Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P82663

- RT25_HUMAN

UniProt

P82663 - RT25_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

28S ribosomal protein S25, mitochondrial

Gene

MRPS25

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli

Functioni

Keywords - Molecular functioni

Ribonucleoprotein, Ribosomal protein

Names & Taxonomyi

Protein namesi
Recommended name:
28S ribosomal protein S25, mitochondrial
Short name:
MRP-S25
Short name:
S25mt
Gene namesi
Name:MRPS25
Synonyms:RPMS25
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 3

Organism-specific databases

HGNCiHGNC:14511. MRPS25.

Subcellular locationi

GO - Cellular componenti

  1. mitochondrion Source: HPA
  2. ribosome Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Mitochondrion

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA31013.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 17317328S ribosomal protein S25, mitochondrialPRO_0000087708Add
BLAST

Proteomic databases

MaxQBiP82663.
PaxDbiP82663.
PRIDEiP82663.

Expressioni

Gene expression databases

BgeeiP82663.
CleanExiHS_MRPS25.
ExpressionAtlasiP82663. baseline and differential.
GenevestigatoriP82663.

Organism-specific databases

HPAiHPA043490.

Interactioni

Subunit structurei

Component of the mitochondrial ribosome small subunit (28S) which comprises a 12S rRNA and about 30 distinct proteins.

Protein-protein interaction databases

BioGridi122180. 27 interactions.
IntActiP82663. 4 interactions.
MINTiMINT-8052188.
STRINGi9606.ENSP00000253686.

Structurei

3D structure databases

ProteinModelPortaliP82663.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the ribosomal protein S25/L51 family.Curated

Phylogenomic databases

eggNOGiNOG330435.
GeneTreeiENSGT00640000091558.
HOGENOMiHOG000007270.
HOVERGENiHBG002378.
InParanoidiP82663.
KOiK17404.
OMAiNGITHND.
OrthoDBiEOG7NCV4X.
PhylomeDBiP82663.
TreeFamiTF300292.

Family and domain databases

Gene3Di3.40.30.10. 1 hit.
InterProiIPR007741. Ribosome/NADH_DH.
IPR012336. Thioredoxin-like_fold.
[Graphical view]
PfamiPF05047. L51_S25_CI-B8. 1 hit.
[Graphical view]
SMARTiSM00916. L51_S25_CI-B8. 1 hit.
[Graphical view]
SUPFAMiSSF52833. SSF52833. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P82663-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPMKGRFPIR RTLQYLSQGN VVFKDSVKVM TVNYNTHGEL GEGARKFVFF
60 70 80 90 100
NIPQIQYKNP WVQIMMFKNM TPSPFLRFYL DSGEQVLVDV ETKSNKEIME
110 120 130 140 150
HIRKILGKNE ETLREEEEEK KQLSHPANFG PRKYCLRECI CEVEGQVPCP
160 170
SLVPLPKEMR GKYKAALKAD AQD
Length:173
Mass (Da):20,116
Last modified:March 1, 2001 - v1
Checksum:i78BB282C1539FA4C
GO
Isoform 2 (identifier: P82663-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     111-173: ETLREEEEEK...KAALKADAQD → HYLAAPSKPVSSAVVPVTQEAEAGGSLEPRRLRLE

Note: No experimental confirmation available.

Show »
Length:145
Mass (Da):16,644
Checksum:iF6951457D5BB2DEA
GO
Isoform 3 (identifier: P82663-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     81-129: DSGEQVLVDV...KKQLSHPANF → GKPSGKRRRR...APAWCHYPRR
     130-173: Missing.

Note: No experimental confirmation available.

Show »
Length:129
Mass (Da):14,953
Checksum:iC539192C27905D47
GO

Sequence cautioni

The sequence BAB15723.1 differs from that shown. Reason: Erroneous initiation.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei81 – 12949DSGEQ…HPANF → GKPSGKRRRRKSSFLTQPTS ALESTACGSASVKWKGRCPA PAWCHYPRR in isoform 3. 1 PublicationVSP_056422Add
BLAST
Alternative sequencei111 – 17363ETLRE…ADAQD → HYLAAPSKPVSSAVVPVTQE AEAGGSLEPRRLRLE in isoform 2. 1 PublicationVSP_056423Add
BLAST
Alternative sequencei130 – 17344Missing in isoform 3. 1 PublicationVSP_056424Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK024702 mRNA. Translation: BAB14968.1.
AK024433 mRNA. Translation: BAB15723.1. Different initiation.
AK294123 mRNA. Translation: BAG57456.1.
AK298791 mRNA. Translation: BAG60928.1.
AC090954 Genomic DNA. No translation available.
BC003590 mRNA. Translation: AAH03590.1.
CCDSiCCDS2622.1. [P82663-1]
RefSeqiNP_071942.1. NM_022497.3.
UniGeneiHs.657764.
Hs.715617.

