Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P78358

- CTG1B_HUMAN

UniProt

P78358 - CTG1B_HUMAN

Protein

Cancer/testis antigen 1

Gene

CTAG1A

more
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 121 (01 Oct 2014)
      Sequence version 1 (01 May 1997)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GO - Molecular functioni

    1. protein binding Source: IntAct

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Cancer/testis antigen 1
    Alternative name(s):
    Autoimmunogenic cancer/testis antigen NY-ESO-1
    Cancer/testis antigen 6.1
    Short name:
    CT6.1
    L antigen family member 2
    Short name:
    LAGE-2
    Gene namesi
    Name:CTAG1A
    Synonyms:CTAG, CTAG1, ESO1, LAGE2, LAGE2A
    AND
    Name:CTAG1B
    Synonyms:LAGE2B
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome X

    Organism-specific databases

    HGNCiHGNC:24198. CTAG1A.
    HGNC:2491. CTAG1B.

    Subcellular locationi

    Cytoplasm 1 Publication

    GO - Cellular componenti

    1. cytoplasm Source: LIFEdb

    Keywords - Cellular componenti

    Cytoplasm

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134979749.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 180180Cancer/testis antigen 1PRO_0000218922Add
    BLAST

    Proteomic databases

    PaxDbiP78358.
    PRIDEiP78358.

    PTM databases

    PhosphoSiteiP78358.

    Expressioni

    Tissue specificityi

    Expressed in testis and ovary and in a wide variety of cancers. Detected in uterine myometrium. Expressed from 18 weeks until birth in human fetal testis. In the adult testis, is strongly expressed in spermatogonia and in primary spermatocytes, but not in post-meiotic cells or in testicular somatic cells (at protein level).1 Publication

    Gene expression databases

    BgeeiP78358.
    CleanExiHS_CTAG1A.
    HS_CTAG1B.
    GenevestigatoriP78358.

    Organism-specific databases

    HPAiCAB013061.
    CAB015453.

    Interactioni

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    MAGEC1O607326EBI-1188472,EBI-1188463

    Protein-protein interaction databases

    BioGridi107867. 2 interactions.
    IntActiP78358. 1 interaction.
    STRINGi9606.ENSP00000332018.

    Structurei

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1S9WX-ray2.20C157-165[»]
    2BNQX-ray1.70C157-164[»]
    2BNRX-ray1.90C157-165[»]
    2F53X-ray2.10C157-165[»]
    2F54X-ray2.70C/H157-165[»]
    2P5EX-ray1.89C157-165[»]
    2P5WX-ray2.20C157-165[»]
    2PYEX-ray2.30C157-165[»]
    3GJFX-ray1.90C/F157-164[»]
    3HAEX-ray2.90C/F/M/R157-164[»]
    3KLAX-ray1.65C/F157-165[»]
    ProteinModelPortaliP78358.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiP78358.

    Family & Domainsi

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi5 – 8278Gly-richAdd
    BLAST

    Sequence similaritiesi

    Belongs to the CTAG/PCC1 family.Curated

    Phylogenomic databases

    eggNOGiNOG78499.
    HOGENOMiHOG000040003.
    HOVERGENiHBG051214.
    InParanoidiP78358.
    OMAiLLMWIMQ.
    OrthoDBiEOG7M3J33.
    PhylomeDBiP78358.
    TreeFamiTF337064.

    Family and domain databases

    InterProiIPR015419. EKC/KEOPS_Pcc1.
    [Graphical view]
    PfamiPF09341. Pcc1. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P78358-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MQAEGRGTGG STGDADGPGG PGIPDGPGGN AGGPGEAGAT GGRGPRGAGA    50
    ARASGPGGGA PRGPHGGAAS GLNGCCRCGA RGPESRLLEF YLAMPFATPM 100
    EAELARRSLA QDAPPLPVPG VLLKEFTVSG NILTIRLTAA DHRQLQLSIS 150
    SCLQQLSLLM WITQCFLPVF LAQPPSGQRR 180
    Length:180
    Mass (Da):17,992
    Last modified:May 1, 1997 - v1
    Checksum:iB122C5C2C8BE1569
    GO
    Isoform 2 (identifier: P78358-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         135-180: IRLTAADHRQ...LAQPPSGQRR → MSVQDQDRDGAWVGGGHSVAGWGLGSAYTPRSGC

