Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sushi repeat-containing protein SRPX

Gene

SRPX

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May be involved in phagocytosis during disk shedding, cell adhesion to cells other than the pigment epithelium or signal transduction.

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Cell adhesion

Enzyme and pathway databases

BioCyciZFISH:ENSG00000101955-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Sushi repeat-containing protein SRPX
Gene namesi
Name:SRPX
Synonyms:ETX1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

HGNCiHGNC:11309. SRPX.

Subcellular locationi

  • Cell surface Curated

  • Note: Possibly surface of photoreceptor cell.

GO - Cellular componenti

  • autophagosome Source: Ensembl
  • cell surface Source: UniProtKB-SubCell
  • endoplasmic reticulum Source: Ensembl
  • membrane Source: ProtInc
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

DisGeNETi8406.
OpenTargetsiENSG00000101955.
PharmGKBiPA36133.

Polymorphism and mutation databases

BioMutaiSRPX.
DMDMi2498958.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 30Sequence analysisAdd BLAST30
ChainiPRO_000002241631 – 464Sushi repeat-containing protein SRPXAdd BLAST434

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi57 ↔ 85PROSITE-ProRule annotation
Disulfide bondi69 ↔ 103PROSITE-ProRule annotation
Disulfide bondi89 ↔ 115PROSITE-ProRule annotation
Disulfide bondi120 ↔ 161PROSITE-ProRule annotation
Disulfide bondi147 ↔ 174PROSITE-ProRule annotation
Disulfide bondi262 ↔ 304PROSITE-ProRule annotation
Disulfide bondi290 ↔ 317PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond

Proteomic databases

PaxDbiP78539.
PeptideAtlasiP78539.
PRIDEiP78539.

PTM databases

iPTMnetiP78539.
PhosphoSitePlusiP78539.

Expressioni

Tissue specificityi

Retina and heart; less in placenta, pancreas, lung, liver, skeletal muscle, kidney and brain.

Gene expression databases

BgeeiENSG00000101955.
CleanExiHS_SRPX.
GenevisibleiP78539. HS.

Organism-specific databases

HPAiHPA001256.

Interactioni

Protein-protein interaction databases

BioGridi113994. 3 interactors.
IntActiP78539. 4 interactors.
STRINGi9606.ENSP00000367794.

Structurei

3D structure databases

ProteinModelPortaliP78539.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini57 – 117Sushi 1PROSITE-ProRule annotationAdd BLAST61
Domaini118 – 176Sushi 2PROSITE-ProRule annotationAdd BLAST59
Domaini177 – 259HYRPROSITE-ProRule annotationAdd BLAST83
Domaini260 – 319Sushi 3PROSITE-ProRule annotationAdd BLAST60

Sequence similaritiesi

Contains 1 HYR domain.PROSITE-ProRule annotation
Contains 3 Sushi (CCP/SCR) domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal, Sushi

Phylogenomic databases

eggNOGiENOG410IEWW. Eukaryota.
ENOG410XP80. LUCA.
GeneTreeiENSGT00730000110685.
HOGENOMiHOG000232093.
HOVERGENiHBG007217.
InParanoidiP78539.
OMAiRVRRCGK.
OrthoDBiEOG091G045R.
PhylomeDBiP78539.
TreeFamiTF336515.

