SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P79745

- P3F3B_DANRE

UniProt

P79745 - P3F3B_DANRE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
POU domain, class 3, transcription factor 3-B
Gene
pou3f3b, brn-1.0, pou1, pou23, zp23, zp23pou
Organism
Danio rerio (Zebrafish) (Brachydanio rerio)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Transcription factor that may play important roles in patterning the embryonic brain.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi330 – 38960Homeobox
Add
BLAST

GO - Molecular functioni

  1. sequence-specific DNA binding Source: InterPro
  2. sequence-specific DNA binding transcription factor activity Source: InterPro
Complete GO annotation...

GO - Biological processi

  1. multicellular organismal development Source: UniProtKB-KW
  2. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
POU domain, class 3, transcription factor 3-B
Alternative name(s):
Brain-specific homeobox/POU domain protein 1.0
Short name:
Brain-1.0
Short name:
zfBrn-1.0
POU domain protein 1
Short name:
ZFPOU1
POU domain protein 23
Short name:
ZP-23
Gene namesi
Name:pou3f3b
Synonyms:brn-1.0, pou1, pou23, zp23, zp23pou
OrganismiDanio rerio (Zebrafish) (Brachydanio rerio)
Taxonomic identifieri7955 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiActinopterygiiNeopterygiiTeleosteiOstariophysiCypriniformesCyprinidaeDanio
ProteomesiUP000000437: Chromosome 6

Organism-specific databases

ZFINiZDB-GENE-980526-140. pou3f3b.

Subcellular locationi

GO - Cellular componenti

  1. nucleus Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 443443POU domain, class 3, transcription factor 3-B
PRO_0000100771Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei317 – 3171Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Expressioni

Tissue specificityi

Predominantly expressed in the central nervous system.3 Publications

Developmental stagei

First expressed at early neurula stage (9-12 hours). Expression then increases greatly at the 16-somite stage, reached the maximum level at 36 hr of development, and thereafter decreased. Only expressed in adults in the brain.3 Publications

Gene expression databases

BgeeiP79745.

Interactioni

Protein-protein interaction databases

STRINGi7955.ENSDARP00000065952.

Structurei

3D structure databases

ProteinModelPortaliP79745.
SMRiP79745. Positions 244-390.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini238 – 31275POU-specific
Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi84 – 9815Ala-rich
Add
BLAST
Compositional biasi165 – 1695Poly-Gln
Compositional biasi208 – 23528His-rich
Add
BLAST

Sequence similaritiesi

Keywords - Domaini

Homeobox

Phylogenomic databases

eggNOGiNOG261729.
GeneTreeiENSGT00730000110809.
HOGENOMiHOG000116303.
HOVERGENiHBG053120.
InParanoidiQ6PHH6.
KOiK09365.
OMAiHTHAGTW.
OrthoDBiEOG7DJSMG.
PhylomeDBiP79745.
TreeFamiTF316413.