    Show »
    Length:168
    Mass (Da):16,192
    Checksum:iC71F3242B5440169
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei135 – 18046IRLTA…SGQRR → MSVQDQDRDGAWVGGGHSVA GWGLGSAYTPRSGC in isoform 2. 1 PublicationVSP_028548Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U87459 mRNA. Translation: AAB49693.1.
    AJ003149 mRNA. Translation: CAA05908.1.
    AF038567 mRNA. Translation: AAD05202.1.
    AJ275977 Genomic DNA. Translation: CAB76943.1.
    AF277315 Genomic DNA. Translation: AAL27013.1.
    AF277315 Genomic DNA. Translation: AAL27014.1.
    CH471172 Genomic DNA. Translation: EAW72673.1.
    CH471172 Genomic DNA. Translation: EAW72674.1.
    BC130362 mRNA. Translation: AAI30363.1.
    BC130364 mRNA. Translation: AAI30365.1.
    AJ275978 mRNA. Translation: CAB76945.1.
    CCDSiCCDS14758.1. [P78358-1]
    CCDS44025.1. [P78358-1]
    RefSeqiNP_001318.1. NM_001327.2. [P78358-1]
    NP_640343.1. NM_139250.1. [P78358-1]
    UniGeneiHs.534310.
    Hs.745351.

    Genome annotation databases

    EnsembliENST00000328435; ENSP00000332602; ENSG00000184033. [P78358-1]
    ENST00000359887; ENSP00000352953; ENSG00000184033. [P78358-2]
    ENST00000593606; ENSP00000472220; ENSG00000268651. [P78358-2]
    ENST00000595485; ENSP00000469269; ENSG00000184033. [P78358-1]
    ENST00000599837; ENSP00000469441; ENSG00000268651. [P78358-1]
    GeneIDi1485.
    246100.
    KEGGihsa:1485.
    hsa:246100.
    UCSCiuc004fme.3. human. [P78358-1]

    Polymorphism databases

    DMDMi6014739.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U87459 mRNA. Translation: AAB49693.1 .
    AJ003149 mRNA. Translation: CAA05908.1 .
    AF038567 mRNA. Translation: AAD05202.1 .
    AJ275977 Genomic DNA. Translation: CAB76943.1 .
    AF277315 Genomic DNA. Translation: AAL27013.1 .
    AF277315 Genomic DNA. Translation: AAL27014.1 .
    CH471172 Genomic DNA. Translation: EAW72673.1 .
    CH471172 Genomic DNA. Translation: EAW72674.1 .
    BC130362 mRNA. Translation: AAI30363.1 .
    BC130364 mRNA. Translation: AAI30365.1 .
    AJ275978 mRNA. Translation: CAB76945.1 .
    CCDSi CCDS14758.1. [P78358-1 ]
    CCDS44025.1. [P78358-1 ]
    RefSeqi NP_001318.1. NM_001327.2. [P78358-1 ]
    NP_640343.1. NM_139250.1. [P78358-1 ]
    UniGenei Hs.534310.
    Hs.745351.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1S9W X-ray 2.20 C 157-165 [» ]
    2BNQ X-ray 1.70 C 157-164 [» ]
    2BNR X-ray 1.90 C 157-165 [» ]
    2F53 X-ray 2.10 C 157-165 [» ]
    2F54 X-ray 2.70 C/H 157-165 [» ]
    2P5E X-ray 1.89 C 157-165 [» ]
    2P5W X-ray 2.20 C 157-165 [» ]
    2PYE X-ray 2.30 C 157-165 [» ]
    3GJF X-ray 1.90 C/F 157-164 [» ]
    3HAE X-ray 2.90 C/F/M/R 157-164 [» ]
    3KLA X-ray 1.65 C/F 157-165 [» ]
    ProteinModelPortali P78358.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 107867. 2 interactions.
    IntActi P78358. 1 interaction.
    STRINGi 9606.ENSP00000332018.

    PTM databases

    PhosphoSitei P78358.

    Polymorphism databases

    DMDMi 6014739.

    Proteomic databases

    PaxDbi P78358.
    PRIDEi P78358.

