Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cancer/testis antigen 1

Gene

CTAG1A

more
Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Enzyme and pathway databases

BioCyciZFISH:G66-32088-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Cancer/testis antigen 1
Alternative name(s):
Autoimmunogenic cancer/testis antigen NY-ESO-1
Cancer/testis antigen 6.1
Short name:
CT6.1
L antigen family member 2
Short name:
LAGE-2
Gene namesi
Name:CTAG1A
Synonyms:CTAG, CTAG1, ESO1, LAGE2, LAGE2A
AND
Name:CTAG1B
Synonyms:LAGE2B
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

HGNCiHGNC:24198. CTAG1A.
HGNC:2491. CTAG1B.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi1485.
246100.
OpenTargetsiENSG00000184033.
ENSG00000268651.
PharmGKBiPA134979749.

Polymorphism and mutation databases

DMDMi6014739.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002189221 – 180Cancer/testis antigen 1Add BLAST180

Proteomic databases

PaxDbiP78358.
PeptideAtlasiP78358.
PRIDEiP78358.
TopDownProteomicsiP78358-1. [P78358-1]

PTM databases

iPTMnetiP78358.
PhosphoSitePlusiP78358.

Expressioni

Tissue specificityi

Expressed in testis and ovary and in a wide variety of cancers. Detected in uterine myometrium. Expressed from 18 weeks until birth in human fetal testis. In the adult testis, is strongly expressed in spermatogonia and in primary spermatocytes, but not in post-meiotic cells or in testicular somatic cells (at protein level).1 Publication

Gene expression databases

BgeeiENSG00000183678.
CleanExiHS_CTAG1A.
HS_CTAG1B.
GenevisibleiP78358. HS.

Organism-specific databases

HPAiCAB013061.
CAB015453.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
MAGEC1O607326EBI-1188472,EBI-1188463
SGTAO437654EBI-1188472,EBI-347996
UBQLN1Q9UMX07EBI-1188472,EBI-741480
UBQLN1Q9UMX0-23EBI-1188472,EBI-10173939
UBQLN2Q9UHD96EBI-1188472,EBI-947187

Protein-protein interaction databases

BioGridi107867. 2 interactors.
IntActiP78358. 50 interactors.
STRINGi9606.ENSP00000332602.

Structurei

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1S9WX-ray2.20C157-165[»]
2BNQX-ray1.70C157-164[»]
2BNRX-ray1.90C157-165[»]
2F53X-ray2.10C157-165[»]
2F54X-ray2.70C/H157-165[»]
2P5EX-ray1.89C157-165[»]
2P5WX-ray2.20C157-165[»]
2PYEX-ray2.30C157-165[»]
3GJFX-ray1.90C/F157-164[»]
3HAEX-ray2.90C/F/M/R157-164[»]
3KLAX-ray1.65C/F157-165[»]
ProteinModelPortaliP78358.
SMRiP78358.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP78358.

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi5 – 82Gly-richAdd BLAST78

Sequence similaritiesi

Belongs to the CTAG/PCC1 family.Curated

Phylogenomic databases

eggNOGiENOG410JHSY. Eukaryota.
ENOG411148V. LUCA.
GeneTreeiENSGT00410000025802.
HOGENOMiHOG000040003.
HOVERGENiHBG051214.
InParanoidiP78358.
OMAiLIAADHR.
PhylomeDBiP78358.
TreeFamiTF337064.

Family and domain databases

InterProiIPR015419. CTAG/Pcc1.
[Graphical view]
PfamiPF09341. Pcc1. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P78358-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQAEGRGTGG STGDADGPGG PGIPDGPGGN AGGPGEAGAT GGRGPRGAGA
60 70 80 90 100
ARASGPGGGA PRGPHGGAAS GLNGCCRCGA RGPESRLLEF YLAMPFATPM
110 120 130 140 150
EAELARRSLA QDAPPLPVPG VLLKEFTVSG NILTIRLTAA DHRQLQLSIS
160 170 180
SCLQQLSLLM WITQCFLPVF LAQPPSGQRR
Length:180
Mass (Da):17,992
Last modified:May 1, 1997 - v1
Checksum:iB122C5C2C8BE1569
GO
Isoform 2 (identifier: P78358-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     135-180: IRLTAADHRQ...LAQPPSGQRR → MSVQDQDRDGAWVGGGHSVAGWGLGSAYTPRSGC

Show »
Length:168
Mass (Da):16,192
Checksum:iC71F3242B5440169
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_028548135 – 180IRLTA…SGQRR → MSVQDQDRDGAWVGGGHSVA GWGLGSAYTPRSGC in isoform 2. 1 PublicationAdd BLAST46

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U87459 mRNA. Translation: AAB49693.1.
AJ003149 mRNA. Translation: CAA05908.1.
AF038567 mRNA. Translation: AAD05202.1.
AJ275977 Genomic DNA. Translation: CAB76943.1.
AF277315 Genomic DNA. Translation: AAL27013.1.
AF277315 Genomic DNA. Translation: AAL27014.1.
CH471172 Genomic DNA. Translation: EAW72673.1.
CH471172 Genomic DNA. Translation: EAW72674.1.
BC130362 mRNA. Translation: AAI30363.1.
BC130364 mRNA. Translation: AAI30365.1.
AJ275978 mRNA. Translation: CAB76945.1.
CCDSiCCDS14758.1. [P78358-1]
CCDS44025.1. [P78358-1]
RefSeqiNP_001318.1. NM_001327.2. [P78358-1]
NP_640343.1. NM_139250.1. [P78358-1]
UniGeneiHs.534310.
Hs.745351.

