Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P78358

- CTG1B_HUMAN

UniProt

P78358 - CTG1B_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Cancer/testis antigen 1

Gene

CTAG1A

more
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Cancer/testis antigen 1
Alternative name(s):
Autoimmunogenic cancer/testis antigen NY-ESO-1
Cancer/testis antigen 6.1
Short name:
CT6.1
L antigen family member 2
Short name:
LAGE-2
Gene namesi
Name:CTAG1A
Synonyms:CTAG, CTAG1, ESO1, LAGE2, LAGE2A
AND
Name:CTAG1B
Synonyms:LAGE2B
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome X

Organism-specific databases

HGNCiHGNC:24198. CTAG1A.
HGNC:2491. CTAG1B.

Subcellular locationi

Cytoplasm 1 Publication

GO - Cellular componenti

  1. cytoplasm Source: LIFEdb
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134979749.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 180180Cancer/testis antigen 1PRO_0000218922Add
BLAST

Proteomic databases

PaxDbiP78358.
PRIDEiP78358.

PTM databases

PhosphoSiteiP78358.

Expressioni

Tissue specificityi

Expressed in testis and ovary and in a wide variety of cancers. Detected in uterine myometrium. Expressed from 18 weeks until birth in human fetal testis. In the adult testis, is strongly expressed in spermatogonia and in primary spermatocytes, but not in post-meiotic cells or in testicular somatic cells (at protein level).1 Publication

Gene expression databases

BgeeiP78358.
CleanExiHS_CTAG1A.
HS_CTAG1B.
GenevestigatoriP78358.

Organism-specific databases

HPAiCAB013061.
CAB015453.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
MAGEC1O607326EBI-1188472,EBI-1188463

Protein-protein interaction databases

BioGridi107867. 2 interactions.
IntActiP78358. 1 interaction.
STRINGi9606.ENSP00000332018.

Structurei

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1S9WX-ray2.20C157-165[»]
2BNQX-ray1.70C157-164[»]
2BNRX-ray1.90C157-165[»]
2F53X-ray2.10C157-165[»]
2F54X-ray2.70C/H157-165[»]
2P5EX-ray1.89C157-165[»]
2P5WX-ray2.20C157-165[»]
2PYEX-ray2.30C157-165[»]
3GJFX-ray1.90C/F157-164[»]
3HAEX-ray2.90C/F/M/R157-164[»]
3KLAX-ray1.65C/F157-165[»]
ProteinModelPortaliP78358.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP78358.

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi5 – 8278Gly-richAdd
BLAST

Sequence similaritiesi

Belongs to the CTAG/PCC1 family.Curated

Phylogenomic databases

eggNOGiNOG78499.
GeneTreeiENSGT00410000025802.
HOGENOMiHOG000040003.
HOVERGENiHBG051214.
InParanoidiP78358.
OMAiLLMWIMQ.
OrthoDBiEOG7M3J33.
PhylomeDBiP78358.
TreeFamiTF337064.

Family and domain databases

InterProiIPR015419. EKC/KEOPS_Pcc1.
[Graphical view]
PfamiPF09341. Pcc1. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P78358-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQAEGRGTGG STGDADGPGG PGIPDGPGGN AGGPGEAGAT GGRGPRGAGA
60 70 80 90 100
ARASGPGGGA PRGPHGGAAS GLNGCCRCGA RGPESRLLEF YLAMPFATPM
110 120 130 140 150
EAELARRSLA QDAPPLPVPG VLLKEFTVSG NILTIRLTAA DHRQLQLSIS
160 170 180
SCLQQLSLLM WITQCFLPVF LAQPPSGQRR
Length:180
Mass (Da):17,992
Last modified:May 1, 1997 - v1
Checksum:iB122C5C2C8BE1569
GO
Isoform 2 (identifier: P78358-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     135-180: IRLTAADHRQ...LAQPPSGQRR → MSVQDQDRDGAWVGGGHSVAGWGLGSAYTPRSGC

