Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P78358 (CTG1B_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 117. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Cancer/testis antigen 1
Alternative name(s):
Autoimmunogenic cancer/testis antigen NY-ESO-1
Cancer/testis antigen 6.1
Short name=CT6.1
L antigen family member 2
Short name=LAGE-2
Gene names
Name:CTAG1A
Synonyms:CTAG, CTAG1, ESO1, LAGE2, LAGE2A
AND
Name:CTAG1B
Synonyms:LAGE2B
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length180 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Subcellular location

Cytoplasm Ref.10.

Tissue specificity

Expressed in testis and ovary and in a wide variety of cancers. Detected in uterine myometrium. Expressed from 18 weeks until birth in human fetal testis. In the adult testis, is strongly expressed in spermatogonia and in primary spermatocytes, but not in post-meiotic cells or in testicular somatic cells (at protein level). Ref.10

Sequence similarities

Belongs to the CTAG/PCC1 family.

Ontologies

Keywords
   Cellular componentCytoplasm
   Coding sequence diversityAlternative splicing
   Technical term3D-structure
Complete proteome
Reference proteome
Gene Ontology (GO)
   Cellular_componentcytoplasm

Inferred from direct assay. Source: LIFEdb

Complete GO annotation...

Binary interactions

With

Entry

#Exp.

IntAct

Notes

MAGEC1O607326EBI-1188472,EBI-1188463

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: P78358-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: P78358-2)

The sequence of this isoform differs from the canonical sequence as follows:
     135-180: IRLTAADHRQ...LAQPPSGQRR → MSVQDQDRDGAWVGGGHSVAGWGLGSAYTPRSGC

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 180180Cancer/testis antigen 1
PRO_0000218922

Regions

Compositional bias5 – 8278Gly-rich

Natural variations

Alternative sequence135 – 18046IRLTA…SGQRR → MSVQDQDRDGAWVGGGHSVA GWGLGSAYTPRSGC in isoform 2.
VSP_028548

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified May 1, 1997. Version 1.
Checksum: B122C5C2C8BE1569

FASTA18017,992
        10         20         30         40         50         60 
MQAEGRGTGG STGDADGPGG PGIPDGPGGN AGGPGEAGAT GGRGPRGAGA ARASGPGGGA 

        70         80         90        100        110        120 
PRGPHGGAAS GLNGCCRCGA RGPESRLLEF YLAMPFATPM EAELARRSLA QDAPPLPVPG 

       130        140        150        160        170        180 
VLLKEFTVSG NILTIRLTAA DHRQLQLSIS SCLQQLSLLM WITQCFLPVF LAQPPSGQRR 

« Hide

Isoform 2 [UniParc].

Checksum: C71F3242B5440169
Show »

FASTA16816,192

References

« Hide 'large scale' references
[1]"A testicular antigen aberrantly expressed in human cancers detected by autologous antibody screening."
Chen Y.-T., Scanlan M.J., Sahin U., Tuereci O., Gure A.O., Tsang S., Williamson B., Stockert E., Pfreundschuh M., Old L.J.
Proc. Natl. Acad. Sci. U.S.A. 94:1914-1918(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[2]"LAGE-1, a new gene with tumor specificity."
Lethe B.G., Lucas S., Michaux L., De Smet C., Godelaine D., Serrano A., De Plaen E., Boon T.
Int. J. Cancer 76:903-908(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Melanoma.
[3]"A breast and melanoma-shared tumor antigen: T cell responses to antigenic peptides translated from different open reading frames."
Wang R.-F., Johnston S.L., Zeng G., Topalian S.L., Schwartzentruber D.J., Rosenberg S.A.
J. Immunol. 161:3598-3606(1998) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[4]"DNA methylation is the primary silencing mechanism for a set of germ line- and tumor-specific genes with a CpG-rich promoter."
De Smet C., Lurquin C., Lethe B.G., Martelange V., Boon T.
Mol. Cell. Biol. 19:7327-7335(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
[5]"Multiple pathogenic and benign genomic rearrangements occur at a 35 kb duplication involving the NEMO and LAGE2 genes."
Aradhya S., Bardaro T., Galgoczy P., Yamagata T., Esposito T., Patlan H., Ciccodicola A., Kenwrick S., Platzer M., D'Urso M., Nelson D.L.
Hum. Mol. Genet. 10:2557-2567(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
[6]"The DNA sequence of the human X chromosome."
Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. expand/collapse author list , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[8]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[9]Lethe B.G.
Submitted (MAR-2000) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 27-180 (ISOFORM 2).
[10]"The cancer-testis gene, NY-ESO-1, is expressed in normal fetal and adult testes and in spermatocytic seminomas and testicular carcinoma in situ."
Satie A.P., Rajpert-De Meyts E., Spagnoli G.C., Henno S., Olivo L., Jacobsen G.K., Rioux-Leclercq N., Jegou B., Samson M.
Lab. Invest. 82:775-780(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY, SUBCELLULAR LOCATION.
[11]"Structural and kinetic basis for heightened immunogenicity of T cell vaccines."
Chen J.-L., Stewart-Jones G., Bossi G., Lissin N.M., Wooldridge L., Choi E.M.L., Held G., Dunbar P.R., Esnouf R.M., Sami M., Boulter J.M., Rizkallah P., Renner C., Sewell A., van der Merwe P.A., Jakobsen B.K., Griffiths G., Jones E.Y., Cerundolo V.
J. Exp. Med. 201:1243-1255(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (1.7 ANGSTROMS) OF 157-165 IN COMPLEX WITH T-CELL RECEPTOR.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U87459 mRNA. Translation: AAB49693.1.
AJ003149 mRNA. Translation: CAA05908.1.
AF038567 mRNA. Translation: AAD05202.1.
AJ275977 Genomic DNA. Translation: CAB76943.1.
AF277315 Genomic DNA. Translation: AAL27013.1.
AF277315 Genomic DNA. Translation: AAL27014.1.
CH471172 Genomic DNA. Translation: EAW72673.1.
CH471172 Genomic DNA. Translation: EAW72674.1.
BC130362 mRNA. Translation: AAI30363.1.
BC130364 mRNA. Translation: AAI30365.1.
AJ275978 mRNA. Translation: CAB76945.1.
RefSeqNP_001318.1. NM_001327.2.
NP_640343.1. NM_139250.1.
UniGeneHs.534310.
Hs.745351.

