Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P79745

- P3F3B_DANRE

UniProt

P79745 - P3F3B_DANRE

Protein

POU domain, class 3, transcription factor 3-B

Gene

pou3f3b

Organism
Danio rerio (Zebrafish) (Brachydanio rerio)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 120 (01 Oct 2014)
      Sequence version 1 (01 May 1997)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Transcription factor that may play important roles in patterning the embryonic brain.

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    DNA bindingi330 – 38960HomeoboxPROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. sequence-specific DNA binding Source: InterPro
    2. sequence-specific DNA binding transcription factor activity Source: InterPro

    GO - Biological processi

    1. multicellular organismal development Source: UniProtKB-KW
    2. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Molecular functioni

    Developmental protein

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    POU domain, class 3, transcription factor 3-B
    Alternative name(s):
    Brain-specific homeobox/POU domain protein 1.0
    Short name:
    Brain-1.0
    Short name:
    zfBrn-1.0
    POU domain protein 1
    Short name:
    ZFPOU1
    POU domain protein 23
    Short name:
    ZP-23
    Gene namesi
    Name:pou3f3b
    Synonyms:brn-1.0, pou1, pou23, zp23, zp23pou
    OrganismiDanio rerio (Zebrafish) (Brachydanio rerio)
    Taxonomic identifieri7955 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiActinopterygiiNeopterygiiTeleosteiOstariophysiCypriniformesCyprinidaeDanio
    ProteomesiUP000000437: Chromosome 6

    Organism-specific databases

    ZFINiZDB-GENE-980526-140. pou3f3b.

    Subcellular locationi

    GO - Cellular componenti

    1. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Nucleus

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 443443POU domain, class 3, transcription factor 3-BPRO_0000100771Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei317 – 3171Phosphoserine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Expressioni

    Tissue specificityi

    Predominantly expressed in the central nervous system.3 Publications

    Developmental stagei

    First expressed at early neurula stage (9-12 hours). Expression then increases greatly at the 16-somite stage, reached the maximum level at 36 hr of development, and thereafter decreased. Only expressed in adults in the brain.3 Publications

    Gene expression databases

    BgeeiP79745.

    Interactioni

    Protein-protein interaction databases

    STRINGi7955.ENSDARP00000065952.

    Structurei

    3D structure databases

    ProteinModelPortaliP79745.
    SMRiP79745. Positions 244-390.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini238 – 31275POU-specificPROSITE-ProRule annotationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi84 – 9815Ala-richAdd
    BLAST
    Compositional biasi165 – 1695Poly-Gln
    Compositional biasi208 – 23528His-richAdd
    BLAST

    Sequence similaritiesi

    Contains 1 homeobox DNA-binding domain.PROSITE-ProRule annotation
    Contains 1 POU-specific domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Homeobox

    Phylogenomic databases

    eggNOGiNOG261729.
    GeneTreeiENSGT00730000110809.
    HOGENOMiHOG000116303.
    HOVERGENiHBG053120.
    InParanoidiQ6PHH6.
    KOiK09365.
    OMAiHTHAGTW.
    OrthoDBiEOG7DJSMG.
    PhylomeDBiP79745.
    TreeFamiTF316413.

    Family and domain databases

    Gene3Di1.10.10.60. 1 hit.
    1.10.260.40. 1 hit.
    InterProiIPR017970. Homeobox_CS.
    IPR001356. Homeobox_dom.
    IPR009057. Homeodomain-like.
    IPR010982. Lambda_DNA-bd_dom.
    IPR013847. POU.
    IPR000327. POU_specific.
    IPR016362. Transcription_factor_POU.
    [Graphical view]
    PfamiPF00046. Homeobox. 1 hit.
    PF00157. Pou. 1 hit.
    [Graphical view]
    PIRSFiPIRSF002629. Transcription_factor_POU. 1 hit.
    PRINTSiPR00028. POUDOMAIN.
    SMARTiSM00389. HOX. 1 hit.
    SM00352. POU. 1 hit.
    [Graphical view]
    SUPFAMiSSF46689. SSF46689. 1 hit.
    SSF47413. SSF47413. 1 hit.
    PROSITEiPS00027. HOMEOBOX_1. 1 hit.
    PS50071. HOMEOBOX_2. 1 hit.
    PS00035. POU_1. 1 hit.
    PS00465. POU_2. 1 hit.
    PS51179. POU_3. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform Long (identifier: P79745-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MATAASNPYL ASSSILSSGS IVHSDSGGGM QQGSAAVTSV SGGYRGDPTV    50
    KMVQSDFMQG AMAASNGGHM LSHAHQWVTS LPHAAAAAAA AAVAAAEAGS 100
    PWSSSPVGMT GSPQQQDVKN NSGRDDLHSG TALHHRAPHL GPHQTHAGAW 150
    GSTTAAHIPS LTGSQQQQQS LIYSQPGGFT VNGMLSPPGS QSLVHPGLVR 200
    GDTPELDHSS HHHHHHHQHQ HHQQAHHGVN SHDPHSDEDT PTSDDLEHFA 250
    KQFKQRRIKL GFTQADVGLA LGTLYGNVFS QTTICRFEAL QLSFKNMCKL 300
    KPLLNKWLEE ADSSTGSPTS IDKIAAQGRK RKKRTSIEVS VKGALESHFL 350
    KCPKPSAQEI TSLADNLQLE KEVVRVWFCN RRQKEKRMTP PGVPQTPEDV 400
    YSQVGNGHFL VDYLKDASLT GPSEPGDQRV TTTSSFHQVI LAH 443
    Length:443
    Mass (Da):47,453
    Last modified:May 1, 1997 - v1
    Checksum:i5F2A6DC6BB333F5C
    GO
    Isoform Short (identifier: P79745-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         407-443: GHFLVDYLKDASLTGPSEPGDQRVTTTSSFHQVILAH → VSADTPPPSMDCKRMFSET

    Show »
    Length:425
    Mass (Da):45,527
    Checksum:iBAAC6D655310F131
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti109 – 1091M → I in BAA02377. (PubMed:1417821)Curated
    Sequence conflicti116 – 1161Q → QQ in AAH56549. 1 PublicationCurated
    Sequence conflicti116 – 1161Q → QQ in AAI63489. 1 PublicationCurated
    Sequence conflicti135 – 1351H → N in BAA02377. (PubMed:1417821)Curated
    Sequence conflicti146 – 1461H → Y in BAA02377. (PubMed:1417821)Curated
    Sequence conflicti170 – 1701S → F in BAA02377. (PubMed:1417821)Curated
    Sequence conflicti174 – 1752SQ → FA in BAA02377. (PubMed:1417821)Curated
    Sequence conflicti185 – 1851L → H in BAA02377. (PubMed:1417821)Curated
    Sequence conflicti263 – 2631T → K in BAA02377. (PubMed:1417821)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei407 – 44337GHFLV…VILAH → VSADTPPPSMDCKRMFSET in isoform Short. 4 PublicationsVSP_002341Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D13045 mRNA. Translation: BAA02377.1.
    Y07907 mRNA. Translation: CAA69215.1.
    Y07907 mRNA. Translation: CAA69214.1.
    BC056320 mRNA. Translation: AAH56320.1.
    BC056549 mRNA. Translation: AAH56549.1.
    BC163489 mRNA. Translation: AAI63489.1.
    PIRiJH0710.
    RefSeqiNP_571177.2. NM_131102.2. [P79745-2]
    NP_958855.1. NM_201447.1.
    UniGeneiDr.29717.

    Genome annotation databases

    EnsembliENSDART00000149202; ENSDARP00000123893; ENSDARG00000095896. [P79745-2]
    ENSDART00000149949; ENSDARP00000124688; ENSDARG00000095896. [P79745-1]
    GeneIDi30321.
    KEGGidre:30321.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D13045 mRNA. Translation: BAA02377.1 .
    Y07907 mRNA. Translation: CAA69215.1 .
    Y07907 mRNA. Translation: CAA69214.1 .
    BC056320 mRNA. Translation: AAH56320.1 .
    BC056549 mRNA. Translation: AAH56549.1 .
    BC163489 mRNA. Translation: AAI63489.1 .
    PIRi JH0710.
    RefSeqi NP_571177.2. NM_131102.2. [P79745-2 ]
    NP_958855.1. NM_201447.1.
    UniGenei Dr.29717.

    3D structure databases

    ProteinModelPortali P79745.
    SMRi P79745. Positions 244-390.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 7955.ENSDARP00000065952.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSDART00000149202 ; ENSDARP00000123893 ; ENSDARG00000095896 . [P79745-2 ]
    ENSDART00000149949 ; ENSDARP00000124688 ; ENSDARG00000095896 . [P79745-1 ]
    GeneIDi 30321.
    KEGGi dre:30321.

    Organism-specific databases

    CTDi 30321.
    ZFINi ZDB-GENE-980526-140. pou3f3b.

    Phylogenomic databases

    eggNOGi NOG261729.
    GeneTreei ENSGT00730000110809.
    HOGENOMi HOG000116303.
    HOVERGENi HBG053120.
    InParanoidi Q6PHH6.
    KOi K09365.
    OMAi HTHAGTW.
    OrthoDBi EOG7DJSMG.
    PhylomeDBi P79745.
    TreeFami TF316413.

    Miscellaneous databases

    NextBioi 20806757.

    Gene expression databases

    Bgeei P79745.

    Family and domain databases

    Gene3Di 1.10.10.60. 1 hit.
    1.10.260.40. 1 hit.
    InterProi IPR017970. Homeobox_CS.
    IPR001356. Homeobox_dom.
    IPR009057. Homeodomain-like.
    IPR010982. Lambda_DNA-bd_dom.
    IPR013847. POU.
    IPR000327. POU_specific.
    IPR016362. Transcription_factor_POU.
    [Graphical view ]
    Pfami PF00046. Homeobox. 1 hit.
    PF00157. Pou. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF002629. Transcription_factor_POU. 1 hit.
    PRINTSi PR00028. POUDOMAIN.
    SMARTi SM00389. HOX. 1 hit.
    SM00352. POU. 1 hit.
    [Graphical view ]
    SUPFAMi SSF46689. SSF46689. 1 hit.
    SSF47413. SSF47413. 1 hit.
    PROSITEi PS00027. HOMEOBOX_1. 1 hit.
    PS50071. HOMEOBOX_2. 1 hit.
    PS00035. POU_1. 1 hit.
    PS00465. POU_2. 1 hit.
    PS51179. POU_3. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "A POU-domain gene of zebrafish, ZFPOU1, specifically expressed in the developing neural tissues."
      Matsuzaki T., Amanuma H., Takeda H.
      Biochem. Biophys. Res. Commun. 187:1446-1453(1992) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SHORT), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
      Tissue: Neurula.
    2. "Class III POU genes of zebrafish are predominantly expressed in the central nervous system."
      Spaniol P., Bornmann C., Hauptmann G., Gerster T.
      Nucleic Acids Res. 24:4874-4881(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS LONG AND SHORT), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
      Tissue: Neurula.
    3. NIH - Zebrafish Gene Collection (ZGC) project
      Submitted (APR-2008) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS LONG AND SHORT).
      Tissue: Embryo and Kidney.
    4. "Developmental expression of class III and IV POU domain genes in the zebrafish."
      Sampath K., Stuart G.W.
      Biochem. Biophys. Res. Commun. 219:565-571(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 262-374 (ISOFORM SHORT), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
      Tissue: Pharyngula.
    5. "Online automated in vivo zebrafish phosphoproteomics: from large-scale analysis down to a single embryo."
      Lemeer S., Pinkse M.W.H., Mohammed S., van Breukelen B., den Hertog J., Slijper M., Heck A.J.R.
      J. Proteome Res. 7:1555-1564(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-317, IDENTIFICATION BY MASS SPECTROMETRY.
      Tissue: Embryo.

    Entry informationi

    Entry nameiP3F3B_DANRE
    AccessioniPrimary (citable) accession number: P79745
    Secondary accession number(s): B3DJH8
    , P31366, P79744, Q6PHH6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1997
    Last sequence update: May 1, 1997
    Last modified: October 1, 2014
    This is version 120 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3