P78563 (RED1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 129.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Double-stranded RNA-specific editase 1 EC=3.5.-.- Alternative name(s): RNA-editing deaminase 1 RNA-editing enzyme 1 dsRNA adenosine deaminase | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 741 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Catalyzes the hydrolytic deamination of adenosine to inosine in double-stranded RNA (dsRNA) referred to as A-to-I RNA editing. This may affect gene expression and function in a number of ways that include mRNA translation by changing codons and hence the amino acid sequence of proteins; pre-mRNA splicing by altering splice site recognition sequences; RNA stability by changing sequences involved in nuclease recognition; genetic stability in the case of RNA virus genomes by changing sequences during viral RNA replication; and RNA structure-dependent activities such as microRNA production or targeting or protein-RNA interactions. Can edit both viral and cellular RNAs and can edit RNAs at multiple sites (hyper-editing) or at specific sites (site-specific editing). Its cellular RNA substrates include: bladder cancer-associated protein (BLCAP), neurotransmitter receptors for glutamate (GRIA2 and GRIK2) and serotonin (HTR2C), GABA receptor (GABRA3) and potassium voltage-gated channel (KCNA1). Site-specific RNA editing of transcripts encoding these proteins results in amino acid substitutions which consequently alter their functional activities. Edits GRIA2 at both the Q/R and R/G sites efficiently but converts the adenosine in hotspot1 much less efficiently. Can exert a proviral effect towards human immunodeficiency virus type 1 (HIV-1) and enhances its replication via both an editing-dependent and editing-independent mechanism. The former involves editing of adenosines in the 5'UTR while the latter occurs via suppression of EIF2AK2/PKR activation and function. Can inhibit cell proliferation and migration and can stimulate exocytosis. Ref.11 Ref.15 Ref.18 |
| Cofactor | Binds 1 inositol hexakisphosphate (IP6) per subunit. |
| Subunit structure | Homodimer. Homodimerization is essential for its catalytic activity. Can form heterodimers with isoform 5 of ADAR/ADAR1. Ref.11 |
| Subcellular location | Nucleus. Nucleus › nucleolus. Note: Shuttles between nucleoli and the nucleoplasm. Ref.11 Ref.18 |
| Tissue specificity | Highly expressed in brain and heart and at lower levels in placenta. Fair expression in lung, liver and kidney. Detected in brain, heart, kidney, lung and liver (at protein level). Isoform 5 is high expressed in hippocampus and colon. Isoform 5 is expressed in pediatric astrocytomas and the protein has a decreased RNA-editing activity. The decrease in RNA editing correlates with the grade of malignancy of the tumors, with the high grade tumors showing lower editing is seen. Ref.1 Ref.9 Ref.11 |
| Sequence similarities | Contains 1 A to I editase domain. Contains 2 DRBM (double-stranded RNA-binding) domains. |
Ontologies
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: P78563-1) Also known as: RED1-L; DRADA2B; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: Alu insert from position 465 to 505. Has a lower catalytic activity than isoform 2. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 2 (identifier: P78563-2) Also known as: RED1-S; DRADA2A; The sequence of this isoform differs from the canonical sequence as follows: 466-505: Missing. | ||||||
| Note: Has a higher catalytic activity than isoform 1. | ||||||
| Isoform 3 (identifier: P78563-3) Also known as: DRADA2C; The sequence of this isoform differs from the canonical sequence as follows: 713-741: ARLFTAFIKAGLGAWVEKPTEQDQFSLTP → VH | ||||||
| Isoform 4 (identifier: P78563-4) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MKIPRMKTPCQPDRNSLRQSRNPQKYFA 466-505: Missing. | ||||||
| Isoform 5 (identifier: P78563-5) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MGTFFSVMGRRYKRRRKKRSERKDRNSLRQSRNPQKYFAM 26-741: Missing. | ||||||