Family and domain databases

Gene3Di1.10.10.60. 1 hit.
1.10.260.40. 1 hit.
InterProiIPR017970. Homeobox_CS.
IPR001356. Homeobox_dom.
IPR009057. Homeodomain-like.
IPR010982. Lambda_DNA-bd_dom.
IPR013847. POU.
IPR000327. POU_specific.
IPR016362. Transcription_factor_POU.
[Graphical view]
PfamiPF00046. Homeobox. 1 hit.
PF00157. Pou. 1 hit.
[Graphical view]
PIRSFiPIRSF002629. Transcription_factor_POU. 1 hit.
PRINTSiPR00028. POUDOMAIN.
SMARTiSM00389. HOX. 1 hit.
SM00352. POU. 1 hit.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 1 hit.
SSF47413. SSF47413. 1 hit.
PROSITEiPS00027. HOMEOBOX_1. 1 hit.
PS50071. HOMEOBOX_2. 1 hit.
PS00035. POU_1. 1 hit.
PS00465. POU_2. 1 hit.
PS51179. POU_3. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform Long (identifier: P79745-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MATAASNPYL ASSSILSSGS IVHSDSGGGM QQGSAAVTSV SGGYRGDPTV    50
KMVQSDFMQG AMAASNGGHM LSHAHQWVTS LPHAAAAAAA AAVAAAEAGS 100
PWSSSPVGMT GSPQQQDVKN NSGRDDLHSG TALHHRAPHL GPHQTHAGAW 150
GSTTAAHIPS LTGSQQQQQS LIYSQPGGFT VNGMLSPPGS QSLVHPGLVR 200
GDTPELDHSS HHHHHHHQHQ HHQQAHHGVN SHDPHSDEDT PTSDDLEHFA 250
KQFKQRRIKL GFTQADVGLA LGTLYGNVFS QTTICRFEAL QLSFKNMCKL 300
KPLLNKWLEE ADSSTGSPTS IDKIAAQGRK RKKRTSIEVS VKGALESHFL 350
KCPKPSAQEI TSLADNLQLE KEVVRVWFCN RRQKEKRMTP PGVPQTPEDV 400
YSQVGNGHFL VDYLKDASLT GPSEPGDQRV TTTSSFHQVI LAH 443
Length:443
Mass (Da):47,453
Last modified:May 1, 1997 - v1
Checksum:i5F2A6DC6BB333F5C
GO
Isoform Short (identifier: P79745-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     407-443: GHFLVDYLKDASLTGPSEPGDQRVTTTSSFHQVILAH → VSADTPPPSMDCKRMFSET

Show »
Length:425
Mass (Da):45,527
Checksum:iBAAC6D655310F131
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei407 – 44337GHFLV…VILAH → VSADTPPPSMDCKRMFSET in isoform Short.
VSP_002341Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti109 – 1091M → I in BAA02377. 1 Publication
Sequence conflicti116 – 1161Q → QQ in AAH56549. 1 Publication
Sequence conflicti116 – 1161Q → QQ in AAI63489. 1 Publication
Sequence conflicti135 – 1351H → N in BAA02377. 1 Publication
Sequence conflicti146 – 1461H → Y in BAA02377. 1 Publication
Sequence conflicti170 – 1701S → F in BAA02377. 1 Publication
Sequence conflicti174 – 1752SQ → FA in BAA02377. 1 Publication
Sequence conflicti185 – 1851L → H in BAA02377. 1 Publication
Sequence conflicti263 – 2631T → K in BAA02377. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D13045 mRNA. Translation: BAA02377.1.
Y07907 mRNA. Translation: CAA69215.1.
Y07907 mRNA. Translation: CAA69214.1.
BC056320 mRNA. Translation: AAH56320.1.
BC056549 mRNA. Translation: AAH56549.1.
BC163489 mRNA. Translation: AAI63489.1.
PIRiJH0710.
RefSeqiNP_571177.2. NM_131102.2. [P79745-2]
NP_958855.1. NM_201447.1.
UniGeneiDr.29717.

Genome annotation databases

EnsembliENSDART00000149202; ENSDARP00000123893; ENSDARG00000095896. [P79745-2]
ENSDART00000149949; ENSDARP00000124688; ENSDARG00000095896. [P79745-1]
GeneIDi30321.
KEGGidre:30321.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D13045 mRNA. Translation: BAA02377.1 .
Y07907 mRNA. Translation: CAA69215.1 .
Y07907 mRNA. Translation: CAA69214.1 .
BC056320 mRNA. Translation: AAH56320.1 .
BC056549 mRNA. Translation: AAH56549.1 .
BC163489 mRNA. Translation: AAI63489.1 .
PIRi JH0710.
RefSeqi NP_571177.2. NM_131102.2. [P79745-2 ]
NP_958855.1. NM_201447.1.
UniGenei Dr.29717.

