreeFami TF300292.

    Miscellaneous databases

    ChiTaRSi MRPS25. human.
    GeneWikii MRPS25.
    GenomeRNAii 64432.
    NextBioi 66453.
    PROi P82663.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P82663.
    Bgeei P82663.
    CleanExi HS_MRPS25.
    Genevestigatori P82663.

    Family and domain databases

    Gene3Di 3.40.30.10. 1 hit.
    InterProi IPR007741. Ribosome/NADH_DH.
    IPR012336. Thioredoxin-like_fold.
    [Graphical view ]
    Pfami PF05047. L51_S25_CI-B8. 1 hit.
    [Graphical view ]
    SMARTi SM00916. L51_S25_CI-B8. 1 hit.
    [Graphical view ]
    SUPFAMi SSF52833. SSF52833. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3).
      Tissue: Brain cortex.
    2. "Characterization of long cDNA clones from human adult spleen."
      Hattori A., Okumura K., Nagase T., Kikuno R., Hirosawa M., Ohara O.
      DNA Res. 7:357-366(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Spleen.
    3. "The DNA sequence, annotation and analysis of human chromosome 3."
      Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
      , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
      Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Lung.
    5. "A proteomics approach to the identification of mammalian mitochondrial small subunit ribosomal proteins."
      Koc E.C., Burkhart W., Blackburn K., Moseley A., Koc H., Spremulli L.L.
      J. Biol. Chem. 275:32585-32591(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION.
    6. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiRT25_HUMAN
    AccessioniPrimary (citable) accession number: P82663
    Secondary accession number(s): B4DFJ5, B4DQG6, Q9H7P5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 27, 2001
    Last sequence update: March 1, 2001
    Last modified: October 1, 2014
    This is version 115 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 3
      Human chromosome 3: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. Ribosomal proteins
      Ribosomal proteins families and list of entries
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3