| Note: Incomplete sequence. Alternative 5'exon. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 741 | 741 | Double-stranded RNA-specific editase 1 | PRO_0000171779 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 78 – 144 | 67 | DRBM 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 231 – 298 | 68 | DRBM 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 370 – 737 | 368 | A to I editase | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 83 – 88 | 6 | Interaction with substrate RNA By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 104 – 105 | 2 | Interaction with substrate RNA By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 237 – 242 | 6 | Interaction with substrate RNA By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 259 | 1 | Interaction with substrate RNA By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 396 | 1 | Proton donor | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 394 | 1 | Zinc | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 451 | 1 | Zinc | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 556 | 1 | Zinc | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 400 | 1 | Inositol hexakisphosphate | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 401 | 1 | Inositol hexakisphosphate | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 559 | 1 | Inositol hexakisphosphate | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 562 | 1 | Inositol hexakisphosphate | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 669 | 1 | Inositol hexakisphosphate | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 702 | 1 | Inositol hexakisphosphate | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 712 | 1 | Inositol hexakisphosphate | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 730 | 1 | Inositol hexakisphosphate | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 26 | 1 | Phosphoserine Ref.16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MKIPRMKTPCQPDRNSLRQS RNPQKYFA in isoform 4. | VSP_019597 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MGTFFSVMGRRYKRRRKKRS ERKDRNSLRQSRNPQKYFAM in isoform 5. | VSP_041421 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 26 – 741 | 716 | Missing in isoform 5. | VSP_041422 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 466 – 505 | 40 | Missing in isoform 2 and isoform 4. | VSP_000865 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 713 – 741 | 29 | ARLFT…FSLTP → VH in isoform 3. | VSP_000866 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 30 | 1 | G → A in AAB58300. Ref.4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 30 | 1 | G → A in AAM83100. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 30 | 1 | G → A in AAN10291. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 423 | 1 | R → E in AAB58300. Ref.4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 423 | 1 | R → E in AAM83100. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 423 | 1 | R → E in AAN10291. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 475 | 1 | V → L in AAM83100. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 475 | 1 | V → L in AAN10291. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 320 – 338 | 19 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 339 – 343 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 345 – 347 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 352 – 361 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 363 – 365 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 367 – 373 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 380 – 382 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 395 – 416 | 22 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 418 – 423 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 425 – 428 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 432 – 436 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 440 – 448 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 453 – 456 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 521 – 524 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 542 – 546 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 552 – 554 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 556 – 566 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 570 – 574 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 582 – 589 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 593 – 600 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 602 – 604 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 620 – 623 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 637 – 643 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 650 – 653 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 654 – 657 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 669 – 680 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 685 – 687 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 698 – 703 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 706 – 721 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 732 – 735 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Two forms of human double-stranded RNA-specific editase 1 (hRED1) generated by the insertion of an Alu cassette." Gerber A., O'Connell M.A., Keller W. RNA 3:453-463(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY, CATALYTIC ACTIVITY. Tissue: Brain. |
