Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

POU domain, class 3, transcription factor 3-B

Gene

pou3f3b

Organism
Danio rerio (Zebrafish) (Brachydanio rerio)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Transcription factor that may play important roles in patterning the embryonic brain.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi330 – 38960HomeoboxPROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. sequence-specific DNA binding Source: InterPro
  2. sequence-specific DNA binding transcription factor activity Source: InterPro

GO - Biological processi

  1. multicellular organismal development Source: UniProtKB-KW
  2. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
POU domain, class 3, transcription factor 3-B
Alternative name(s):
Brain-specific homeobox/POU domain protein 1.0
Short name:
Brain-1.0
Short name:
zfBrn-1.0
POU domain protein 1
Short name:
ZFPOU1
POU domain protein 23
Short name:
ZP-23
Gene namesi
Name:pou3f3b
Synonyms:brn-1.0, pou1, pou23, zp23, zp23pou
OrganismiDanio rerio (Zebrafish) (Brachydanio rerio)
Taxonomic identifieri7955 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiActinopterygiiNeopterygiiTeleosteiOstariophysiCypriniformesCyprinidaeDanio
ProteomesiUP000000437 Componenti: Chromosome 6

Organism-specific databases

ZFINiZDB-GENE-980526-140. pou3f3b.

Subcellular locationi

GO - Cellular componenti

  1. nucleus Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 443443POU domain, class 3, transcription factor 3-BPRO_0000100771Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei317 – 3171Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Expressioni

Tissue specificityi

Predominantly expressed in the central nervous system.3 Publications

Developmental stagei

First expressed at early neurula stage (9-12 hours). Expression then increases greatly at the 16-somite stage, reached the maximum level at 36 hr of development, and thereafter decreased. Only expressed in adults in the brain.3 Publications

Gene expression databases

BgeeiP79745.

Interactioni

Protein-protein interaction databases

STRINGi7955.ENSDARP00000065952.

Structurei

3D structure databases

ProteinModelPortaliP79745.
SMRiP79745. Positions 244-390.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini238 – 31275POU-specificPROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi84 – 9815Ala-richAdd
BLAST
Compositional biasi165 – 1695Poly-Gln
Compositional biasi208 – 23528His-richAdd
BLAST

Sequence similaritiesi

Contains 1 homeobox DNA-binding domain.PROSITE-ProRule annotation
Contains 1 POU-specific domain.PROSITE-ProRule annotation

Keywords - Domaini

Homeobox

Phylogenomic databases

eggNOGiNOG261729.
GeneTreeiENSGT00760000118935.
HOGENOMiHOG000116303.
HOVERGENiHBG053120.
InParanoidiP79745.
KOiK09365.
OMAiHTHAGTW.
OrthoDBiEOG7DJSMG.
PhylomeDBiP79745.
TreeFamiTF316413.