Show »
Length:168
Mass (Da):16,192
Checksum:iC71F3242B5440169
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei135 – 18046IRLTA…SGQRR → MSVQDQDRDGAWVGGGHSVA GWGLGSAYTPRSGC in isoform 2. 1 PublicationVSP_028548Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U87459 mRNA. Translation: AAB49693.1.
AJ003149 mRNA. Translation: CAA05908.1.
AF038567 mRNA. Translation: AAD05202.1.
AJ275977 Genomic DNA. Translation: CAB76943.1.
AF277315 Genomic DNA. Translation: AAL27013.1.
AF277315 Genomic DNA. Translation: AAL27014.1.
CH471172 Genomic DNA. Translation: EAW72673.1.
CH471172 Genomic DNA. Translation: EAW72674.1.
BC130362 mRNA. Translation: AAI30363.1.
BC130364 mRNA. Translation: AAI30365.1.
AJ275978 mRNA. Translation: CAB76945.1.
CCDSiCCDS14758.1. [P78358-1]
CCDS44025.1. [P78358-1]
RefSeqiNP_001318.1. NM_001327.2. [P78358-1]
NP_640343.1. NM_139250.1. [P78358-1]
UniGeneiHs.534310.
Hs.745351.

Genome annotation databases

EnsembliENST00000328435; ENSP00000332602; ENSG00000184033. [P78358-1]
ENST00000359887; ENSP00000352953; ENSG00000184033. [P78358-2]
ENST00000599837; ENSP00000469441; ENSG00000268651. [P78358-1]
GeneIDi1485.
246100.
KEGGihsa:1485.
hsa:246100.
UCSCiuc004fme.3. human. [P78358-1]

Polymorphism databases

DMDMi6014739.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U87459 mRNA. Translation: AAB49693.1 .
AJ003149 mRNA. Translation: CAA05908.1 .
AF038567 mRNA. Translation: AAD05202.1 .
AJ275977 Genomic DNA. Translation: CAB76943.1 .
AF277315 Genomic DNA. Translation: AAL27013.1 .
AF277315 Genomic DNA. Translation: AAL27014.1 .
CH471172 Genomic DNA. Translation: EAW72673.1 .
CH471172 Genomic DNA. Translation: EAW72674.1 .
BC130362 mRNA. Translation: AAI30363.1 .
BC130364 mRNA. Translation: AAI30365.1 .
AJ275978 mRNA. Translation: CAB76945.1 .
CCDSi CCDS14758.1. [P78358-1 ]
CCDS44025.1. [P78358-1 ]
RefSeqi NP_001318.1. NM_001327.2. [P78358-1 ]
NP_640343.1. NM_139250.1. [P78358-1 ]
UniGenei Hs.534310.
Hs.745351.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1S9W X-ray 2.20 C 157-165 [» ]
2BNQ X-ray 1.70 C 157-164 [» ]
2BNR X-ray 1.90 C 157-165 [» ]
2F53 X-ray 2.10 C 157-165 [» ]
2F54 X-ray 2.70 C/H 157-165 [» ]
2P5E X-ray 1.89 C 157-165 [» ]
2P5W X-ray 2.20 C 157-165 [» ]
2PYE X-ray 2.30 C 157-165 [» ]
3GJF X-ray 1.90 C/F 157-164 [» ]
3HAE X-ray 2.90 C/F/M/R 157-164 [» ]
3KLA X-ray 1.65 C/F 157-165 [» ]
ProteinModelPortali P78358.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 107867. 2 interactions.
IntActi P78358. 1 interaction.
STRINGi 9606.ENSP00000332018.

PTM databases

PhosphoSitei P78358.

Polymorphism databases

DMDMi 6014739.

Proteomic databases

PaxDbi P78358.
PRIDEi P78358.