| [2] | "Cloning of a human RNA editing deaminase (ADARB1) of glutamate receptors that maps to chromosome 21q22.3." Mittaz L., Scott H.S., Rossier C., Seeburg P.H., Higuchi M., Antonarakis S.E. Genomics 41:210-217(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). Tissue: Fetal brain. |
| [3] | "Editing of glutamate receptor B subunit ion channel RNAs by four alternatively spliced DRADA2 double-stranded RNA adenosine deaminases." Lai F., Chen C.-X., Carter K.C., Nishikura K. Mol. Cell. Biol. 17:2413-2424(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3). |
| [4] | "Map location, genomic organization and expression patterns of the human RED1 RNA editase." Villard L., Tassone F., Haymowicz M., Welborn R., Gardiner K. Somat. Cell Mol. Genet. 23:135-145(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [5] | "Phylogenetic comparison of the pre-mRNA adenosine deaminase ADAR2 genes and transcripts: conservation and diversity in editing site sequence and alternative splicing patterns." Slavov D., Gardiner K. Gene 299:83-94(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4). |
| [6] | "Novel splice variants of human ADAR2 mRNA: skipping of the exon encoding the dsRNA-binding domains, and multiple C-terminal splice sites." Kawahara Y., Ito K., Ito M., Tsuji S., Kwak S. Gene 363:193-201(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [7] | "The DNA sequence of human chromosome 21." Hattori M., Fujiyama A., Taylor T.D., Watanabe H., Yada T., Park H.-S., Toyoda A., Ishii K., Totoki Y., Choi D.-K., Groner Y., Soeda E., Ohki M., Takagi T., Sakaki Y., Taudien S., Blechschmidt K., Polley A. Yaspo M.-L.Nature 405:311-319(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | "Novel exon of mammalian ADAR2 extends open reading frame." Maas S., Gommans W.M. PLoS ONE 4:E4225-E4225(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), TISSUE SPECIFICITY. |
| [10] | "An unappreciated role for RNA surveillance." Hillman R.T., Green R.E., Brenner S.E. Genome Biol. 5:R8.1-R8.16(2004) [PubMed] [Europe PMC] [Abstract] Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S). |
| [11] | "Down-regulation of RNA editing in pediatric astrocytomas: ADAR2 editing activity inhibits cell migration and proliferation." Cenci C., Barzotti R., Galeano F., Corbelli S., Rota R., Massimi L., Di Rocco C., O'Connell M.A., Gallo A. J. Biol. Chem. 283:7251-7260(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBUNIT, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [12] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [13] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Leukemic T-cell. |
| [14] | "Functions and regulation of RNA editing by ADAR deaminases." Nishikura K. Annu. Rev. Biochem. 79:321-349(2010) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW. |
| [15] | "Human BLCAP transcript: new editing events in normal and cancerous tissues." Galeano F., Leroy A., Rossetti C., Gromova I., Gautier P., Keegan L.P., Massimi L., Di Rocco C., O'Connell M.A., Gallo A. Int. J. Cancer 127:127-137(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [16] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-26, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [17] | "RNA editing catalyzed by ADAR1 and its function in mammalian cells." Wang Q. Biokhimiia 76:900-911(2011) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW. |
| [18] | "ADAR2 editing enzyme is a novel human immunodeficiency virus-1 proviral factor." Doria M., Tomaselli S., Neri F., Ciafre S.A., Farace M.G., Michienzi A., Gallo A. J. Gen. Virol. 92:1228-1232(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION. |
| [19] | "Adenosine deaminases acting on RNA, RNA editing, and interferon action." George C.X., Gan Z., Liu Y., Samuel C.E. J. Interferon Cytokine Res. 31:99-117(2011) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW. |
| [20] | "Adenosine deaminases acting on RNA (ADARs) are both antiviral and proviral." Samuel C.E. Virology 411:180-193(2011) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW. |