    Protocols and materials databases

    DNASUi 246100.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000328435 ; ENSP00000332602 ; ENSG00000184033 . [P78358-1 ]
    ENST00000359887 ; ENSP00000352953 ; ENSG00000184033 . [P78358-2 ]
    ENST00000593606 ; ENSP00000472220 ; ENSG00000268651 . [P78358-2 ]
    ENST00000595485 ; ENSP00000469269 ; ENSG00000184033 . [P78358-1 ]
    ENST00000599837 ; ENSP00000469441 ; ENSG00000268651 . [P78358-1 ]
    GeneIDi 1485.
    246100.
    KEGGi hsa:1485.
    hsa:246100.
    UCSCi uc004fme.3. human. [P78358-1 ]

    Organism-specific databases

    CTDi 1485.
    246100.
    GeneCardsi GC0XM153845.
    GC0XP153813.
    HGNCi HGNC:24198. CTAG1A.
    HGNC:2491. CTAG1B.
    HPAi CAB013061.
    CAB015453.
    MIMi 300156. gene.
    300657. gene.
    neXtProti NX_P78358.
    PharmGKBi PA134979749.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG78499.
    HOGENOMi HOG000040003.
    HOVERGENi HBG051214.
    InParanoidi P78358.
    OMAi LLMWIMQ.
    OrthoDBi EOG7M3J33.
    PhylomeDBi P78358.
    TreeFami TF337064.

    Miscellaneous databases

    EvolutionaryTracei P78358.
    GeneWikii CTAG1B.
    NextBioi 6097.
    PROi P78358.
    SOURCEi Search...

    Gene expression databases

    Bgeei P78358.
    CleanExi HS_CTAG1A.
    HS_CTAG1B.
    Genevestigatori P78358.

    Family and domain databases

    InterProi IPR015419. EKC/KEOPS_Pcc1.
    [Graphical view ]
    Pfami PF09341. Pcc1. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "A testicular antigen aberrantly expressed in human cancers detected by autologous antibody screening."
      Chen Y.-T., Scanlan M.J., Sahin U., Tuereci O., Gure A.O., Tsang S., Williamson B., Stockert E., Pfreundschuh M., Old L.J.
      Proc. Natl. Acad. Sci. U.S.A. 94:1914-1918(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Melanoma.
    3. "A breast and melanoma-shared tumor antigen: T cell responses to antigenic peptides translated from different open reading frames."
      Wang R.-F., Johnston S.L., Zeng G., Topalian S.L., Schwartzentruber D.J., Rosenberg S.A.
      J. Immunol. 161:3598-3606(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    4. "DNA methylation is the primary silencing mechanism for a set of germ line- and tumor-specific genes with a CpG-rich promoter."
      De Smet C., Lurquin C., Lethe B.G., Martelange V., Boon T.
      Mol. Cell. Biol. 19:7327-7335(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    5. "Multiple pathogenic and benign genomic rearrangements occur at a 35 kb duplication involving the NEMO and LAGE2 genes."
      Aradhya S., Bardaro T., Galgoczy P., Yamagata T., Esposito T., Patlan H., Ciccodicola A., Kenwrick S., Platzer M., D'Urso M., Nelson D.L.
      Hum. Mol. Genet. 10:2557-2567(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    6. "The DNA sequence of the human X chromosome."
      Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
      , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
      Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    9. Lethe B.G.
      Submitted (MAR-2000) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 27-180 (ISOFORM 2).
    10. "The cancer-testis gene, NY-ESO-1, is expressed in normal fetal and adult testes and in spermatocytic seminomas and testicular carcinoma in situ."
      Satie A.P., Rajpert-De Meyts E., Spagnoli G.C., Henno S., Olivo L., Jacobsen G.K., Rioux-Leclercq N., Jegou B., Samson M.
      Lab. Invest. 82:775-780(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY, SUBCELLULAR LOCATION.
    11. Cited for: X-RAY CRYSTALLOGRAPHY (1.7 ANGSTROMS) OF 157-165 IN COMPLEX WITH T-CELL RECEPTOR.

    Entry informationi

    Entry nameiCTG1B_HUMAN
    AccessioniPrimary (citable) accession number: P78358
    Secondary accession number(s): A1L417
    , B7WNL9, Q7LBY4, Q9NY13
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 15, 1998
    Last sequence update: May 1, 1997
    Last modified: October 1, 2014
    This is version 121 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome X
      Human chromosome X: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3