Family and domain databases

Gene3Di1.10.10.60. 1 hit.
1.10.260.40. 1 hit.
InterProiIPR017970. Homeobox_CS.
IPR001356. Homeobox_dom.
IPR009057. Homeodomain-like.
IPR010982. Lambda_DNA-bd_dom.
IPR013847. POU.
IPR000327. POU_specific.
IPR016362. TF_POU_3.
[Graphical view]
PfamiPF00046. Homeobox. 1 hit.
PF00157. Pou. 1 hit.
[Graphical view]
PIRSFiPIRSF002629. Transcription_factor_POU. 1 hit.
PRINTSiPR00028. POUDOMAIN.
SMARTiSM00389. HOX. 1 hit.
SM00352. POU. 1 hit.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 1 hit.
SSF47413. SSF47413. 1 hit.
PROSITEiPS00027. HOMEOBOX_1. 1 hit.
PS50071. HOMEOBOX_2. 1 hit.
PS00035. POU_1. 1 hit.
PS00465. POU_2. 1 hit.
PS51179. POU_3. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform Long (identifier: P79745-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MATAASNPYL ASSSILSSGS IVHSDSGGGM QQGSAAVTSV SGGYRGDPTV
60 70 80 90 100
KMVQSDFMQG AMAASNGGHM LSHAHQWVTS LPHAAAAAAA AAVAAAEAGS
110 120 130 140 150
PWSSSPVGMT GSPQQQDVKN NSGRDDLHSG TALHHRAPHL GPHQTHAGAW
160 170 180 190 200
GSTTAAHIPS LTGSQQQQQS LIYSQPGGFT VNGMLSPPGS QSLVHPGLVR
210 220 230 240 250
GDTPELDHSS HHHHHHHQHQ HHQQAHHGVN SHDPHSDEDT PTSDDLEHFA
260 270 280 290 300
KQFKQRRIKL GFTQADVGLA LGTLYGNVFS QTTICRFEAL QLSFKNMCKL
310 320 330 340 350
KPLLNKWLEE ADSSTGSPTS IDKIAAQGRK RKKRTSIEVS VKGALESHFL
360 370 380 390 400
KCPKPSAQEI TSLADNLQLE KEVVRVWFCN RRQKEKRMTP PGVPQTPEDV
410 420 430 440
YSQVGNGHFL VDYLKDASLT GPSEPGDQRV TTTSSFHQVI LAH
Length:443
Mass (Da):47,453
Last modified:April 30, 1997 - v1
Checksum:i5F2A6DC6BB333F5C
GO
Isoform Short (identifier: P79745-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     407-443: GHFLVDYLKDASLTGPSEPGDQRVTTTSSFHQVILAH → VSADTPPPSMDCKRMFSET

Show »
Length:425
Mass (Da):45,527
Checksum:iBAAC6D655310F131
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti109 – 1091M → I in BAA02377 (PubMed:1417821).Curated
Sequence conflicti116 – 1161Q → QQ in AAH56549 (Ref. 3) Curated
Sequence conflicti116 – 1161Q → QQ in AAI63489 (Ref. 3) Curated
Sequence conflicti135 – 1351H → N in BAA02377 (PubMed:1417821).Curated
Sequence conflicti146 – 1461H → Y in BAA02377 (PubMed:1417821).Curated
Sequence conflicti170 – 1701S → F in BAA02377 (PubMed:1417821).Curated
Sequence conflicti174 – 1752SQ → FA in BAA02377 (PubMed:1417821).Curated
Sequence conflicti185 – 1851L → H in BAA02377 (PubMed:1417821).Curated
Sequence conflicti263 – 2631T → K in BAA02377 (PubMed:1417821).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei407 – 44337GHFLV…VILAH → VSADTPPPSMDCKRMFSET in isoform Short. 4 PublicationsVSP_002341Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D13045 mRNA. Translation: BAA02377.1.
Y07907 mRNA. Translation: CAA69215.1.
Y07907 mRNA. Translation: CAA69214.1.
BC056320 mRNA. Translation: AAH56320.1.
BC056549 mRNA. Translation: AAH56549.1.
BC163489 mRNA. Translation: AAI63489.1.
PIRiJH0710.
RefSeqiNP_571177.2. NM_131102.2. [P79745-2]
NP_958855.1. NM_201447.1.
UniGeneiDr.29717.

Genome annotation databases

EnsembliENSDART00000149202; ENSDARP00000123893; ENSDARG00000095896. [P79745-2]
ENSDART00000149949; ENSDARP00000124688; ENSDARG00000095896. [P79745-1]
GeneIDi30321.
KEGGidre:30321.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D13045 mRNA. Translation: BAA02377.1.
Y07907 mRNA. Translation: CAA69215.1.
Y07907 mRNA. Translation: CAA69214.1.
BC056320 mRNA. Translation: AAH56320.1.
BC056549 mRNA. Translation: AAH56549.1.
BC163489 mRNA. Translation: AAI63489.1.
PIRiJH0710.
RefSeqiNP_571177.2. NM_131102.2. [P79745-2]
NP_958855.1. NM_201447.1.
UniGeneiDr.29717.

