Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P79745 (P3F3B_DANRE) Reviewed, UniProtKB/Swiss-Prot

Last modified May 14, 2014. Version 119. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (1) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
POU domain, class 3, transcription factor 3-B
Alternative name(s):
Brain-specific homeobox/POU domain protein 1.0
Short name=Brain-1.0
Short name=zfBrn-1.0
POU domain protein 1
Short name=ZFPOU1
POU domain protein 23
Short name=ZP-23
Gene names
Name:pou3f3b
Synonyms:brn-1.0, pou1, pou23, zp23, zp23pou
OrganismDanio rerio (Zebrafish) (Brachydanio rerio) [Reference proteome]
Taxonomic identifier7955 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiActinopterygiiNeopterygiiTeleosteiOstariophysiCypriniformesCyprinidaeDanio

Protein attributes

Sequence length443 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Transcription factor that may play important roles in patterning the embryonic brain.

Subcellular location

Nucleus.

Tissue specificity

Predominantly expressed in the central nervous system. Ref.1 Ref.2 Ref.4

Developmental stage

First expressed at early neurula stage (9-12 hours). Expression then increases greatly at the 16-somite stage, reached the maximum level at 36 hr of development, and thereafter decreased. Only expressed in adults in the brain. Ref.1 Ref.2 Ref.4

Sequence similarities

Belongs to the POU transcription factor family. Class-3 subfamily.

Contains 1 homeobox DNA-binding domain.

Contains 1 POU-specific domain.

Ontologies

Keywords
   Biological processTranscription
Transcription regulation
   Cellular componentNucleus
   Coding sequence diversityAlternative splicing
   DomainHomeobox
   LigandDNA-binding
   Molecular functionDevelopmental protein
   PTMPhosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processmulticellular organismal development

Inferred from electronic annotation. Source: UniProtKB-KW

transcription, DNA-templated

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentnucleus

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionsequence-specific DNA binding

Inferred from electronic annotation. Source: InterPro

sequence-specific DNA binding transcription factor activity

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform Long (identifier: P79745-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform Short (identifier: P79745-2)

The sequence of this isoform differs from the canonical sequence as follows:
     407-443: GHFLVDYLKDASLTGPSEPGDQRVTTTSSFHQVILAH → VSADTPPPSMDCKRMFSET

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 443443POU domain, class 3, transcription factor 3-B
PRO_0000100771

Regions

Domain238 – 31275POU-specific
DNA binding330 – 38960Homeobox
Compositional bias84 – 9815Ala-rich
Compositional bias165 – 1695Poly-Gln
Compositional bias208 – 23528His-rich

Amino acid modifications

Modified residue3171Phosphoserine Ref.5

Natural variations

Alternative sequence407 – 44337GHFLV…VILAH → VSADTPPPSMDCKRMFSET in isoform Short.
VSP_002341

Experimental info

Sequence conflict1091M → I in BAA02377. Ref.1
Sequence conflict1161Q → QQ in AAH56549. Ref.3
Sequence conflict1161Q → QQ in AAI63489. Ref.3
Sequence conflict1351H → N in BAA02377. Ref.1
Sequence conflict1461H → Y in BAA02377. Ref.1
Sequence conflict1701S → F in BAA02377. Ref.1
Sequence conflict174 – 1752SQ → FA in BAA02377. Ref.1
Sequence conflict1851L → H in BAA02377. Ref.1
Sequence conflict2631T → K in BAA02377. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform Long [UniParc].

Last modified May 1, 1997. Version 1.
Checksum: 5F2A6DC6BB333F5C

FASTA44347,453
        10         20         30         40         50         60 
MATAASNPYL ASSSILSSGS IVHSDSGGGM QQGSAAVTSV SGGYRGDPTV KMVQSDFMQG 

        70         80         90        100        110        120 
AMAASNGGHM LSHAHQWVTS LPHAAAAAAA AAVAAAEAGS PWSSSPVGMT GSPQQQDVKN 

       130        140        150        160        170        180 
NSGRDDLHSG TALHHRAPHL GPHQTHAGAW GSTTAAHIPS LTGSQQQQQS LIYSQPGGFT 

       190        200        210        220        230        240 
VNGMLSPPGS QSLVHPGLVR GDTPELDHSS HHHHHHHQHQ HHQQAHHGVN SHDPHSDEDT 

       250        260        270        280        290        300 
PTSDDLEHFA KQFKQRRIKL GFTQADVGLA LGTLYGNVFS QTTICRFEAL QLSFKNMCKL 

       310        320        330        340        350        360 
KPLLNKWLEE ADSSTGSPTS IDKIAAQGRK RKKRTSIEVS VKGALESHFL KCPKPSAQEI 

       370        380        390        400        410        420 
TSLADNLQLE KEVVRVWFCN RRQKEKRMTP PGVPQTPEDV YSQVGNGHFL VDYLKDASLT 

       430        440 
GPSEPGDQRV TTTSSFHQVI LAH 

« Hide

Isoform Short [UniParc].