| [21] | "A-to-I editing of protein coding and noncoding RNAs." Mallela A., Nishikura K. Crit. Rev. Biochem. Mol. Biol. 47:493-501(2012) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW. |
| [22] | "ADAR proteins: structure and catalytic mechanism." Goodman R.A., Macbeth M.R., Beal P.A. Curr. Top. Microbiol. Immunol. 353:1-33(2012) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW. |
| [23] | "Activity regulation of adenosine deaminases acting on RNA (ADARs)." Orlandi C., Barbon A., Barlati S. Mol. Neurobiol. 45:61-75(2012) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW. |
| [24] | "Inositol hexakisphosphate is bound in the ADAR2 core and required for RNA editing." Macbeth M.R., Schubert H.L., Vandemark A.P., Lingam A.T., Hill C.P., Bass B.L. Science 309:1534-1539(2005) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.7 ANGSTROMS) OF 299-741 IN COMPLEX WITH IP6. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U82120 mRNA. Translation: AAB61686.1. U82121 mRNA. Translation: AAB61687.1. X99227 mRNA. Translation: CAA67611.1. X99383 mRNA. Translation: CAA67762.1. U76420 mRNA. Translation: AAC51240.1. U76421 mRNA. Translation: AAC51241.1. U76422 mRNA. Translation: AAC51242.1. AF001042 mRNA. Translation: AAB58300.1. AF525422 mRNA. Translation: AAM83100.1. AY135659 mRNA. Translation: AAN10291.1. AB194370 mRNA. Translation: BAE16326.1. AB194371 mRNA. Translation: BAE16327.1. AB194372 mRNA. Translation: BAE16328.1. AL163301 Genomic DNA. Translation: CAB90493.1. AP001579 Genomic DNA. No translation available. CH471079 Genomic DNA. Translation: EAX09359.1. CH471079 Genomic DNA. Translation: EAX09360.1. FJ169505 mRNA. Translation: ACN49026.1. | ||||||||||||
| IPI | IPI00020368. IPI00184874. IPI00334613. IPI00477012. IPI01019091. | ||||||||||||
| RefSeq | NP_001103.1. NM_001112.3. NP_056648.1. NM_015833.3. NP_056649.1. NM_015834.3. | ||||||||||||
| UniGene | Hs.474018. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | P78563. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | P78563. 1 interaction. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | P78563. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 2829669. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | P78563. | ||||||||||||
| PRIDE | P78563. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000348831; ENSP00000015877; ENSG00000197381. ENST00000360697; ENSP00000353920; ENSG00000197381. ENST00000389863; ENSP00000374513; ENSG00000197381. ENST00000492414; ENSP00000436367; ENSG00000197381. ENST00000496664; ENSP00000435381; ENSG00000197381. ENST00000539173; ENSP00000441897; ENSG00000197381. | ||||||||||||
| GeneID | 104. | ||||||||||||
| KEGG | hsa:104. | ||||||||||||
| UCSC | uc002zgr.2. human. uc002zgt.2. human. uc002zgy.2. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 104. | ||||||||||||
| GeneCards | GC21P046493. | ||||||||||||
| HGNC | HGNC:226. ADARB1. | ||||||||||||
| HPA | HPA018277. HPA029645. | ||||||||||||
| MIM | 601218. gene. | ||||||||||||
| neXtProt | NX_P78563. | ||||||||||||
| PharmGKB | PA24556. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG292433. | ||||||||||||
| HOVERGEN | HBG003836. | ||||||||||||
| InParanoid | P78563. | ||||||||||||
| KO | K13194. | ||||||||||||
| OMA | PPLYTLN. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Reactome | REACT_1675. mRNA Processing. REACT_71. Gene Expression. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | P78563. | ||||||||||||
| Bgee | P78563. | ||||||||||||
| Genevestigator | P78563. | ||||||||||||
| GermOnline | ENSG00000197381. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 3.30.160.20. 2 hits. | ||||||||||||
| InterPro | IPR002466. A_deamin. IPR008996. Cytokine_IL1-like. IPR001159. Ds-RNA-bd. IPR014720. dsRNA-bd-like_dom. [Graphical view] | ||||||||||||
| Pfam | PF02137. A_deamin. 1 hit. PF00035. dsrm. 2 hits. [Graphical view] | ||||||||||||
| SMART | SM00552. ADEAMc. 1 hit. SM00358. DSRM. 2 hits. [Graphical view] | ||||||||||||
| SUPFAM | SSF50353. Cytok_IL1_like. 1 hit. | ||||||||||||
| PROSITE | PS50141. A_DEAMIN_EDITASE. 1 hit. PS50137. DS_RBD. 2 hits. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| EvolutionaryTrace | P78563. | ||||||||||||
| GenomeRNAi | 104. | ||||||||||||
| NextBio | 399. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | RED1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P78563 Secondary accession number(s): A6NFK8 Q8NFD1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 21 Human chromosome 21: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
