P78563 (RED1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 16, 2012.
Version 118.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Double-stranded RNA-specific editase 1 EC=3.5.-.- Alternative name(s): RNA-editing deaminase 1 RNA-editing enzyme 1 dsRNA adenosine deaminase | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 741 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Editing of the messenger RNAs for glutamate receptor (GluR) subunits by site-selective adenosine deamination. Edits both the GluR-B Q/R and R/G sites efficiently but converts the adenosine in hotspot1 much less efficiently. |
| Cofactor | Binds 1 inositol hexakisphosphate (IP6) per subunit. |
| Tissue specificity | Highly expressed in brain and heart and at lower levels in placenta. Fair expression in lung, liver and kikney. Detected in brain, heart, kidney, lung and liver (at protein level). Isoform 5 is high expressed in hippocampus and colon. Ref.1 Ref.9 |
| Sequence similarities | Contains 1 A to I editase domain. Contains 2 DRBM (double-stranded RNA-binding) domains. |
Ontologies
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: P78563-1) Also known as: RED1-L; DRADA2B; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: Alu insert from position 465 to 505. Has a lower catalytic activity than isoform 2. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 2 (identifier: P78563-2) Also known as: RED1-S; DRADA2A; The sequence of this isoform differs from the canonical sequence as follows: 466-505: Missing. | ||||||
| Note: Has a higher catalytic activity than isoform 1. | ||||||
| Isoform 3 (identifier: P78563-3) Also known as: DRADA2C; The sequence of this isoform differs from the canonical sequence as follows: 713-741: ARLFTAFIKAGLGAWVEKPTEQDQFSLTP → VH | ||||||
| Isoform 4 (identifier: P78563-4) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MKIPRMKTPCQPDRNSLRQSRNPQKYFA 466-505: Missing. | ||||||
| Isoform 5 (identifier: P78563-5) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MGTFFSVMGRRYKRRRKKRSERKDRNSLRQSRNPQKYFAM 26-741: Missing. | ||||||
| Note: Incomplete sequence. Alternative 5'exon. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 741 | 741 | Double-stranded RNA-specific editase 1 | PRO_0000171779 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 78 – 144 | 67 | DRBM 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 231 – 298 | 68 | DRBM 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 370 – 737 | 368 | A to I editase | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 83 – 88 | 6 | Interaction with substrate RNA By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 104 – 105 | 2 | Interaction with substrate RNA By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 237 – 242 | 6 | Interaction with substrate RNA By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 259 | 1 | Interaction with substrate RNA By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 396 | 1 | Proton donor | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 394 | 1 | Zinc | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 451 | 1 | Zinc | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 556 | 1 | Zinc | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 400 | 1 | Inositol hexakisphosphate | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 401 | 1 | Inositol hexakisphosphate | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 559 | 1 | Inositol hexakisphosphate | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 562 | 1 | Inositol hexakisphosphate | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 669 | 1 | Inositol hexakisphosphate | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 702 | 1 | Inositol hexakisphosphate | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 712 | 1 | Inositol hexakisphosphate | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 730 | 1 | Inositol hexakisphosphate | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 26 | 1 | Phosphoserine Ref.11 Ref.12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MKIPRMKTPCQPDRNSLRQS RNPQKYFA in isoform 4. | VSP_019597 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MGTFFSVMGRRYKRRRKKRS ERKDRNSLRQSRNPQKYFAM in isoform 5. | VSP_041421 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 26 – 741 | 716 | Missing in isoform 5. | VSP_041422 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 466 – 505 | 40 | Missing in isoform 2 and isoform 4. | VSP_000865 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 713 – 741 | 29 | ARLFT…FSLTP → VH in isoform 3. | VSP_000866 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 30 | 1 | G → A in AAB58300. Ref.4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 30 | 1 | G → A in AAM83100. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 30 | 1 | G → A in AAN10291. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 423 | 1 | R → E in AAB58300. Ref.4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 423 | 1 | R → E in AAM83100. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 423 | 1 | R → E in AAN10291. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 475 | 1 | V → L in AAM83100. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 475 | 1 | V → L in AAN10291. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 320 – 338 | 19 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 339 – 343 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 345 – 347 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 352 – 361 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 363 – 365 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 367 – 373 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 380 – 382 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 395 – 416 | 22 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 418 – 423 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 425 – 428 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 432 – 436 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 440 – 448 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 453 – 456 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 521 – 524 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 542 – 546 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 552 – 554 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 556 – 566 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 570 – 574 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 582 – 589 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 593 – 600 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 602 – 604 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 620 – 623 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 637 – 643 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 650 – 653 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 654 – 657 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 669 – 680 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 685 – 687 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 698 – 703 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 706 – 721 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 732 – 735 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Two forms of human double-stranded RNA-specific editase 1 (hRED1) generated by the insertion of an Alu cassette." Gerber A., O'Connell M.A., Keller W. RNA 3:453-463(1997) [PubMed: 9149227] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY, CATALYTIC ACTIVITY. Tissue: Brain. |
| [2] | "Cloning of a human RNA editing deaminase (ADARB1) of glutamate receptors that maps to chromosome 21q22.3." Mittaz L., Scott H.S., Rossier C., Seeburg P.H., Higuchi M., Antonarakis S.E. Genomics 41:210-217(1997) [PubMed: 9143496] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). Tissue: Fetal brain. |
| [3] | "Editing of glutamate receptor B subunit ion channel RNAs by four alternatively spliced DRADA2 double-stranded RNA adenosine deaminases." Lai F., Chen C.-X., Carter K.C., Nishikura K. Mol. Cell. Biol. 17:2413-2424(1997) [PubMed: 9111310] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3). |
| [4] | "Map location, genomic organization and expression patterns of the human RED1 RNA editase." Villard L., Tassone F., Haymowicz M., Welborn R., Gardiner K. Somat. Cell Mol. Genet. 23:135-145(1997) [PubMed: 9330641] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [5] | "Phylogenetic comparison of the pre-mRNA adenosine deaminase ADAR2 genes and transcripts: conservation and diversity in editing site sequence and alternative splicing patterns." Slavov D., Gardiner K. Gene 299:83-94(2002) [PubMed: 12459255] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4). |
| [6] | "Novel splice variants of human ADAR2 mRNA: skipping of the exon encoding the dsRNA-binding domains, and multiple C-terminal splice sites." Kawahara Y., Ito K., Ito M., Tsuji S., Kwak S. Gene 363:193-201(2005) [PubMed: 16297572] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [7] | "The DNA sequence of human chromosome 21." Hattori M., Fujiyama A., Taylor T.D., Watanabe H., Yada T., Park H.-S., Toyoda A., Ishii K., Totoki Y., Choi D.-K., Groner Y., Soeda E., Ohki M., Takagi T., Sakaki Y., Taudien S., Blechschmidt K., Polley A. Yaspo M.-L.Nature 405:311-319(2000) [PubMed: 10830953] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | "Novel exon of mammalian ADAR2 extends open reading frame." Maas S., Gommans W.M. PLoS ONE 4:E4225-E4225(2009) [PubMed: 19156214] [Abstract] Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), TISSUE SPECIFICITY. |