3D structure databases

ProteinModelPortaliP79745.
SMRiP79745. Positions 244-390.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi7955.ENSDARP00000065952.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSDART00000149202; ENSDARP00000123893; ENSDARG00000095896. [P79745-2]
ENSDART00000149949; ENSDARP00000124688; ENSDARG00000095896. [P79745-1]
GeneIDi30321.
KEGGidre:30321.

Organism-specific databases

CTDi30321.
ZFINiZDB-GENE-980526-140. pou3f3b.

Phylogenomic databases

eggNOGiNOG261729.
GeneTreeiENSGT00760000118935.
HOGENOMiHOG000116303.
HOVERGENiHBG053120.
InParanoidiP79745.
KOiK09365.
OMAiHTHAGTW.
OrthoDBiEOG7DJSMG.
PhylomeDBiP79745.
TreeFamiTF316413.

Miscellaneous databases

NextBioi20806757.

Gene expression databases

BgeeiP79745.

Family and domain databases

Gene3Di1.10.10.60. 1 hit.
1.10.260.40. 1 hit.
InterProiIPR017970. Homeobox_CS.
IPR001356. Homeobox_dom.
IPR009057. Homeodomain-like.
IPR010982. Lambda_DNA-bd_dom.
IPR013847. POU.
IPR000327. POU_specific.
IPR016362. TF_POU_3.
[Graphical view]
PfamiPF00046. Homeobox. 1 hit.
PF00157. Pou. 1 hit.
[Graphical view]
PIRSFiPIRSF002629. Transcription_factor_POU. 1 hit.
PRINTSiPR00028. POUDOMAIN.
SMARTiSM00389. HOX. 1 hit.
SM00352. POU. 1 hit.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 1 hit.
SSF47413. SSF47413. 1 hit.
PROSITEiPS00027. HOMEOBOX_1. 1 hit.
PS50071. HOMEOBOX_2. 1 hit.
PS00035. POU_1. 1 hit.
PS00465. POU_2. 1 hit.
PS51179. POU_3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "A POU-domain gene of zebrafish, ZFPOU1, specifically expressed in the developing neural tissues."
    Matsuzaki T., Amanuma H., Takeda H.
    Biochem. Biophys. Res. Commun. 187:1446-1453(1991) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SHORT), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
    Tissue: Neurula.
  2. "Class III POU genes of zebrafish are predominantly expressed in the central nervous system."
    Spaniol P., Bornmann C., Hauptmann G., Gerster T.
    Nucleic Acids Res. 24:4874-4881(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS LONG AND SHORT), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
    Tissue: Neurula.
  3. NIH - Zebrafish Gene Collection (ZGC) project
    Submitted (MAR-2008) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS LONG AND SHORT).
    Tissue: Embryo and Kidney.
  4. "Developmental expression of class III and IV POU domain genes in the zebrafish."
    Sampath K., Stuart G.W.
    Biochem. Biophys. Res. Commun. 219:565-571(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 262-374 (ISOFORM SHORT), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
    Tissue: Pharyngula.
  5. "Online automated in vivo zebrafish phosphoproteomics: from large-scale analysis down to a single embryo."
    Lemeer S., Pinkse M.W.H., Mohammed S., van Breukelen B., den Hertog J., Slijper M., Heck A.J.R.
    J. Proteome Res. 7:1555-1564(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-317, IDENTIFICATION BY MASS SPECTROMETRY.
    Tissue: Embryo.

Entry informationi

Entry nameiP3F3B_DANRE
AccessioniPrimary (citable) accession number: P79745
Secondary accession number(s): B3DJH8
, P31366, P79744, Q6PHH6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 31, 1997
Last sequence update: April 30, 1997
Last modified: March 31, 2015
This is version 123 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.