P78352 (DLG4_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 152.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Disks large homolog 4 Alternative name(s): Postsynaptic density protein 95 Short name=PSD-95 Synapse-associated protein 90 Short name=SAP-90 Short name=SAP90 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 724 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Interacts with the cytoplasmic tail of NMDA receptor subunits and shaker-type potassium channels. Required for synaptic plasticity associated with NMDA receptor signaling. Overexpression or depletion of DLG4 changes the ratio of excitatory to inhibitory synapses in hippocampal neurons. May reduce the amplitude of ASIC3 acid-evoked currents by retaining the channel intracellularly. May regulate the intracellular trafficking of ADR1B By similarity. |
| Subunit structure | Interacts with ANKS1B, KLHL17 and PRR7 By similarity. Interacts through its PDZ domains with NETO1. Interacts through its first two PDZ domains with GRIN2A, GRIN2B, GRIN2C, GRIN2D, ASIC3, certain splice forms of GRIN1, KCND2, CXADR and SYNGAP1. Interacts through its second PDZ domain with the PDZ domain of NOS1 or the C-terminus of CAPON. May interact with HTR2A. Interacts through its guanylate kinase-like domain with DLGAP1/GKAP, DLGAP2, DLGAP3, DLGAP4, MAP1A and BEGAIN. Interacts through its third PDZ domain with CRIPT By similarity. Interacts through its first two PDZ domains with KCNA1, KCNA2, KCNA3, KCNA4 and ERBB4. Interacts through its first PDZ domain with GRIK2, KCNA4 and CRIPT. Interacts through its third PDZ domain with NLGN1, and probably with NLGN2 and NLGN3. Interacts through its guanylate kinase-like domain with KIF13B. Isoform 2 interacts through an L27 domain with HGS/HRS and the first L27 domain of CASK. Interacts with LRFN1, LRFN2 and LRFN4. Interacts with ANO2, ADAM22 and LGI1 By similarity. Interacts with FRMPD4 (via C-terminus). Interacts (via PDZ1 and PDZ2 domains) with LRRC4; LRRC4B and SEMA4C. Interacts (via guanylate kinase-like domain) with SIPA1L1 By similarity. Ref.6 Ref.7 Ref.8 Ref.9 Ref.10 Ref.11 Ref.12 Ref.14 |
| Subcellular location | Cell membrane; Peripheral membrane protein. Cell junction › synapse › postsynaptic cell membrane › postsynaptic density. Cell junction › synapse. Cell junction › synapse › synaptosome By similarity. Note: High levels in postsynaptic density of neurons in the forebrain. Also in presynaptic region of inhibitory synapses formed by cerebellar basket cells on axon hillocks of Purkinje cells. Ref.10 |
| Tissue specificity | Brain. |
| Domain | The PDZ domain 3 mediates interaction with ADR1B. The L27 domain near the N-terminus of isoform 2 is required for HGS/HRS-dependent targeting to postsynaptic density. |
| Post-translational modification | Palmitoylation of isoform 1 is required for targeting to postsynaptic density By similarity. |
| Sequence similarities | Belongs to the MAGUK family. Contains 1 guanylate kinase-like domain. Contains 3 PDZ (DHR) domains. Contains 1 SH3 domain. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| Dlgap1 | P97836-5 | 3 | EBI-80389,EBI-6269434 | From a different organism. |
| ERBB4 | Q15303 | 6 | EBI-80389,EBI-80371 | |
| Kcna1 | P10499 | 2 | EBI-80389,EBI-631463 | From a different organism. |
| Kcna2 | P63142 | 2 | EBI-80389,EBI-631446 | From a different organism. |
| Kcna3 | P15384 | 2 | EBI-80389,EBI-631478 | From a different organism. |
| Kcna4 | P15385 | 9 | EBI-80389,EBI-631417 | From a different organism. |
| KIF1B | O60333-3 | 4 | EBI-80389,EBI-465669 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P78352-1) Also known as: PSD95-alpha; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P78352-2) Also known as: PSD95-beta; The sequence of this isoform differs from the canonical sequence as follows: 1-10: MDCLCIVTTK → MSQRPRAPRSALWLLAPPLLRWAPPLLTVLHSDLFQALLDILDYYEASLSESQ |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 724 | 724 | Disks large homolog 4 | PRO_0000094560 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 65 – 151 | 87 | PDZ 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 160 – 246 | 87 | PDZ 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 313 – 393 | 81 | PDZ 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 428 – 498 | 71 | SH3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 534 – 709 | 176 | Guanylate kinase-like | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 142 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 240 | 1 | Phosphotyrosine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 295 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 397 | 1 | Phosphotyrosine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 415 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 418 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 432 | 1 | Phosphotyrosine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 580 | 1 | Phosphotyrosine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 604 | 1 | Phosphotyrosine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 715 | 1 | Phosphotyrosine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Lipidation | 3 | 1 | S-palmitoyl cysteine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Lipidation | 5 | 1 | S-palmitoyl cysteine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 10 | 10 | MDCLCIVTTK → MSQRPRAPRSALWLLAPPLL RWAPPLLTVLHSDLFQALLD ILDYYEASLSESQ in isoform 2. | VSP_014929 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Isoform 2: | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 46 | 1 | E → V in AAD56173. