Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

POU domain, class 3, transcription factor 3-B

Gene

pou3f3b

Organism
Danio rerio (Zebrafish) (Brachydanio rerio)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Transcription factor that may play important roles in patterning the embryonic brain.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi330 – 389HomeoboxPROSITE-ProRule annotationAdd BLAST60

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDevelopmental protein, DNA-binding
Biological processTranscription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
POU domain, class 3, transcription factor 3-B
Alternative name(s):
Brain-specific homeobox/POU domain protein 1.0
Short name:
Brain-1.0
Short name:
zfBrn-1.0
POU domain protein 1
Short name:
ZFPOU1
POU domain protein 23
Short name:
ZP-23
Gene namesi
Name:pou3f3b
Synonyms:brn-1.0, pou1, pou23, zp23, zp23pou
OrganismiDanio rerio (Zebrafish) (Brachydanio rerio)
Taxonomic identifieri7955 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiActinopterygiiNeopterygiiTeleosteiOstariophysiCypriniformesCyprinidaeDanio
Proteomesi
  • UP000000437 Componenti: Chromosome 6

Organism-specific databases

ZFINiZDB-GENE-980526-140 pou3f3b

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001007711 – 443POU domain, class 3, transcription factor 3-BAdd BLAST443

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei317Phosphoserine1 Publication1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiP79745

PTM databases

iPTMnetiP79745

Expressioni

Tissue specificityi

Predominantly expressed in the central nervous system.3 Publications

Developmental stagei

First expressed at early neurula stage (9-12 hours). Expression then increases greatly at the 16-somite stage, reached the maximum level at 36 hr of development, and thereafter decreased. Only expressed in adults in the brain.3 Publications

Gene expression databases

BgeeiENSDARG00000095896

Interactioni

Protein-protein interaction databases

STRINGi7955.ENSDARP00000124688

Structurei

3D structure databases

ProteinModelPortaliP79745
SMRiP79745
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini238 – 312POU-specificPROSITE-ProRule annotationAdd BLAST75

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi84 – 98Ala-richAdd BLAST15
Compositional biasi165 – 169Poly-Gln5
Compositional biasi208 – 235His-richAdd BLAST28

Sequence similaritiesi

Keywords - Domaini

Homeobox

Phylogenomic databases

eggNOGiKOG3802 Eukaryota
ENOG410XQ7X LUCA
GeneTreeiENSGT00760000118935
HOGENOMiHOG000116303
HOVERGENiHBG053120
InParanoidiP79745
KOiK09365
OMAiPHQGHPG
OrthoDBiEOG091G0U0S
PhylomeDBiP79745
TreeFamiTF316413

Family and domain databases

CDDicd00086 homeodomain, 1 hit
InterProiView protein in InterPro
IPR009057 Homeobox-like_sf
IPR017970 Homeobox_CS
IPR001356 Homeobox_dom
IPR010982 Lambda_DNA-bd_dom_sf
IPR013847 POU
IPR000327 POU_dom
IPR016362 TF_POU_3
PfamiView protein in Pfam
PF00046 Homeobox, 1 hit
PF00157 Pou, 1 hit
PIRSFiPIRSF002629 Transcription_factor_POU, 1 hit
PRINTSiPR00028 POUDOMAIN
SMARTiView protein in SMART
SM00389 HOX, 1 hit
SM00352 POU, 1 hit
SUPFAMiSSF46689 SSF46689, 1 hit
SSF47413 SSF47413, 1 hit
PROSITEiView protein in PROSITE
PS00027 HOMEOBOX_1, 1 hit
PS50071 HOMEOBOX_2, 1 hit
PS00035 POU_1, 1 hit
PS00465 POU_2, 1 hit
PS51179 POU_3, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform Long (identifier: P79745-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MATAASNPYL ASSSILSSGS IVHSDSGGGM QQGSAAVTSV SGGYRGDPTV
60 70 80 90 100
KMVQSDFMQG AMAASNGGHM LSHAHQWVTS LPHAAAAAAA AAVAAAEAGS
110 120 130 140 150
PWSSSPVGMT GSPQQQDVKN NSGRDDLHSG TALHHRAPHL GPHQTHAGAW
160 170 180 190 200
GSTTAAHIPS LTGSQQQQQS LIYSQPGGFT VNGMLSPPGS QSLVHPGLVR
210 220 230 240 250
GDTPELDHSS HHHHHHHQHQ HHQQAHHGVN SHDPHSDEDT PTSDDLEHFA
260 270 280 290 300
KQFKQRRIKL GFTQADVGLA LGTLYGNVFS QTTICRFEAL QLSFKNMCKL
310 320 330 340 350
KPLLNKWLEE ADSSTGSPTS IDKIAAQGRK RKKRTSIEVS VKGALESHFL
360 370 380 390 400
KCPKPSAQEI TSLADNLQLE KEVVRVWFCN RRQKEKRMTP PGVPQTPEDV
410 420 430 440
YSQVGNGHFL VDYLKDASLT GPSEPGDQRV TTTSSFHQVI LAH
Length:443
Mass (Da):47,453
Last modified:May 1, 1997 - v1
Checksum:i5F2A6DC6BB333F5C
GO
Isoform Short (identifier: P79745-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     407-443: GHFLVDYLKDASLTGPSEPGDQRVTTTSSFHQVILAH → VSADTPPPSMDCKRMFSET

Show »
Length:425
Mass (Da):45,527
Checksum:iBAAC6D655310F131
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti109M → I in BAA02377 (PubMed:1417821).Curated1
Sequence conflicti116Q → QQ in AAH56549 (Ref. 3) Curated1
Sequence conflicti116Q → QQ in AAI63489 (Ref. 3) Curated1
Sequence conflicti135H → N in BAA02377 (PubMed:1417821).Curated1
Sequence conflicti146H → Y in BAA02377 (PubMed:1417821).Curated1
Sequence conflicti170S → F in BAA02377 (PubMed:1417821).Curated1
Sequence conflicti174 – 175SQ → FA in BAA02377 (PubMed:1417821).Curated2
Sequence conflicti185L → H in BAA02377 (PubMed:1417821).Curated1
Sequence conflicti263T → K in BAA02377 (PubMed:1417821).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_002341407 – 443GHFLV…VILAH → VSADTPPPSMDCKRMFSET in isoform Short. 4 PublicationsAdd BLAST37

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D13045 mRNA Translation: BAA02377.1
Y07907 mRNA Translation: CAA69215.1
Y07907 mRNA Translation: CAA69214.1
BC056320 mRNA Translation: AAH56320.1
BC056549 mRNA Translation: AAH56549.1
BC163489 mRNA Translation: AAI63489.1
PIRiJH0710
RefSeqiNP_571177.2, NM_131102.3 [P79745-2]
NP_958855.2, NM_201447.2 [P79745-1]
UniGeneiDr.29717

Genome annotation databases

EnsembliENSDART00000149202; ENSDARP00000123893; ENSDARG00000095896 [P79745-2]
ENSDART00000149949; ENSDARP00000124688; ENSDARG00000095896 [P79745-1]
GeneIDi30321
KEGGidre:30321

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiP3F3B_DANRE
AccessioniPrimary (citable) accession number: P79745
Secondary accession number(s): B3DJH8
, P31366, P79744, Q6PHH6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: May 1, 1997
Last modified: May 23, 2018
This is version 144 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health