3D structure databases

ProteinModelPortali P79745.
SMRi P79745. Positions 244-390.
ModBasei Search...

Protein-protein interaction databases

STRINGi 7955.ENSDARP00000065952.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSDART00000149202 ; ENSDARP00000123893 ; ENSDARG00000095896 . [P79745-2 ]
ENSDART00000149949 ; ENSDARP00000124688 ; ENSDARG00000095896 . [P79745-1 ]
GeneIDi 30321.
KEGGi dre:30321.

Organism-specific databases

CTDi 30321.
ZFINi ZDB-GENE-980526-140. pou3f3b.

Phylogenomic databases

eggNOGi NOG261729.
GeneTreei ENSGT00730000110809.
HOGENOMi HOG000116303.
HOVERGENi HBG053120.
InParanoidi Q6PHH6.
KOi K09365.
OMAi HTHAGTW.
OrthoDBi EOG7DJSMG.
PhylomeDBi P79745.
TreeFami TF316413.

Miscellaneous databases

NextBioi 20806757.

Gene expression databases

Bgeei P79745.

Family and domain databases

Gene3Di 1.10.10.60. 1 hit.
1.10.260.40. 1 hit.
InterProi IPR017970. Homeobox_CS.
IPR001356. Homeobox_dom.
IPR009057. Homeodomain-like.
IPR010982. Lambda_DNA-bd_dom.
IPR013847. POU.
IPR000327. POU_specific.
IPR016362. Transcription_factor_POU.
[Graphical view ]
Pfami PF00046. Homeobox. 1 hit.
PF00157. Pou. 1 hit.
[Graphical view ]
PIRSFi PIRSF002629. Transcription_factor_POU. 1 hit.
PRINTSi PR00028. POUDOMAIN.
SMARTi SM00389. HOX. 1 hit.
SM00352. POU. 1 hit.
[Graphical view ]
SUPFAMi SSF46689. SSF46689. 1 hit.
SSF47413. SSF47413. 1 hit.
PROSITEi PS00027. HOMEOBOX_1. 1 hit.
PS50071. HOMEOBOX_2. 1 hit.
PS00035. POU_1. 1 hit.
PS00465. POU_2. 1 hit.
PS51179. POU_3. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "A POU-domain gene of zebrafish, ZFPOU1, specifically expressed in the developing neural tissues."
    Matsuzaki T., Amanuma H., Takeda H.
    Biochem. Biophys. Res. Commun. 187:1446-1453(1992) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SHORT), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
    Tissue: Neurula.
  2. "Class III POU genes of zebrafish are predominantly expressed in the central nervous system."
    Spaniol P., Bornmann C., Hauptmann G., Gerster T.
    Nucleic Acids Res. 24:4874-4881(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS LONG AND SHORT), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
    Tissue: Neurula.
  3. NIH - Zebrafish Gene Collection (ZGC) project
    Submitted (APR-2008) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS LONG AND SHORT).
    Tissue: Embryo and Kidney.
  4. "Developmental expression of class III and IV POU domain genes in the zebrafish."
    Sampath K., Stuart G.W.
    Biochem. Biophys. Res. Commun. 219:565-571(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 262-374 (ISOFORM SHORT), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
    Tissue: Pharyngula.
  5. "Online automated in vivo zebrafish phosphoproteomics: from large-scale analysis down to a single embryo."
    Lemeer S., Pinkse M.W.H., Mohammed S., van Breukelen B., den Hertog J., Slijper M., Heck A.J.R.
    J. Proteome Res. 7:1555-1564(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-317, IDENTIFICATION BY MASS SPECTROMETRY.
    Tissue: Embryo.

Entry informationi

Entry nameiP3F3B_DANRE
AccessioniPrimary (citable) accession number: P79745
Secondary accession number(s): B3DJH8
, P31366, P79744, Q6PHH6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: May 1, 1997
Last modified: May 14, 2014
This is version 119 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi