Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

F-actin-capping protein subunit beta

Gene

CAPZB

Organism
Bos taurus (Bovine)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

F-actin-capping proteins bind in a Ca2+-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments. The isoform beta-3 may play a role in spermatogenesis. Alternatively, may play a role in later maturation steps such as capacitation and fertilization which involve changes of membrane domains. May play a role in the regulation of cell morphology and cytoskeletal organization.

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Actin capping

Keywords - Ligandi

Actin-binding

Enzyme and pathway databases

ReactomeiR-BTA-983231. Factors involved in megakaryocyte development and platelet production.

Names & Taxonomyi

Protein namesi
Recommended name:
F-actin-capping protein subunit beta
Alternative name(s):
CapZ beta
Gene namesi
Name:CAPZB
OrganismiBos taurus (Bovine)
Taxonomic identifieri9913 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaLaurasiatheriaCetartiodactylaRuminantiaPecoraBovidaeBovinaeBos
Proteomesi
  • UP000009136 Componenti: Chromosome 2

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002046331 – 301F-actin-capping protein subunit betaAdd BLAST301

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei31PhosphoserineBy similarity1
Modified residuei264N6-acetyllysineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDbiP79136.
PeptideAtlasiP79136.
PRIDEiP79136.

Expressioni

Tissue specificityi

The isoform beta-3 is predominantly expressed in the testis. It is only detected in total sperm, sperm heads and the calyx fraction, but not in sperm tails or any supernatant fraction. Weaker expression also found in brain.

Gene expression databases

BgeeiENSBTAG00000004554.

Interactioni

Subunit structurei

Heterodimer of an alpha and a beta subunit. Interacts with ARHGAP17 and RCSD1/CAPZIP. Component of the WASH complex, composed of F-actin-capping protein subunit alpha (CAPZA1, CAPZA2 or CAPZA3), F-actin-capping protein subunit beta (CAPZB), WASH1, FAM21, KIAA1033, KIAA0196 and CCDC53 (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
MTPNQ3T0F72EBI-2128126,EBI-2128107

GO - Molecular functioni

Protein-protein interaction databases

IntActiP79136. 2 interactors.
STRINGi9913.ENSBTAP00000005983.

Structurei

3D structure databases

ProteinModelPortaliP79136.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG3174. Eukaryota.
ENOG410XQYD. LUCA.
GeneTreeiENSGT00390000017957.
HOGENOMiHOG000041208.
HOVERGENiHBG050789.
InParanoidiP79136.
KOiK10365.
OMAiFDTYREM.
OrthoDBiEOG091G0EH8.
TreeFamiTF105732.

Family and domain databases

InterProiIPR001698. CAPZB.
IPR019771. F-actin_capping_bsu_CS.
[Graphical view]
PANTHERiPTHR10619. PTHR10619. 1 hit.
PfamiPF01115. F_actin_cap_B. 1 hit.
[Graphical view]
PRINTSiPR00192. FACTINCAPB.
PROSITEiPS00231. F_ACTIN_CAPPING_BETA. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform Beta-3 (identifier: P79136-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MHPCRRSLPF PLNCQLVKVG TADYGGASDQ SDQQLDCALD LMRRLPPQQI
60 70 80 90 100
EKNLSDLIDL VPSLCEDLLS SVDQPLKIAR DKVVGKDYLL CDYNRDGDSY
110 120 130 140 150
RSPWSNKYDP PLEDGAMPSA RLRKLEVEAN NAFDQYRDLY FEGGVSSVYL
160 170 180 190 200
WDLDHGFAGV ILIKKAGDGS KKIKGCWDSI HVVEVQEKSS GRTAHYKLTS
210 220 230 240 250
TVMLWLQTNK SGSGTMNLGG SLTRQMEKDE TVSDCSPHIA NIGRLVEDME
260 270 280 290 300
NKIRSTLNEI YFGKTKDIVN GLRSVQTFAD KSKQEALKND LVEALKRKQQ

C
Length:301
Mass (Da):33,741
Last modified:May 1, 1997 - v1
Checksum:iE4029F1A53614719
GO
Isoform Beta-1 (identifier: P79136-3)
Sequence is not available
Length:
Mass (Da):
Isoform Beta-2 (identifier: P79136-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MHPCRRSLPFPLNCQLVKVGTADYGGASDQ → M

Show »
Length:272
Mass (Da):30,629
Checksum:iE6466A68B1254FD0
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0007661 – 30MHPCR…GASDQ → M in isoform Beta-2. 1 PublicationAdd BLAST30

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z85980 mRNA. Translation: CAB06626.1.
Y10372 mRNA. Translation: CAA71401.1.
BC102613 mRNA. Translation: AAI02614.1.
RefSeqiNP_788821.1. NM_176648.4. [P79136-1]
UniGeneiBt.4730.

Genome annotation databases

EnsembliENSBTAT00000005983; ENSBTAP00000005983; ENSBTAG00000004554. [P79136-1]
GeneIDi338052.
KEGGibta:338052.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z85980 mRNA. Translation: CAB06626.1.
Y10372 mRNA. Translation: CAA71401.1.
BC102613 mRNA. Translation: AAI02614.1.
RefSeqiNP_788821.1. NM_176648.4. [P79136-1]
UniGeneiBt.4730.

3D structure databases

ProteinModelPortaliP79136.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiP79136. 2 interactors.
STRINGi9913.ENSBTAP00000005983.

Proteomic databases

PaxDbiP79136.
PeptideAtlasiP79136.
PRIDEiP79136.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSBTAT00000005983; ENSBTAP00000005983; ENSBTAG00000004554. [P79136-1]
GeneIDi338052.
KEGGibta:338052.

Organism-specific databases

CTDi832.

Phylogenomic databases

eggNOGiKOG3174. Eukaryota.
ENOG410XQYD. LUCA.
GeneTreeiENSGT00390000017957.
HOGENOMiHOG000041208.
HOVERGENiHBG050789.
InParanoidiP79136.
KOiK10365.
OMAiFDTYREM.
OrthoDBiEOG091G0EH8.
TreeFamiTF105732.

Enzyme and pathway databases

ReactomeiR-BTA-983231. Factors involved in megakaryocyte development and platelet production.

Gene expression databases

BgeeiENSBTAG00000004554.

Family and domain databases

InterProiIPR001698. CAPZB.
IPR019771. F-actin_capping_bsu_CS.
[Graphical view]
PANTHERiPTHR10619. PTHR10619. 1 hit.
PfamiPF01115. F_actin_cap_B. 1 hit.
[Graphical view]
PRINTSiPR00192. FACTINCAPB.
PROSITEiPS00231. F_ACTIN_CAPPING_BETA. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCAPZB_BOVIN
AccessioniPrimary (citable) accession number: P79136
Secondary accession number(s): Q3T012
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: May 1, 1997
Last modified: October 5, 2016
This is version 122 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.