3D structure databases

PDBe
RCSB PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
2BNQX-ray1.70C157-165[»]
2BNRX-ray1.90C157-165[»]
2F53X-ray2.10C157-165[»]
2F54X-ray2.70C/H157-165[»]
2P5EX-ray1.89C157-165[»]
2P5WX-ray2.20C157-165[»]
2PYEX-ray2.30C157-165[»]
3KLAX-ray1.65C/F157-164[»]
ProteinModelPortalP78358.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid107867. 2 interactions.
IntActP78358. 1 interaction.
STRING9606.ENSP00000332018.

PTM databases

PhosphoSiteP78358.

Polymorphism databases

DMDM6014739.

Proteomic databases

PaxDbP78358.
PRIDEP78358.

Protocols and materials databases

DNASU246100.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000328435; ENSP00000332602; ENSG00000184033. [P78358-1]
ENST00000333128; ENSP00000332018; ENSG00000183678. [P78358-1]
ENST00000359887; ENSP00000352953; ENSG00000184033. [P78358-2]
ENST00000443287; ENSP00000399822; ENSG00000183678. [P78358-2]
ENST00000593606; ENSP00000472220; ENSG00000268651. [P78358-2]
ENST00000599837; ENSP00000469441; ENSG00000268651. [P78358-1]
GeneID1485.
246100.
KEGGhsa:1485.
hsa:246100.
UCSCuc004fme.3. human. [P78358-1]

Organism-specific databases

CTD1485.
246100.
GeneCardsGC0XM153845.
GC0XP153813.
HGNCHGNC:24198. CTAG1A.
HGNC:2491. CTAG1B.
HPACAB013061.
CAB015453.
MIM300156. gene.
300657. gene.
neXtProtNX_P78358.
PharmGKBPA134979749.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG78499.
HOGENOMHOG000040003.
HOVERGENHBG051214.
InParanoidP78358.
OMALLMWIMQ.
OrthoDBEOG7M3J33.
PhylomeDBP78358.
TreeFamTF337064.

Gene expression databases

BgeeP78358.
CleanExHS_CTAG1A.
HS_CTAG1B.
GenevestigatorP78358.

Family and domain databases

InterProIPR015419. EKC/KEOPS_Pcc1.
[Graphical view]
PfamPF09341. Pcc1. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

EvolutionaryTraceP78358.
GeneWikiCTAG1B.
NextBio6097.
PROP78358.
SOURCESearch...

Entry information

Entry nameCTG1B_HUMAN
AccessionPrimary (citable) accession number: P78358
Secondary accession number(s): A1L417 expand/collapse secondary AC list , B7WNL9, Q7LBY4, Q9NY13
Entry history
Integrated into UniProtKB/Swiss-Prot: December 15, 1998
Last sequence update: May 1, 1997
Last modified: April 16, 2014
This is version 117 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome X

Human chromosome X: entries, gene names and cross-references to MIM