P79745 (P3F3B_DANRE) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 110.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: POU domain, class 3, transcription factor 3-B Alternative name(s): Brain-specific homeobox/POU domain protein 1.0 Short name=Brain-1.0 Short name=zfBrn-1.0 POU domain protein 1 Short name=ZFPOU1 POU domain protein 23 Short name=ZP-23 | ||||
| Gene names |
| ||||
| Organism | Danio rerio (Zebrafish) (Brachydanio rerio) [Reference proteome] | ||||
| Taxonomic identifier | 7955 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Actinopterygii › Neopterygii › Teleostei › Ostariophysi › Cypriniformes › Cyprinidae › Danio![]() |
Protein attributes
| Sequence length | 443 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Transcription factor that may play important roles in patterning the embryonic brain. |
| Subcellular location | |
| Tissue specificity | Predominantly expressed in the central nervous system. Ref.1 Ref.2 Ref.4 |
| Developmental stage | First expressed at early neurula stage (9-12 hours). Expression then increases greatly at the 16-somite stage, reached the maximum level at 36 hr of development, and thereafter decreased. Only expressed in adults in the brain. Ref.1 Ref.2 Ref.4 |
| Sequence similarities | Belongs to the POU transcription factor family. Class-3 subfamily. Contains 1 homeobox DNA-binding domain. Contains 1 POU-specific domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing |
| Domain | Homeobox |
| Ligand | DNA-binding |
| Molecular function | Developmental protein |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | multicellular organismal development Inferred from electronic annotation. Source: UniProtKB-KW transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | nucleus Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | sequence-specific DNA binding Inferred from electronic annotation. Source: InterPro sequence-specific DNA binding transcription factor activityInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Long (identifier: P79745-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Short (identifier: P79745-2) The sequence of this isoform differs from the canonical sequence as follows: 407-443: GHFLVDYLKDASLTGPSEPGDQRVTTTSSFHQVILAH → VSADTPPPSMDCKRMFSET |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 443 | 443 | POU domain, class 3, transcription factor 3-B | PRO_0000100771 | |||||
Regions | |||||||||
| Domain | 238 – 312 | 75 | POU-specific | ||||||
| DNA binding | 330 – 389 | 60 | Homeobox | ||||||
| Compositional bias | 84 – 98 | 15 | Ala-rich | ||||||
| Compositional bias | 165 – 169 | 5 | Poly-Gln | ||||||
| Compositional bias | 208 – 235 | 28 | His-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 317 | 1 | Phosphoserine Ref.5 | ||||||
Natural variations | |||||||||
| Alternative sequence | 407 – 443 | 37 | GHFLV…VILAH → VSADTPPPSMDCKRMFSET in isoform Short. | VSP_002341 | |||||
Experimental info | |||||||||
| Sequence conflict | 109 | 1 | M → I in BAA02377. Ref.1 | ||||||
| Sequence conflict | 116 | 1 | Q → QQ in AAH56549. Ref.3 | ||||||
| Sequence conflict | 116 | 1 | Q → QQ in AAI63489. Ref.3 | ||||||
| Sequence conflict | 135 | 1 | H → N in BAA02377. Ref.1 | ||||||
| Sequence conflict | 146 | 1 | H → Y in BAA02377. Ref.1 | ||||||
| Sequence conflict | 170 | 1 | S → F in BAA02377. Ref.1 | ||||||
| Sequence conflict | 174 – 175 | 2 | SQ → FA in BAA02377. Ref.1 | ||||||
| Sequence conflict | 185 | 1 | L → H in BAA02377. Ref.1 | ||||||