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 61 – 69 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 72 – 74 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 77 – 81 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 83 – 85 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 87 – 90 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 94 – 99 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 104 – 108 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 116 – 120 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 126 – 128 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 130 – 138 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 142 – 151 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 156 – 164 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 169 – 176 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 178 – 180 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 189 – 194 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 199 – 203 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 211 – 215 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 225 – 233 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 237 – 245 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 312 – 317 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 324 – 329 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 336 – 341 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 346 – 350 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 357 – 362 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 372 – 380 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 384 – 392 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 394 – 401 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human postsynaptic density-95 (PSD95): location of the gene (DLG4) and possible function in nonneural as well as in neural tissues." Stathakis D.G., Hoover K.B., You Z., Bryant P.J. Genomics 44:71-82(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Mammary gland. |
| [2] | Stathakis D.G., Hoover K.H., You Z., Bryant P.J. Submitted (JUL-1998) to the EMBL/GenBank/DDBJ databases Cited for: SEQUENCE REVISION. |
| [3] | "Genomic organization of human DLG4, the gene encoding postsynaptic density 95." Stathakis D.G., Udar N., Sandgren O., Andreasson S., Bryant P.J., Small K., Forsman-Semb K. J. Neurochem. 73:2250-2265(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Cerebellum. |
| [5] | Brenman J.E., Bredt D.S., Parkinson J.F., Manzana W.P., McClary J.A. Submitted (AUG-1996) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 84-398. Tissue: Brain. |
| [6] | "Clustering of Shaker-type K+ channels by interaction with a family of membrane-associated guanylate kinases." Kim E., Niethammer M., Rothschild A., Jan Y.N., Sheng M. Nature 378:85-88(1995) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH KCNA1; KCNA2; KCNA3 AND KCNA4. |
| [7] | "Binding of neuroligins to PSD-95." Irie M., Hata Y., Takeuchi M., Ichtchenko K., Toyoda A., Hirao K., Takai Y., Rosahl T.W., Suedhof T.C. Science 277:1511-1515(1997) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NLGN1; NLGN2 AND NLGN3. |
| [8] | "GAKIN, a novel kinesin-like protein associates with the human homologue of the Drosophila discs large tumor suppressor in T lymphocytes." Hanada T., Lin L., Tibaldi E.V., Reinherz E.L., Chishti A.H. J. Biol. Chem. 275:28774-28784(2000) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH KIF13B. |
| [9] | "The neuregulin receptor ErbB-4 interacts with PDZ-containing proteins at neuronal synapses." Garcia R.A., Vasudevan K., Buonanno A. Proc. Natl. Acad. Sci. U.S.A. 97:3596-3601(2000) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ERBB4. |
| [10] | "Postsynaptic targeting of alternative postsynaptic density-95 isoforms by distinct mechanisms." Chetkovich D.M., Bunn R.C., Kuo S.-H., Kawasaki Y., Kohwi M., Bredt D.S. J. Neurosci. 22:6415-6425(2002) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING, SUBCELLULAR LOCATION, INTERACTION WITH CASK AND HGS. |
| [11] | "SALM synaptic cell adhesion-like molecules regulate the differentiation of excitatory synapses." Ko J., Kim S., Chung H.S., Kim K., Han K., Kim H., Jun H., Kaang B.-K., Kim E. Neuron 50:233-245(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH LRFN1; LRFN2 AND LRFN4. |
