P78382 (S35A1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 116.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: CMP-sialic acid transporter Short name=CMP-SA-Tr Short name=CMP-Sia-Tr Alternative name(s): Solute carrier family 35 member A1 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 337 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Transports CMP-sialic acid from the cytosol into Golgi vesicles where glycosyltransferases function. |
| Subcellular location | |
| Involvement in disease | Congenital disorder of glycosylation 2F (CDG2F) [MIM:603585]: CDGs are a family of severe inherited diseases caused by a defect in protein N-glycosylation. They are characterized by under-glycosylated serum proteins. These multisystem disorders present with a wide variety of clinical features, such as disorders of the nervous system development, psychomotor retardation, dysmorphic features, hypotonia, coagulation disorders, and immunodeficiency. The broad spectrum of features reflects the critical role of N-glycoproteins during embryonic development, differentiation, and maintenance of cell functions. |
| Sequence similarities | Belongs to the nucleotide-sugar transporter family. SLC35A subfamily. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Sugar transport Transport |
| Cellular component | Golgi apparatus Membrane |
| Coding sequence diversity | Alternative splicing |
| Disease | Congenital disorder of glycosylation |
| Domain | Transmembrane Transmembrane helix |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | carbohydrate metabolic process Traceable author statement PubMed 9644260. Source: ProtInc cellular protein modification processTraceable author statement PubMed 9644260. Source: ProtInc |
| Cellular_component | Golgi membrane Traceable author statement. Source: Reactome integral to plasma membraneTraceable author statement PubMed 9644260. Source: ProtInc |
| Molecular_function | CMP-N-acetylneuraminate transmembrane transporter activity Traceable author statement PubMed 9644260. Source: ProtInc sugar:hydrogen symporter activityInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P78382-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P78382-2) The sequence of this isoform differs from the canonical sequence as follows: 192-251: GVYFEKVLKSSDTSLWVRNIQMYLSGIIVTLAGVYLSDGAEIKEKGFFYGYTYYVWFVIF → V | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 337 | 337 | CMP-sialic acid transporter | PRO_0000213351 | |||||
Regions | |||||||||
| Topological domain | 1 – 9 | 9 | Cytoplasmic Potential | ||||||
| Transmembrane | 10 – 30 | 21 | Helical; Potential | ||||||
| Topological domain | 31 – 45 | 15 | Lumenal Potential | ||||||
| Transmembrane | 46 – 64 | 19 | Helical; Potential | ||||||
| Topological domain | 65 – 87 | 23 | Cytoplasmic Potential | ||||||
| Transmembrane | 88 – 108 | 21 | Helical; Potential | ||||||
| Topological domain | 109 – 113 | 5 | Lumenal Potential | ||||||
| Transmembrane | 114 – 135 | 22 | Helical; Potential | ||||||
| Topological domain | 136 – 141 | 6 | Cytoplasmic Potential | ||||||
| Transmembrane | 142 – 160 | 19 | Helical; Potential | ||||||
| Topological domain | 161 – 175 | 15 | Lumenal Potential | ||||||
| Transmembrane | 176 – 196 | 21 | Helical; Potential | ||||||
| Topological domain | 197 – 212 | 16 | Cytoplasmic Potential | ||||||
| Transmembrane | 213 – 228 | 16 | Helical; Potential | ||||||
| Topological domain | 229 – 243 | 15 | Lumenal Potential | ||||||
| Transmembrane | 244 – 262 | 19 | Helical; Potential | ||||||
| Topological domain | 263 – 272 | 10 | Cytoplasmic Potential | ||||||
| Transmembrane | 273 – 291 | 19 | Helical; Potential | ||||||
| Topological domain | 292 – 296 | 5 | Lumenal Potential | ||||||
| Transmembrane | 297 – 315 | 19 | Helical; Potential | ||||||
| Topological domain | 316 – 337 | 22 | Cytoplasmic Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 192 – 251 | 60 | GVYFE…WFVIF → V in isoform 2. | VSP_042916 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and characterization of a novel isoform of the human UDP-galactose transporter, and of related complementary DNAs belonging to the nucleotide-sugar transporter gene family." Ishida N., Miura N., Yoshioka S., Kawakita M. J. Biochem. 120:1074-1078(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Liver. |
| [2] | "Genetic complementation reveals a novel human congenital disorder of glycosylation of type II, due to inactivation of the Golgi CMP-sialic acid transporter." Martinez-Duncker I., Dupre T., Piller V., Piller F., Candelier J.-J., Trichet C., Tchernia G., Oriol R., Mollicone R. Blood 105:2671-2676(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), INVOLVEMENT IN CDG2F. |
| [3] | "The DNA sequence and analysis of human chromosome 6." Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. Beck S.Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Lung. |
| + | Additional computationally mapped references. |
Web resources
| GGDB GlycoGene database |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | D87969 mRNA. Translation: BAA13522.1. AJ851888 mRNA. Translation: CAH65468.1. AL049697 Genomic DNA. Translation: CAB76857.1. BC017807 mRNA. Translation: AAH17807.1. |
| IPI | IPI00478254. IPI00746093. |
| PIR | JC5023. |
| RefSeq | NP_001161870.1. NM_001168398.1. NP_006407.1. NM_006416.4. |
| UniGene | Hs.423163. |
3D structure databases | |
| ProteinModelPortal | P78382. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000358565. |
Protein family/group databases | |
| TCDB | 2.A.7.12.11. drug/metabolite transporter (DMT) superfamily. |
Polymorphism databases | |
| DMDM | 2499226. |
Proteomic databases | |
| PaxDb | P78382. |
| PRIDE | P78382. |
Protocols and materials databases | |
| DNASU | 10559. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000369552; ENSP00000358565; ENSG00000164414. ENST00000369556; ENSP00000358569; ENSG00000164414. |
| GeneID | 10559. |
| KEGG | hsa:10559. |
| UCSC | uc011dzi.2. human. |
Organism-specific databases | |
| CTD | 10559. |
| GeneCards | GC06P088180. |
| HGNC | HGNC:11021. SLC35A1. |
| MIM | 603585. phenotype. 605634. gene. |
| neXtProt | NX_P78382. |
| Orphanet | 238459. CDG syndrome type IIf. |
| PharmGKB | PA35889. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0697. |
| HOGENOM | HOG000216649. |
| HOVERGEN | HBG054025. |
| InParanoid | P78382. |
| KO | K15272. |
| OMA | GSPKELM. |
| OrthoDB | EOG451DR4. |
| PhylomeDB | P78382. |
Enzyme and pathway databases | |
| Reactome | REACT_15518. Transmembrane transport of small molecules. |
Gene expression databases | |
| ArrayExpress | P78382. |
| Bgee | P78382. |
| CleanEx | HS_SLC35A1. |
| Genevestigator | P78382. |
| GermOnline | ENSG00000164414. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR007271. Nuc_sug_transpt. IPR021189. UDP/CMP-sugar_transptr. IPR004689. UDPgal_transpt. [Graphical view] |
| PANTHER | PTHR10231. PTHR10231. 1 hit. |
| Pfam | PF04142. Nuc_sug_transp. 1 hit. [Graphical view] |
| PIRSF | PIRSF005799. UDP-gal_transpt. 1 hit. |
| TIGRFAMs | TIGR00803. nst. 1 hit. |
| ProtoNet | Search... |
Other | |
| ChiTaRS | SLC35A1. human. |
| GenomeRNAi | 10559. |
| NextBio | 40073. |
| SOURCE | Search... |
Entry information
| Entry name | S35A1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P78382 Secondary accession number(s): Q5W1L8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