Family and domain databases

CDDicd00033. CCP. 3 hits.
InterProiIPR025232. DUF4174.
IPR003410. HYR_dom.
IPR000436. Sushi_SCR_CCP_dom.
[Graphical view]
PfamiPF13778. DUF4174. 1 hit.
PF02494. HYR. 1 hit.
PF00084. Sushi. 3 hits.
[Graphical view]
SMARTiSM00032. CCP. 3 hits.
[Graphical view]
SUPFAMiSSF57535. SSF57535. 3 hits.
PROSITEiPS50825. HYR. 1 hit.
PS50923. SUSHI. 3 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: P78539-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGSPAHRPAL LLLLPPLLLL LLLRVPPSRS FPGSGDSPLE DDEVGYSHPR
60 70 80 90 100
YKDTPWCSPI KVKYGDVYCR APQGGYYKTA LGTRCDIRCQ KGYELHGSSL
110 120 130 140 150
LICQSNKRWS DKVICKQKRC PTLAMPANGG FKCVDGAYFN SRCEYYCSPG
160 170 180 190 200
YTLKGERTVT CMDNKAWSGR PASCVDMEPP RIKCPSVKER IAEPNKLTVR
210 220 230 240 250
VSWETPEGRD TADGILTDVI LKGLPPGSNF PEGDHKIQYT VYDRAENKGT
260 270 280 290 300
CKFRVKVRVK RCGKLNAPEN GYMKCSSDGD NYGATCEFSC IGGYELQGSP
310 320 330 340 350
ARVCQSNLAW SGTEPTCAAM NVNVGVRTAA ALLDQFYEKR RLLIVSTPTA
360 370 380 390 400
RNLLYRLQLG MLQQAQCGLD LRHITVVELV GVFPTLIGRI GAKIMPPALA
410 420 430 440 450
LQLRLLLRIP LYSFSMVLVD KHGMDKERYV SLVMPVALFN LIDTFPLRKE
460
EMVLQAEMSQ TCNT
Length:464
Mass (Da):51,572
Last modified:May 1, 1997 - v1
Checksum:i9CD5E57BC2848680
GO
Isoform 2 (identifier: P78539-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: MGSPAHRPAL...EVGYSHPRYK → MDFDVGRTTH...RRCLIGESGH

Show »
Length:451
Mass (Da):49,934
Checksum:iAAE97A096B950609
GO
Isoform 3 (identifier: P78539-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     117-176: QKRCPTLAMPANGGFKCVDGAYFNSRCEYYCSPGYTLKGERTVTCMDNKAWSGRPASCVD → H

Note: No experimental confirmation available.
Show »
Length:405
Mass (Da):45,121
Checksum:iC8C21CD2E06B7BA8
GO
Isoform 4 (identifier: P78539-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     364-464: QAQCGLDLRH...QAEMSQTCNT → AVAANPTLLLQYGASG

Note: No experimental confirmation available.
Show »
Length:379
Mass (Da):41,750
Checksum:i27FFD6B0F84D18A2
GO
Isoform 5 (identifier: P78539-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     33-52: Missing.

Show »
Length:444
Mass (Da):49,382
Checksum:i369E18F51CECE377
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti170 – 178RPASCVDME → ASLLCGYG in AAB40715 (PubMed:9162095).Curated9
Sequence conflicti202Missing in AAB40715 (PubMed:9162095).Curated1
Sequence conflicti242Y → H in BAG54210 (PubMed:14702039).Curated1
Sequence conflicti292G → S in BAF82119 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_00562423Missing .3 Publications1
Natural variantiVAR_005625225P → S.1 PublicationCorresponds to variant rs1123773dbSNPEnsembl.1
Natural variantiVAR_005626413S → F.1 PublicationCorresponds to variant rs35318931dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0044301 – 52MGSPA…HPRYK → MDFDVGRTTHLSSSPCSASN GGESGQVSKRRCLIGESGH in isoform 2. CuratedAdd BLAST52
Alternative sequenceiVSP_04675733 – 52Missing in isoform 5. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_043056117 – 176QKRCP…ASCVD → H in isoform 3. 1 PublicationAdd BLAST60
Alternative sequenceiVSP_045468364 – 464QAQCG…QTCNT → AVAANPTLLLQYGASG in isoform 4. 1 PublicationAdd BLAST101

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U78093 mRNA. Translation: AAB36685.1.
S82496 Genomic DNA. Translation: AAB37378.1.
S82496 Genomic DNA. Translation: AAB37379.1.
AK125542 mRNA. Translation: BAG54210.1.
U61374 mRNA. Translation: AAB40715.1.
AK289430 mRNA. Translation: BAF82119.1.
AK293127 mRNA. Translation: BAG56679.1.
AK298802 mRNA. Translation: BAG60937.1.
AL606748
, AL121578, AL133494, AL627246 Genomic DNA. Translation: CAI95406.1.
CH471141 Genomic DNA. Translation: EAW59447.1.
BC020684 mRNA. Translation: AAH20684.1.
CCDSiCCDS14245.1. [P78539-1]
CCDS55400.1. [P78539-5]
CCDS55401.1. [P78539-3]
CCDS55402.1. [P78539-4]
RefSeqiNP_001164221.1. NM_001170750.1. [P78539-5]
NP_001164222.1. NM_001170751.1. [P78539-3]
NP_001164223.1. NM_001170752.1. [P78539-4]
NP_006298.1. NM_006307.4. [P78539-1]
UniGeneiHs.15154.