Protocols and materials databases

DNASUi 246100.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000328435 ; ENSP00000332602 ; ENSG00000184033 . [P78358-1 ]
ENST00000359887 ; ENSP00000352953 ; ENSG00000184033 . [P78358-2 ]
ENST00000599837 ; ENSP00000469441 ; ENSG00000268651 . [P78358-1 ]
GeneIDi 1485.
246100.
KEGGi hsa:1485.
hsa:246100.
UCSCi uc004fme.3. human. [P78358-1 ]

Organism-specific databases

CTDi 1485.
246100.
GeneCardsi GC0XM153845.
GC0XP153813.
HGNCi HGNC:24198. CTAG1A.
HGNC:2491. CTAG1B.
HPAi CAB013061.
CAB015453.
MIMi 300156. gene.
300657. gene.
neXtProti NX_P78358.
PharmGKBi PA134979749.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG78499.
GeneTreei ENSGT00410000025802.
HOGENOMi HOG000040003.
HOVERGENi HBG051214.
InParanoidi P78358.
OMAi LLMWIMQ.
OrthoDBi EOG7M3J33.
PhylomeDBi P78358.
TreeFami TF337064.

Miscellaneous databases

EvolutionaryTracei P78358.
GeneWikii CTAG1B.
NextBioi 6097.
PROi P78358.
SOURCEi Search...

Gene expression databases

Bgeei P78358.
CleanExi HS_CTAG1A.
HS_CTAG1B.
Genevestigatori P78358.

Family and domain databases

InterProi IPR015419. EKC/KEOPS_Pcc1.
[Graphical view ]
Pfami PF09341. Pcc1. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "A testicular antigen aberrantly expressed in human cancers detected by autologous antibody screening."
    Chen Y.-T., Scanlan M.J., Sahin U., Tuereci O., Gure A.O., Tsang S., Williamson B., Stockert E., Pfreundschuh M., Old L.J.
    Proc. Natl. Acad. Sci. U.S.A. 94:1914-1918(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Melanoma.
  3. "A breast and melanoma-shared tumor antigen: T cell responses to antigenic peptides translated from different open reading frames."
    Wang R.-F., Johnston S.L., Zeng G., Topalian S.L., Schwartzentruber D.J., Rosenberg S.A.
    J. Immunol. 161:3598-3606(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  4. "DNA methylation is the primary silencing mechanism for a set of germ line- and tumor-specific genes with a CpG-rich promoter."
    De Smet C., Lurquin C., Lethe B.G., Martelange V., Boon T.
    Mol. Cell. Biol. 19:7327-7335(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  5. "Multiple pathogenic and benign genomic rearrangements occur at a 35 kb duplication involving the NEMO and LAGE2 genes."
    Aradhya S., Bardaro T., Galgoczy P., Yamagata T., Esposito T., Patlan H., Ciccodicola A., Kenwrick S., Platzer M., D'Urso M., Nelson D.L.
    Hum. Mol. Genet. 10:2557-2567(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  6. "The DNA sequence of the human X chromosome."
    Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
    , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
    Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  9. Lethe B.G.
    Submitted (MAR-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 27-180 (ISOFORM 2).
  10. "The cancer-testis gene, NY-ESO-1, is expressed in normal fetal and adult testes and in spermatocytic seminomas and testicular carcinoma in situ."
    Satie A.P., Rajpert-De Meyts E., Spagnoli G.C., Henno S., Olivo L., Jacobsen G.K., Rioux-Leclercq N., Jegou B., Samson M.
    Lab. Invest. 82:775-780(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY, SUBCELLULAR LOCATION.
  11. Cited for: X-RAY CRYSTALLOGRAPHY (1.7 ANGSTROMS) OF 157-165 IN COMPLEX WITH T-CELL RECEPTOR.

Entry informationi

Entry nameiCTG1B_HUMAN
AccessioniPrimary (citable) accession number: P78358
Secondary accession number(s): A1L417
, B7WNL9, Q7LBY4, Q9NY13
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 15, 1998
Last sequence update: May 1, 1997
Last modified: October 29, 2014
This is version 122 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3