P78358 (CTG1B_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 109.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Cancer/testis antigen 1 Alternative name(s): Autoimmunogenic cancer/testis antigen NY-ESO-1 Cancer/testis antigen 6.1 Short name=CT6.1 L antigen family member 2 Short name=LAGE-2 | |||||||||
| Gene names |
| |||||||||
| Organism | Homo sapiens (Human) [Reference proteome] | |||||||||
| Taxonomic identifier | 9606 [NCBI] | |||||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 180 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Subcellular location | |
| Tissue specificity | Expressed in testis and ovary and in a wide variety of cancers. Detected in uterine myometrium. Expressed from 18 weeks until birth in human fetal testis. In the adult testis, is strongly expressed in spermatogonia and in primary spermatocytes, but not in post-meiotic cells or in testicular somatic cells (at protein level). Ref.10 |
| Sequence similarities | Belongs to the CTAG family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | cytoplasm Inferred from direct assay. Source: LIFEdb |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| MAGEC1 | O60732 | 6 | EBI-1188472,EBI-1188463 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P78358-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P78358-2) The sequence of this isoform differs from the canonical sequence as follows: 135-180: IRLTAADHRQ...LAQPPSGQRR → MSVQDQDRDGAWVGGGHSVAGWGLGSAYTPRSGC |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 180 | 180 | Cancer/testis antigen 1 | PRO_0000218922 | |||||
Regions | |||||||||
| Compositional bias | 5 – 82 | 78 | Gly-rich | ||||||
Natural variations | |||||||||
| Alternative sequence | 135 – 180 | 46 | IRLTA…SGQRR → MSVQDQDRDGAWVGGGHSVA GWGLGSAYTPRSGC in isoform 2. | VSP_028548 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A testicular antigen aberrantly expressed in human cancers detected by autologous antibody screening." Chen Y.-T., Scanlan M.J., Sahin U., Tuereci O., Gure A.O., Tsang S., Williamson B., Stockert E., Pfreundschuh M., Old L.J. Proc. Natl. Acad. Sci. U.S.A. 94:1914-1918(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "LAGE-1, a new gene with tumor specificity." Lethe B.G., Lucas S., Michaux L., De Smet C., Godelaine D., Serrano A., De Plaen E., Boon T. Int. J. Cancer 76:903-908(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Melanoma. |
| [3] | "A breast and melanoma-shared tumor antigen: T cell responses to antigenic peptides translated from different open reading frames." Wang R.-F., Johnston S.L., Zeng G., Topalian S.L., Schwartzentruber D.J., Rosenberg S.A. J. Immunol. 161:3598-3606(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [4] | "DNA methylation is the primary silencing mechanism for a set of germ line- and tumor-specific genes with a CpG-rich promoter." De Smet C., Lurquin C., Lethe B.G., Martelange V., Boon T. Mol. Cell. Biol. 19:7327-7335(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [5] | "Multiple pathogenic and benign genomic rearrangements occur at a 35 kb duplication involving the NEMO and LAGE2 genes." Aradhya S., Bardaro T., Galgoczy P., Yamagata T., Esposito T., Patlan H., Ciccodicola A., Kenwrick S., Platzer M., D'Urso M., Nelson D.L. Hum. Mol. Genet. 10:2557-2567(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [6] | "The DNA sequence of the human X chromosome." Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. Bentley D.R.Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [9] | Lethe B.G. Submitted (MAR-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 27-180 (ISOFORM 2). |
| [10] | "The cancer-testis gene, NY-ESO-1, is expressed in normal fetal and adult testes and in spermatocytic seminomas and testicular carcinoma in situ." Satie A.P., Rajpert-De Meyts E., Spagnoli G.C., Henno S., Olivo L., Jacobsen G.K., Rioux-Leclercq N., Jegou B., Samson M. Lab. Invest. 82:775-780(2002) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY, SUBCELLULAR LOCATION. |
| [11] | "Structural and kinetic basis for heightened immunogenicity of T cell vaccines." Chen J.-L., Stewart-Jones G., Bossi G., Lissin N.M., Wooldridge L., Choi E.M.L., Held G., Dunbar P.R., Esnouf R.M., Sami M., Boulter J.M., Rizkallah P., Renner C., Sewell A., van der Merwe P.A., Jakobsen B.K., Griffiths G., Jones E.Y., Cerundolo V. J. Exp. Med. 201:1243-1255(2005) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.7 ANGSTROMS) OF 157-165 IN COMPLEX WITH T-CELL RECEPTOR. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U87459 mRNA. Translation: AAB49693.1. AJ003149 mRNA. Translation: CAA05908.1. AF038567 mRNA. Translation: AAD05202.1. AJ275977 Genomic DNA. Translation: CAB76943.1. AF277315 Genomic DNA. Translation: AAL27013.1. AF277315 Genomic DNA. Translation: AAL27014.1. CH471172 Genomic DNA. Translation: EAW72673.1. CH471172 Genomic DNA. Translation: EAW72674.1. BC130362 mRNA. Translation: AAI30363.1. BC130364 mRNA. Translation: AAI30365.1. AJ275978 mRNA. Translation: CAB76945.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00019217. IPI00386104. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001318.1. NM_001327.2. NP_640343.1. NM_139250.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.534310. Hs.741688. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | P78358. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | P78358. 1 interaction. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000332018. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | P78358. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PaxDb | P78358. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | P78358. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DNASU | 246100. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000328435; ENSP00000332602; ENSG00000184033. ENST00000333128; ENSP00000332018; ENSG00000183678. ENST00000359887; ENSP00000352953; ENSG00000184033. ENST00000443287; ENSP00000399822; ENSG00000183678. ENST00000593606; ENSP00000472220; ENSG00000268651. ENST00000599837; ENSP00000469441; ENSG00000268651. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 1485. 246100. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:1485. hsa:246100. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc004fme.3. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 1485. 246100. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC0XM153845. GC0XP153813. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:24198. CTAG1A. HGNC:2491. CTAG1B. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB013061. CAB015453. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 300156. gene. 300657. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_P78358. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA134979749. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | NOG78499. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOGENOM | HOG000040003. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG051214. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InParanoid | P78358. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | ELMVIGS. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | P78358. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_CTAG1A. HS_CTAG1B. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | P78358. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000183678. Homo sapiens. ENSG00000184033. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR015419. EKC/KEOPS_Pcc1. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF09341. Pcc1. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | P78358. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 6097. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | CTG1B_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P78358 Secondary accession number(s): A1L417 Q9NY13 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Recent format changes Overview of recent format changes |
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