Genome annotation databases

EnsembliENST00000378533; ENSP00000367794; ENSG00000101955. [P78539-1]
ENST00000432886; ENSP00000411165; ENSG00000101955. [P78539-3]
ENST00000538295; ENSP00000445034; ENSG00000101955. [P78539-4]
ENST00000544439; ENSP00000440758; ENSG00000101955. [P78539-5]
GeneIDi8406.
KEGGihsa:8406.
UCSCiuc004ddy.3. human. [P78539-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U78093 mRNA. Translation: AAB36685.1.
S82496 Genomic DNA. Translation: AAB37378.1.
S82496 Genomic DNA. Translation: AAB37379.1.
AK125542 mRNA. Translation: BAG54210.1.
U61374 mRNA. Translation: AAB40715.1.
AK289430 mRNA. Translation: BAF82119.1.
AK293127 mRNA. Translation: BAG56679.1.
AK298802 mRNA. Translation: BAG60937.1.
AL606748
, AL121578, AL133494, AL627246 Genomic DNA. Translation: CAI95406.1.
CH471141 Genomic DNA. Translation: EAW59447.1.
BC020684 mRNA. Translation: AAH20684.1.
CCDSiCCDS14245.1. [P78539-1]
CCDS55400.1. [P78539-5]
CCDS55401.1. [P78539-3]
CCDS55402.1. [P78539-4]
RefSeqiNP_001164221.1. NM_001170750.1. [P78539-5]
NP_001164222.1. NM_001170751.1. [P78539-3]
NP_001164223.1. NM_001170752.1. [P78539-4]
NP_006298.1. NM_006307.4. [P78539-1]
UniGeneiHs.15154.

3D structure databases

ProteinModelPortaliP78539.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113994. 3 interactors.
IntActiP78539. 4 interactors.
STRINGi9606.ENSP00000367794.

PTM databases

iPTMnetiP78539.
PhosphoSitePlusiP78539.

Polymorphism and mutation databases

BioMutaiSRPX.
DMDMi2498958.

Proteomic databases

PaxDbiP78539.
PeptideAtlasiP78539.
PRIDEiP78539.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000378533; ENSP00000367794; ENSG00000101955. [P78539-1]
ENST00000432886; ENSP00000411165; ENSG00000101955. [P78539-3]
ENST00000538295; ENSP00000445034; ENSG00000101955. [P78539-4]
ENST00000544439; ENSP00000440758; ENSG00000101955. [P78539-5]
GeneIDi8406.
KEGGihsa:8406.
UCSCiuc004ddy.3. human. [P78539-1]

Organism-specific databases

CTDi8406.
DisGeNETi8406.
GeneCardsiSRPX.
HGNCiHGNC:11309. SRPX.
HPAiHPA001256.
MIMi300187. gene.
neXtProtiNX_P78539.
OpenTargetsiENSG00000101955.
PharmGKBiPA36133.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IEWW. Eukaryota.
ENOG410XP80. LUCA.
GeneTreeiENSGT00730000110685.
HOGENOMiHOG000232093.
HOVERGENiHBG007217.
InParanoidiP78539.
OMAiRVRRCGK.
OrthoDBiEOG091G045R.
PhylomeDBiP78539.
TreeFamiTF336515.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000101955-MONOMER.

Miscellaneous databases

GeneWikiiSRPX.
GenomeRNAii8406.
PROiP78539.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000101955.
CleanExiHS_SRPX.
GenevisibleiP78539. HS.

Family and domain databases

CDDicd00033. CCP. 3 hits.
InterProiIPR025232. DUF4174.
IPR003410. HYR_dom.
IPR000436. Sushi_SCR_CCP_dom.
[Graphical view]
PfamiPF13778. DUF4174. 1 hit.
PF02494. HYR. 1 hit.
PF00084. Sushi. 3 hits.
[Graphical view]
SMARTiSM00032. CCP. 3 hits.
[Graphical view]
SUPFAMiSSF57535. SSF57535. 3 hits.
PROSITEiPS50825. HYR. 1 hit.
PS50923. SUSHI. 3 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSRPX_HUMAN
AccessioniPrimary (citable) accession number: P78539
Secondary accession number(s): A8K065
, B3KWP8, B4DDB8, B4DQH5, F5H4D7, G3V1L0, Q4VX66, Q99652, Q99913
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: May 1, 1997
Last modified: November 30, 2016
This is version 145 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.