Checksum: BAAC6D655310F131
Show »

FASTA42545,527

References

« Hide 'large scale' references
[1]"A POU-domain gene of zebrafish, ZFPOU1, specifically expressed in the developing neural tissues."
Matsuzaki T., Amanuma H., Takeda H.
Biochem. Biophys. Res. Commun. 187:1446-1453(1992) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SHORT), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
Tissue: Neurula.
[2]"Class III POU genes of zebrafish are predominantly expressed in the central nervous system."
Spaniol P., Bornmann C., Hauptmann G., Gerster T.
Nucleic Acids Res. 24:4874-4881(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS LONG AND SHORT), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
Tissue: Neurula.
[3]NIH - Zebrafish Gene Collection (ZGC) project
Submitted (APR-2008) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS LONG AND SHORT).
Tissue: Embryo and Kidney.
[4]"Developmental expression of class III and IV POU domain genes in the zebrafish."
Sampath K., Stuart G.W.
Biochem. Biophys. Res. Commun. 219:565-571(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 262-374 (ISOFORM SHORT), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
Tissue: Pharyngula.
[5]"Online automated in vivo zebrafish phosphoproteomics: from large-scale analysis down to a single embryo."
Lemeer S., Pinkse M.W.H., Mohammed S., van Breukelen B., den Hertog J., Slijper M., Heck A.J.R.
J. Proteome Res. 7:1555-1564(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-317, IDENTIFICATION BY MASS SPECTROMETRY.
Tissue: Embryo.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
D13045 mRNA. Translation: BAA02377.1.
Y07907 mRNA. Translation: CAA69215.1.
Y07907 mRNA. Translation: CAA69214.1.
BC056320 mRNA. Translation: AAH56320.1.
BC056549 mRNA. Translation: AAH56549.1.
BC163489 mRNA. Translation: AAI63489.1.
PIRJH0710.
RefSeqNP_571177.2. NM_131102.2. [P79745-2]
NP_958855.1. NM_201447.1.
UniGeneDr.29717.

3D structure databases

ProteinModelPortalP79745.
SMRP79745. Positions 244-390.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING7955.ENSDARP00000065952.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSDART00000149202; ENSDARP00000123893; ENSDARG00000095896. [P79745-2]
ENSDART00000149949; ENSDARP00000124688; ENSDARG00000095896. [P79745-1]
GeneID30321.
KEGGdre:30321.

Organism-specific databases

CTD30321.
ZFINZDB-GENE-980526-140. pou3f3b.

Phylogenomic databases

eggNOGNOG261729.
GeneTreeENSGT00730000110809.
HOGENOMHOG000116303.
HOVERGENHBG053120.
InParanoidQ6PHH6.
KOK09365.
OMAHTHAGTW.
OrthoDBEOG7DJSMG.
PhylomeDBP79745.
TreeFamTF316413.

Gene expression databases

BgeeP79745.

Family and domain databases

Gene3D1.10.10.60. 1 hit.
1.10.260.40. 1 hit.
InterProIPR017970. Homeobox_CS.
IPR001356. Homeobox_dom.
IPR009057. Homeodomain-like.
IPR010982. Lambda_DNA-bd_dom.
IPR013847. POU.
IPR000327. POU_specific.
IPR016362. Transcription_factor_POU.
[Graphical view]
PfamPF00046. Homeobox. 1 hit.
PF00157. Pou. 1 hit.
[Graphical view]
PIRSFPIRSF002629. Transcription_factor_POU. 1 hit.
PRINTSPR00028. POUDOMAIN.
SMARTSM00389. HOX. 1 hit.
SM00352. POU. 1 hit.
[Graphical view]
SUPFAMSSF46689. SSF46689. 1 hit.
SSF47413. SSF47413. 1 hit.
PROSITEPS00027. HOMEOBOX_1. 1 hit.
PS50071. HOMEOBOX_2. 1 hit.
PS00035. POU_1. 1 hit.
PS00465. POU_2. 1 hit.
PS51179. POU_3. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio20806757.

Entry information

Entry nameP3F3B_DANRE
AccessionPrimary (citable) accession number: P79745
Secondary accession number(s): B3DJH8 expand/collapse secondary AC list , P31366, P79744, Q6PHH6
Entry history
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: May 1, 1997
Last modified: May 14, 2014
This is version 119 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families