| [12] | "Preso, a novel PSD-95-interacting FERM and PDZ domain protein that regulates dendritic spine morphogenesis." Lee H.W., Choi J., Shin H., Kim K., Yang J., Na M., Choi S.Y., Kang G.B., Eom S.H., Kim H., Kim E. J. Neurosci. 28:14546-14556(2008) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH FRMPD4. |
| [13] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [14] | "The PDZ1 domain of SAP90. Characterization of structure and binding." Piserchio A., Pellegrini M., Mehta S., Blackman S.M., Garcia E.P., Marshall J., Mierke D.F. J. Biol. Chem. 277:6967-6973(2002) [PubMed] [Europe PMC] [Abstract] Cited for: STRUCTURE BY NMR OF 105-197, INTERACTION WITH GRIK2; KCNA4 AND CRIPT. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U83192 mRNA. Translation: AAC52113.1. AF156495 Genomic DNA. Translation: AAD56173.1. AK293835 mRNA. Translation: BAH11607.1. U68138 mRNA. Translation: AAB07736.1. Sequence problems. | ||||||||||||||||||||||||||||||
| IPI | IPI00019213. IPI00619928. | ||||||||||||||||||||||||||||||
| PIR | T09599. | ||||||||||||||||||||||||||||||
| RefSeq | NP_001356.1. NM_001365.3. | ||||||||||||||||||||||||||||||
| UniGene | Hs.463928. | ||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||
| ProteinModelPortal | P78352. | ||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||
| DIP | DIP-30919N. | ||||||||||||||||||||||||||||||
| IntAct | P78352. 10 interactions. | ||||||||||||||||||||||||||||||
| MINT | MINT-199061. | ||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000293813. | ||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||
| PhosphoSite | P78352. | ||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||
| DMDM | 71658825. | ||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||
| PaxDb | P78352. | ||||||||||||||||||||||||||||||
| PRIDE | P78352. | ||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||
| Ensembl | ENST00000293813; ENSP00000293813; ENSG00000132535. | ||||||||||||||||||||||||||||||
| GeneID | 1742. | ||||||||||||||||||||||||||||||
| KEGG | hsa:1742. | ||||||||||||||||||||||||||||||
| UCSC | uc002get.4. human. uc010vtn.2. human. | ||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||
| CTD | 1742. | ||||||||||||||||||||||||||||||
| GeneCards | GC17M007033. | ||||||||||||||||||||||||||||||
| HGNC | HGNC:2903. DLG4. | ||||||||||||||||||||||||||||||
| HPA | CAB001999. CAB002000. HPA010122. | ||||||||||||||||||||||||||||||
| MIM | 602887. gene. | ||||||||||||||||||||||||||||||
| neXtProt | NX_P78352. | ||||||||||||||||||||||||||||||
| PharmGKB | PA27359. | ||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||
| eggNOG | COG0194. | ||||||||||||||||||||||||||||||
| HOGENOM | HOG000232102. | ||||||||||||||||||||||||||||||
| HOVERGEN | HBG107814. | ||||||||||||||||||||||||||||||
| KO | K11828. | ||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||
| Reactome | REACT_111045. Developmental Biology. REACT_13685. Neuronal System. | ||||||||||||||||||||||||||||||
| SignaLink | P78352. | ||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||
| ArrayExpress | P78352. | ||||||||||||||||||||||||||||||
| Bgee | P78352. | ||||||||||||||||||||||||||||||
| CleanEx | HS_DLG4. | ||||||||||||||||||||||||||||||
| Genevestigator | P78352. | ||||||||||||||||||||||||||||||
| GermOnline | ENSG00000132535. Homo sapiens. | ||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||
| InterPro | IPR008144. Guanylate_kin. IPR008145. Guanylate_kin/L-typ_Ca_channel. IPR020590. Guanylate_kinase_CS. IPR016313. M-assoc_guanylate_kinase. IPR019590. MAGUK_PEST_N. IPR027417. P-loop_NTPase. IPR001478. PDZ. IPR019583. PDZ_assoc. IPR001452. SH3_domain. [Graphical view] | ||||||||||||||||||||||||||||||
| Pfam | PF00625. Guanylate_kin. 1 hit. PF10608. MAGUK_N_PEST. 2 hits. PF00595. PDZ. 3 hits. PF10600. PDZ_assoc. 1 hit. PF00018. SH3_1. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| PIRSF | PIRSF001741. MAGUK_DLGH. 1 hit. | ||||||||||||||||||||||||||||||
| SMART | SM00072. GuKc. 1 hit. SM00228. PDZ. 3 hits. SM00326. SH3. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| SUPFAM | SSF50156. PDZ. 3 hits. SSF50044. SH3. 1 hit. SSF52540. SSF52540. 1 hit. | ||||||||||||||||||||||||||||||
| PROSITE | PS00856. GUANYLATE_KINASE_1. 1 hit. PS50052. GUANYLATE_KINASE_2. 1 hit. PS50106. PDZ. 3 hits. PS50002. SH3. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||
| BindingDB | P78352. | ||||||||||||||||||||||||||||||
| ChEMBL | CHEMBL5666. | ||||||||||||||||||||||||||||||
| ChiTaRS | DLG4. human. | ||||||||||||||||||||||||||||||
| EvolutionaryTrace | P78352. | ||||||||||||||||||||||||||||||
| GenomeRNAi | 1742. | ||||||||||||||||||||||||||||||
| NextBio | 7067. | ||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||
Entry information
| Entry name | DLG4_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P78352 Secondary accession number(s): B7Z1S1, Q92941, Q9UKK8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