| [10] | "An unappreciated role for RNA surveillance." Hillman R.T., Green R.E., Brenner S.E. Genome Biol. 5:R8.1-R8.16(2004) [PubMed: 14759258] [Abstract] Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S). |
| [11] | "Large-scale characterization of HeLa cell nuclear phosphoproteins." Beausoleil S.A., Jedrychowski M., Schwartz D., Elias J.E., Villen J., Li J., Cohn M.A., Cantley L.C., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 101:12130-12135(2004) [PubMed: 15302935] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-26, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [12] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-26, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [13] | "Inositol hexakisphosphate is bound in the ADAR2 core and required for RNA editing." Macbeth M.R., Schubert H.L., Vandemark A.P., Lingam A.T., Hill C.P., Bass B.L. Science 309:1534-1539(2005) [PubMed: 16141067] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.7 ANGSTROMS) OF 299-741 IN COMPLEX WITH IP6. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U82120 mRNA. Translation: AAB61686.1. U82121 mRNA. Translation: AAB61687.1. X99227 mRNA. Translation: CAA67611.1. X99383 mRNA. Translation: CAA67762.1. U76420 mRNA. Translation: AAC51240.1. U76421 mRNA. Translation: AAC51241.1. U76422 mRNA. Translation: AAC51242.1. AF001042 mRNA. Translation: AAB58300.1. AF525422 mRNA. Translation: AAM83100.1. AY135659 mRNA. Translation: AAN10291.1. AB194370 mRNA. Translation: BAE16326.1. AB194371 mRNA. Translation: BAE16327.1. AB194372 mRNA. Translation: BAE16328.1. AL163301 Genomic DNA. Translation: CAB90493.1. AP001579 Genomic DNA. No translation available. CH471079 Genomic DNA. Translation: EAX09359.1. CH471079 Genomic DNA. Translation: EAX09360.1. FJ169505 mRNA. Translation: ACN49026.1. | ||||||||||||
| IPI | IPI00020368. IPI00184874. IPI00334613. IPI00477012. IPI01019091. | ||||||||||||
| RefSeq | NP_001103.1. NM_001112.3. NP_056648.1. NM_015833.3. NP_056649.1. NM_015834.3. | ||||||||||||
| UniGene | Hs.474018. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | P78563. | ||||||||||||
| SMR | P78563. Positions 74-301, 306-740. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | P78563. 1 interaction. | ||||||||||||
| STRING | P78563. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | P78563. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 2829669. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | P78563. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000360697; ENSP00000353920; ENSG00000197381. | ||||||||||||
| GeneID | 104. | ||||||||||||
| KEGG | hsa:104. | ||||||||||||
| UCSC | uc002zgr.2. human. uc002zgt.2. human. uc002zgy.2. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 104. | ||||||||||||
| GeneCards | GC21P046493. | ||||||||||||
| HGNC | HGNC:226. ADARB1. | ||||||||||||
| HPA | HPA018277. HPA029645. | ||||||||||||
| MIM | 601218. gene. | ||||||||||||
| neXtProt | NX_P78563. | ||||||||||||
| PharmGKB | PA24556. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG292433. | ||||||||||||
| GeneTree | ENSGT00550000074412. | ||||||||||||
| HOVERGEN | HBG003836. | ||||||||||||
| InParanoid | P78563. | ||||||||||||
| KO | K13194. | ||||||||||||
| OMA | DEENMSS. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Reactome | REACT_1675. mRNA Processing. REACT_71. Gene Expression. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | P78563. | ||||||||||||
| Bgee | P78563. | ||||||||||||
| Genevestigator | P78563. | ||||||||||||
| GermOnline | ENSG00000197381. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | G3DSA:3.30.160.20. dsRNA-bd-like. 2 hits. | ||||||||||||
| InterPro | IPR002466. A_deamin. IPR008996. Cytokine_IL1-like. IPR001159. Ds-RNA-bd. IPR014720. dsRNA-bd-like. [Graphical view] | ||||||||||||
| Pfam | PF02137. A_deamin. 1 hit. PF00035. dsrm. 2 hits. [Graphical view] | ||||||||||||
| SMART | SM00552. ADEAMc. 1 hit. SM00358. DSRM. 2 hits. [Graphical view] | ||||||||||||
| SUPFAM | SSF50353. Cytok_IL1_like. 1 hit. | ||||||||||||
| PROSITE | PS50141. A_DEAMIN_EDITASE. 1 hit. PS50137. DS_RBD. 2 hits. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| EvolutionaryTrace | P78563. | ||||||||||||
| NextBio | 399. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | RED1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P78563 Secondary accession number(s): A6NFK8 Q8NFD1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 21 Human chromosome 21: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with