| Sequence conflict | 263 | 1 | T → K in BAA02377. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A POU-domain gene of zebrafish, ZFPOU1, specifically expressed in the developing neural tissues." Matsuzaki T., Amanuma H., Takeda H. Biochem. Biophys. Res. Commun. 187:1446-1453(1992) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SHORT), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE. Tissue: Neurula. |
| [2] | "Class III POU genes of zebrafish are predominantly expressed in the central nervous system." Spaniol P., Bornmann C., Hauptmann G., Gerster T. Nucleic Acids Res. 24:4874-4881(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS LONG AND SHORT), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE. Tissue: Neurula. |
| [3] | NIH - Zebrafish Gene Collection (ZGC) project Submitted (APR-2008) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS LONG AND SHORT). Tissue: Embryo and Kidney. |
| [4] | "Developmental expression of class III and IV POU domain genes in the zebrafish." Sampath K., Stuart G.W. Biochem. Biophys. Res. Commun. 219:565-571(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 262-374 (ISOFORM SHORT), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE. Tissue: Pharyngula. |
| [5] | "Online automated in vivo zebrafish phosphoproteomics: from large-scale analysis down to a single embryo." Lemeer S., Pinkse M.W.H., Mohammed S., van Breukelen B., den Hertog J., Slijper M., Heck A.J.R. J. Proteome Res. 7:1555-1564(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-317, MASS SPECTROMETRY. Tissue: Embryo. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | D13045 mRNA. Translation: BAA02377.1. Y07907 mRNA. Translation: CAA69215.1. Y07907 mRNA. Translation: CAA69214.1. BC056320 mRNA. Translation: AAH56320.1. BC056549 mRNA. Translation: AAH56549.1. BC163489 mRNA. Translation: AAI63489.1. |
| IPI | IPI00506827. IPI00934210. |
| PIR | JH0710. |
| RefSeq | NP_571177.2. NM_131102.2. NP_958855.1. NM_201447.1. |
| UniGene | Dr.29717. |
3D structure databases | |
| ProteinModelPortal | P79745. |
| SMR | P79745. Positions 244-390. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 7955.ENSDARP00000065952. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSDART00000149202; ENSDARP00000123893; ENSDARG00000095896. ENSDART00000149949; ENSDARP00000124688; ENSDARG00000095896. |
| GeneID | 30321. |
| KEGG | dre:30321. |
Organism-specific databases | |
| CTD | 30321. |
| ZFIN | ZDB-GENE-980526-140. pou3f3b. |
Phylogenomic databases | |
| eggNOG | NOG261729. |
| GeneTree | ENSGT00700000104117. |
| HOGENOM | HOG000116303. |
| HOVERGEN | HBG053120. |
| InParanoid | Q6PHH6. |
| KO | K09365. |
| OrthoDB | EOG4HDSTS. |
Gene expression databases | |
| Bgee | P79745. |
Family and domain databases | |
| Gene3D | 1.10.10.60. 1 hit. 1.10.260.40. 1 hit. |
| InterPro | IPR017970. Homeobox_CS. IPR001356. Homeodomain. IPR009057. Homeodomain-like. IPR010982. Lambda_DNA-bd_dom. IPR013847. POU. IPR000327. POU_specific. IPR016362. Transcription_factor_POU. [Graphical view] |
| Pfam | PF00046. Homeobox. 1 hit. PF00157. Pou. 1 hit. [Graphical view] |
| PIRSF | PIRSF002629. Transcription_factor_POU. 1 hit. |
| PRINTS | PR00028. POUDOMAIN. |
| SMART | SM00389. HOX. 1 hit. SM00352. POU. 1 hit. [Graphical view] |
| SUPFAM | SSF46689. Homeodomain_like. 1 hit. SSF47413. Lambda_like_DNA. 1 hit. |
| PROSITE | PS00027. HOMEOBOX_1. 1 hit. PS50071. HOMEOBOX_2. 1 hit. PS00035. POU_1. 1 hit. PS00465. POU_2. 1 hit. PS51179. POU_3. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 20806757. |
Entry information
| Entry name | P3F3B_DANRE | ||||||||
| Accession | Primary (citable) accession number: P79745 Secondary accession number(s): B3DJH8 Q6PHH6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| SIMILARITY comments Index of protein domains and families |

Clusters with
