Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

CMP-sialic acid transporter

Gene

SLC35A1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Transports CMP-sialic acid from the cytosol into Golgi vesicles where glycosyltransferases function.

GO - Molecular functioni

  • CMP-N-acetylneuraminate transmembrane transporter activity Source: ProtInc
  • sugar:proton symporter activity Source: InterPro

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Sugar transport, Transport

Enzyme and pathway databases

ReactomeiREACT_22151. Transport of nucleotide sugars.
REACT_264366. Sialic acid metabolism.

Protein family/group databases

TCDBi2.A.7.12.11. the drug/metabolite transporter (dmt) superfamily.

Names & Taxonomyi

Protein namesi
Recommended name:
CMP-sialic acid transporter
Short name:
CMP-SA-Tr
Short name:
CMP-Sia-Tr
Alternative name(s):
Solute carrier family 35 member A1
Gene namesi
Name:SLC35A1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:11021. SLC35A1.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 99CytoplasmicSequence Analysis
Transmembranei10 – 3021HelicalSequence AnalysisAdd
BLAST
Topological domaini31 – 4515LumenalSequence AnalysisAdd
BLAST
Transmembranei46 – 6419HelicalSequence AnalysisAdd
BLAST
Topological domaini65 – 8723CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei88 – 10821HelicalSequence AnalysisAdd
BLAST
Topological domaini109 – 1135LumenalSequence Analysis
Transmembranei114 – 13522HelicalSequence AnalysisAdd
BLAST
Topological domaini136 – 1416CytoplasmicSequence Analysis
Transmembranei142 – 16019HelicalSequence AnalysisAdd
BLAST
Topological domaini161 – 17515LumenalSequence AnalysisAdd
BLAST
Transmembranei176 – 19621HelicalSequence AnalysisAdd
BLAST
Topological domaini197 – 21216CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei213 – 22816HelicalSequence AnalysisAdd
BLAST
Topological domaini229 – 24315LumenalSequence AnalysisAdd
BLAST
Transmembranei244 – 26219HelicalSequence AnalysisAdd
BLAST
Topological domaini263 – 27210CytoplasmicSequence Analysis
Transmembranei273 – 29119HelicalSequence AnalysisAdd
BLAST
Topological domaini292 – 2965LumenalSequence Analysis
Transmembranei297 – 31519HelicalSequence AnalysisAdd
BLAST
Topological domaini316 – 33722CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  • Golgi apparatus Source: ProtInc
  • Golgi membrane Source: Reactome
  • integral component of plasma membrane Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Golgi apparatus, Membrane

Pathology & Biotechi

Involvement in diseasei

Congenital disorder of glycosylation 2F (CDG2F)1 Publication

The disease is caused by mutations affecting the gene represented in this entry.

Disease descriptionCDGs are a family of severe inherited diseases caused by a defect in protein N-glycosylation. They are characterized by under-glycosylated serum proteins. These multisystem disorders present with a wide variety of clinical features, such as disorders of the nervous system development, psychomotor retardation, dysmorphic features, hypotonia, coagulation disorders, and immunodeficiency. The broad spectrum of features reflects the critical role of N-glycoproteins during embryonic development, differentiation, and maintenance of cell functions.

See also OMIM:603585

Keywords - Diseasei

Congenital disorder of glycosylation

Organism-specific databases

MIMi603585. phenotype.
Orphaneti238459. SLC35A1-CDG.
PharmGKBiPA35889.

Polymorphism and mutation databases

BioMutaiSLC35A1.
DMDMi2499226.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 337337CMP-sialic acid transporterPRO_0000213351Add
BLAST

Proteomic databases

MaxQBiP78382.
PaxDbiP78382.
PRIDEiP78382.

Expressioni

Gene expression databases

BgeeiP78382.
CleanExiHS_SLC35A1.
ExpressionAtlasiP78382. baseline.
GenevisibleiP78382. HS.

Interactioni

Protein-protein interaction databases

BioGridi115810. 2 interactions.
STRINGi9606.ENSP00000358565.

Structurei

3D structure databases

ProteinModelPortaliP78382.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0697.
GeneTreeiENSGT00550000074563.
HOGENOMiHOG000216649.
HOVERGENiHBG054025.
InParanoidiP78382.
KOiK15272.
OMAiRNIQLYL.
OrthoDBiEOG7NCV4D.
PhylomeDBiP78382.
TreeFamiTF315345.

Family and domain databases

InterProiIPR007271. Nuc_sug_transpt.
IPR021189. UDP/CMP-sugar_transptr.
IPR004689. UDPgal_transpt.
[Graphical view]
PANTHERiPTHR10231. PTHR10231. 1 hit.
PfamiPF04142. Nuc_sug_transp. 1 hit.
[Graphical view]
PIRSFiPIRSF005799. UDP-gal_transpt. 1 hit.
TIGRFAMsiTIGR00803. nst. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P78382-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAPRDNVTL LFKLYCLAVM TLMAAVYTIA LRYTRTSDKE LYFSTTAVCI
60 70 80 90 100
TEVIKLLLSV GILAKETGSL GRFKASLREN VLGSPKELLK LSVPSLVYAV
110 120 130 140 150
QNNMAFLALS NLDAAVYQVT YQLKIPCTAL CTVLMLNRTL SKLQWVSVFM
160 170 180 190 200
LCAGVTLVQW KPAQATKVVV EQNPLLGFGA IAIAVLCSGF AGVYFEKVLK
210 220 230 240 250
SSDTSLWVRN IQMYLSGIIV TLAGVYLSDG AEIKEKGFFY GYTYYVWFVI
260 270 280 290 300
FLASVGGLYT SVVVKYTDNI MKGFSAAAAI VLSTIASVML FGLQITLTFA
310 320 330
LGTLLVCVSI YLYGLPRQDT TSIQQGETAS KERVIGV
Length:337
Mass (Da):36,779
Last modified:May 1, 1997 - v1
Checksum:i508DD77F5EEBB5A7
GO
Isoform 2 (identifier: P78382-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     192-251: GVYFEKVLKSSDTSLWVRNIQMYLSGIIVTLAGVYLSDGAEIKEKGFFYGYTYYVWFVIF → V

Note: No experimental confirmation available.
Show »
Length:278
Mass (Da):29,919
Checksum:iCA0BD6699B9F97B0
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei192 – 25160GVYFE…WFVIF → V in isoform 2. 1 PublicationVSP_042916Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D87969 mRNA. Translation: BAA13522.1.
AJ851888 mRNA. Translation: CAH65468.1.
AL049697 Genomic DNA. Translation: CAB76857.1.
BC017807 mRNA. Translation: AAH17807.1.
CCDSiCCDS5010.1. [P78382-1]
CCDS55043.1. [P78382-2]
PIRiJC5023.
RefSeqiNP_001161870.1. NM_001168398.1. [P78382-2]
NP_006407.1. NM_006416.4. [P78382-1]
UniGeneiHs.423163.

Genome annotation databases

EnsembliENST00000369552; ENSP00000358565; ENSG00000164414.
ENST00000369556; ENSP00000358569; ENSG00000164414. [P78382-2]
GeneIDi10559.
KEGGihsa:10559.
UCSCiuc010kbx.3. human. [P78382-2]
uc011dzi.2. human. [P78382-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Web resourcesi

GGDB

GlycoGene database

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D87969 mRNA. Translation: BAA13522.1.
AJ851888 mRNA. Translation: CAH65468.1.
AL049697 Genomic DNA. Translation: CAB76857.1.
BC017807 mRNA. Translation: AAH17807.1.
CCDSiCCDS5010.1. [P78382-1]
CCDS55043.1. [P78382-2]
PIRiJC5023.
RefSeqiNP_001161870.1. NM_001168398.1. [P78382-2]
NP_006407.1. NM_006416.4. [P78382-1]
UniGeneiHs.423163.

3D structure databases

ProteinModelPortaliP78382.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115810. 2 interactions.
STRINGi9606.ENSP00000358565.

Protein family/group databases

TCDBi2.A.7.12.11. the drug/metabolite transporter (dmt) superfamily.

Polymorphism and mutation databases

BioMutaiSLC35A1.
DMDMi2499226.

Proteomic databases

MaxQBiP78382.
PaxDbiP78382.
PRIDEiP78382.

Protocols and materials databases

DNASUi10559.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000369552; ENSP00000358565; ENSG00000164414.
ENST00000369556; ENSP00000358569; ENSG00000164414. [P78382-2]
GeneIDi10559.
KEGGihsa:10559.
UCSCiuc010kbx.3. human. [P78382-2]
uc011dzi.2. human. [P78382-1]

Organism-specific databases

CTDi10559.
GeneCardsiGC06P088180.
HGNCiHGNC:11021. SLC35A1.
MIMi603585. phenotype.
605634. gene.
neXtProtiNX_P78382.
Orphaneti238459. SLC35A1-CDG.
PharmGKBiPA35889.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG0697.
GeneTreeiENSGT00550000074563.
HOGENOMiHOG000216649.
HOVERGENiHBG054025.
InParanoidiP78382.
KOiK15272.
OMAiRNIQLYL.
OrthoDBiEOG7NCV4D.
PhylomeDBiP78382.
TreeFamiTF315345.

Enzyme and pathway databases

ReactomeiREACT_22151. Transport of nucleotide sugars.
REACT_264366. Sialic acid metabolism.

Miscellaneous databases

ChiTaRSiSLC35A1. human.
GenomeRNAii10559.
NextBioi40073.
PROiP78382.
SOURCEiSearch...

Gene expression databases

BgeeiP78382.
CleanExiHS_SLC35A1.
ExpressionAtlasiP78382. baseline.
GenevisibleiP78382. HS.

Family and domain databases

InterProiIPR007271. Nuc_sug_transpt.
IPR021189. UDP/CMP-sugar_transptr.
IPR004689. UDPgal_transpt.
[Graphical view]
PANTHERiPTHR10231. PTHR10231. 1 hit.
PfamiPF04142. Nuc_sug_transp. 1 hit.
[Graphical view]
PIRSFiPIRSF005799. UDP-gal_transpt. 1 hit.
TIGRFAMsiTIGR00803. nst. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning and characterization of a novel isoform of the human UDP-galactose transporter, and of related complementary DNAs belonging to the nucleotide-sugar transporter gene family."
    Ishida N., Miura N., Yoshioka S., Kawakita M.
    J. Biochem. 120:1074-1078(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Liver.
  2. "Genetic complementation reveals a novel human congenital disorder of glycosylation of type II, due to inactivation of the Golgi CMP-sialic acid transporter."
    Martinez-Duncker I., Dupre T., Piller V., Piller F., Candelier J.-J., Trichet C., Tchernia G., Oriol R., Mollicone R.
    Blood 105:2671-2676(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), INVOLVEMENT IN CDG2F.
  3. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Lung.

Entry informationi

Entry nameiS35A1_HUMAN
AccessioniPrimary (citable) accession number: P78382
Secondary accession number(s): Q5W1L8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: May 1, 1997
Last modified: July 22, 2015
This is version 137 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.