Genome annotation databases

EnsembliENST00000328435; ENSP00000332602; ENSG00000184033. [P78358-1]
ENST00000359887; ENSP00000352953; ENSG00000184033. [P78358-2]
ENST00000599837; ENSP00000469441; ENSG00000268651. [P78358-1]
GeneIDi1485.
246100.
KEGGihsa:1485.
hsa:246100.
UCSCiuc004fme.3. human. [P78358-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U87459 mRNA. Translation: AAB49693.1.
AJ003149 mRNA. Translation: CAA05908.1.
AF038567 mRNA. Translation: AAD05202.1.
AJ275977 Genomic DNA. Translation: CAB76943.1.
AF277315 Genomic DNA. Translation: AAL27013.1.
AF277315 Genomic DNA. Translation: AAL27014.1.
CH471172 Genomic DNA. Translation: EAW72673.1.
CH471172 Genomic DNA. Translation: EAW72674.1.
BC130362 mRNA. Translation: AAI30363.1.
BC130364 mRNA. Translation: AAI30365.1.
AJ275978 mRNA. Translation: CAB76945.1.
CCDSiCCDS14758.1. [P78358-1]
CCDS44025.1. [P78358-1]
RefSeqiNP_001318.1. NM_001327.2. [P78358-1]
NP_640343.1. NM_139250.1. [P78358-1]
UniGeneiHs.534310.
Hs.745351.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1S9WX-ray2.20C157-165[»]
2BNQX-ray1.70C157-164[»]
2BNRX-ray1.90C157-165[»]
2F53X-ray2.10C157-165[»]
2F54X-ray2.70C/H157-165[»]
2P5EX-ray1.89C157-165[»]
2P5WX-ray2.20C157-165[»]
2PYEX-ray2.30C157-165[»]
3GJFX-ray1.90C/F157-164[»]
3HAEX-ray2.90C/F/M/R157-164[»]
3KLAX-ray1.65C/F157-165[»]
ProteinModelPortaliP78358.
SMRiP78358.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107867. 2 interactors.
IntActiP78358. 50 interactors.
STRINGi9606.ENSP00000332602.

PTM databases

iPTMnetiP78358.
PhosphoSitePlusiP78358.

Polymorphism and mutation databases

DMDMi6014739.

Proteomic databases

PaxDbiP78358.
PeptideAtlasiP78358.
PRIDEiP78358.
TopDownProteomicsiP78358-1. [P78358-1]

Protocols and materials databases

DNASUi246100.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000328435; ENSP00000332602; ENSG00000184033. [P78358-1]
ENST00000359887; ENSP00000352953; ENSG00000184033. [P78358-2]
ENST00000599837; ENSP00000469441; ENSG00000268651. [P78358-1]
GeneIDi1485.
246100.
KEGGihsa:1485.
hsa:246100.
UCSCiuc004fme.3. human. [P78358-1]

Organism-specific databases

CTDi1485.
246100.
DisGeNETi1485.
246100.
GeneCardsiCTAG1A.
CTAG1B.
HGNCiHGNC:24198. CTAG1A.
HGNC:2491. CTAG1B.
HPAiCAB013061.
CAB015453.
MIMi300156. gene.
300657. gene.
neXtProtiNX_P78358.
OpenTargetsiENSG00000184033.
ENSG00000268651.
PharmGKBiPA134979749.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410JHSY. Eukaryota.
ENOG411148V. LUCA.
GeneTreeiENSGT00410000025802.
HOGENOMiHOG000040003.
HOVERGENiHBG051214.
InParanoidiP78358.
OMAiLIAADHR.
PhylomeDBiP78358.
TreeFamiTF337064.

Enzyme and pathway databases

BioCyciZFISH:G66-32088-MONOMER.

Miscellaneous databases

EvolutionaryTraceiP78358.
GeneWikiiCTAG1B.
PROiP78358.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000183678.
CleanExiHS_CTAG1A.
HS_CTAG1B.
GenevisibleiP78358. HS.

Family and domain databases

InterProiIPR015419. CTAG/Pcc1.
[Graphical view]
PfamiPF09341. Pcc1. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCTG1B_HUMAN
AccessioniPrimary (citable) accession number: P78358
Secondary accession number(s): A1L417
, B7WNL9, Q7LBY4, Q9NY13
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 15, 1998
Last sequence update: May 1, 1997
Last modified: November 30, 2016
This is version 140 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.