Genome annotation databases

EnsembliENST00000253686; ENSP00000253686; ENSG00000131368. [P82663-1]
ENST00000444840; ENSP00000407733; ENSG00000131368. [P82663-3]
ENST00000449354; ENSP00000390882; ENSG00000131368. [P82663-2]
GeneIDi64432.
KEGGihsa:64432.
UCSCiuc003bzl.3. human. [P82663-1]

Polymorphism databases

DMDMi13633894.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK024702 mRNA. Translation: BAB14968.1 .
AK024433 mRNA. Translation: BAB15723.1 . Different initiation.
AK294123 mRNA. Translation: BAG57456.1 .
AK298791 mRNA. Translation: BAG60928.1 .
AC090954 Genomic DNA. No translation available.
BC003590 mRNA. Translation: AAH03590.1 .
CCDSi CCDS2622.1. [P82663-1 ]
RefSeqi NP_071942.1. NM_022497.3.
UniGenei Hs.657764.
Hs.715617.

3D structure databases

ProteinModelPortali P82663.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 122180. 27 interactions.
IntActi P82663. 4 interactions.
MINTi MINT-8052188.
STRINGi 9606.ENSP00000253686.

Polymorphism databases

DMDMi 13633894.

Proteomic databases

MaxQBi P82663.
PaxDbi P82663.
PRIDEi P82663.

Protocols and materials databases

DNASUi 64432.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000253686 ; ENSP00000253686 ; ENSG00000131368 . [P82663-1 ]
ENST00000444840 ; ENSP00000407733 ; ENSG00000131368 . [P82663-3 ]
ENST00000449354 ; ENSP00000390882 ; ENSG00000131368 . [P82663-2 ]
GeneIDi 64432.
KEGGi hsa:64432.
UCSCi uc003bzl.3. human. [P82663-1 ]

Organism-specific databases

CTDi 64432.
GeneCardsi GC03M015083.
HGNCi HGNC:14511. MRPS25.
HPAi HPA043490.
MIMi 611987. gene.
neXtProti NX_P82663.
PharmGKBi PA31013.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG330435.
GeneTreei ENSGT00640000091558.
HOGENOMi HOG000007270.
HOVERGENi HBG002378.
InParanoidi P82663.
KOi K17404.
OMAi NGITHND.
OrthoDBi EOG7NCV4X.
PhylomeDBi P82663.
TreeFami TF300292.

Miscellaneous databases

ChiTaRSi MRPS25. human.
GeneWikii MRPS25.
GenomeRNAii 64432.
NextBioi 35471506.
PROi P82663.
SOURCEi Search...

Gene expression databases

Bgeei P82663.
CleanExi HS_MRPS25.
ExpressionAtlasi P82663. baseline and differential.
Genevestigatori P82663.

Family and domain databases

Gene3Di 3.40.30.10. 1 hit.
InterProi IPR007741. Ribosome/NADH_DH.
IPR012336. Thioredoxin-like_fold.
[Graphical view ]
Pfami PF05047. L51_S25_CI-B8. 1 hit.
[Graphical view ]
SMARTi SM00916. L51_S25_CI-B8. 1 hit.
[Graphical view ]
SUPFAMi SSF52833. SSF52833. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3).
    Tissue: Brain cortex.
  2. "Characterization of long cDNA clones from human adult spleen."
    Hattori A., Okumura K., Nagase T., Kikuno R., Hirosawa M., Ohara O.
    DNA Res. 7:357-366(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Spleen.
  3. "The DNA sequence, annotation and analysis of human chromosome 3."
    Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
    , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
    Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Lung.
  5. "A proteomics approach to the identification of mammalian mitochondrial small subunit ribosomal proteins."
    Koc E.C., Burkhart W., Blackburn K., Moseley A., Koc H., Spremulli L.L.
    J. Biol. Chem. 275:32585-32591(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION.
  6. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiRT25_HUMAN
AccessioniPrimary (citable) accession number: P82663
Secondary accession number(s): B4DFJ5, B4DQG6, Q9H7P5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: March 1, 2001
Last modified: October 29, 2014
This is version 116 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Ribosomal proteins
    Ribosomal proteins families and list of entries
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3