Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Disks large homolog 4

Gene

DLG4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Interacts with the cytoplasmic tail of NMDA receptor subunits and shaker-type potassium channels. Required for synaptic plasticity associated with NMDA receptor signaling. Overexpression or depletion of DLG4 changes the ratio of excitatory to inhibitory synapses in hippocampal neurons. May reduce the amplitude of ASIC3 acid-evoked currents by retaining the channel intracellularly. May regulate the intracellular trafficking of ADR1B (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Enzyme and pathway databases

BioCyciZFISH:ENSG00000132535-MONOMER.
ReactomeiR-HSA-399719. Trafficking of AMPA receptors.
R-HSA-438066. Unblocking of NMDA receptor, glutamate binding and activation.
R-HSA-442729. CREB phosphorylation through the activation of CaMKII.
R-HSA-442982. Ras activation uopn Ca2+ infux through NMDA receptor.
R-HSA-447038. NrCAM interactions.
R-HSA-451308. Activation of Ca-permeable Kainate Receptor.
R-HSA-5625900. RHO GTPases activate CIT.
R-HSA-5673001. RAF/MAP kinase cascade.
R-HSA-5682910. LGI-ADAM interactions.
R-HSA-6794361. Interactions of neurexins and neuroligins at synapses.
R-HSA-8849932. SALM protein interactions at the synapses.
SignaLinkiP78352.
SIGNORiP78352.

Protein family/group databases

TCDBi8.A.24.1.3. the ezrin/radixin/moesin-binding phosphoprotein 50 (ebp50) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Disks large homolog 4
Alternative name(s):
Postsynaptic density protein 95
Short name:
PSD-95
Synapse-associated protein 90
Short name:
SAP-90
Short name:
SAP90
Gene namesi
Name:DLG4
Synonyms:PSD95
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:2903. DLG4.

Subcellular locationi

  • Cell membrane 1 Publication; Peripheral membrane protein 1 Publication
  • Cell junctionsynapsepostsynaptic cell membranepostsynaptic density 1 Publication
  • Cell projectionaxon By similarity
  • Cell junctionsynapse 1 Publication

  • Note: High levels in postsynaptic density of neurons in the forebrain. Also in presynaptic region of inhibitory synapses formed by cerebellar basket cells on axon hillocks of Purkinje cells.

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cell projection, Membrane, Postsynaptic cell membrane, Synapse

Pathology & Biotechi

Organism-specific databases

DisGeNETi1742.
OpenTargetsiENSG00000132535.
PharmGKBiPA27359.

Chemistry databases

ChEMBLiCHEMBL5666.
DrugBankiDB00536. Guanidine.

Polymorphism and mutation databases

BioMutaiDLG4.
DMDMi71658825.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000945601 – 724Disks large homolog 4Add BLAST724

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Lipidationi3S-palmitoyl cysteineBy similarity1
Lipidationi5S-palmitoyl cysteineBy similarity1
Modified residuei73PhosphoserineBy similarity1
Modified residuei142PhosphoserineBy similarity1
Modified residuei240PhosphotyrosineBy similarity1
Modified residuei295PhosphoserineBy similarity1
Modified residuei415PhosphoserineBy similarity1
Modified residuei418PhosphoserineBy similarity1
Modified residuei420PhosphothreonineBy similarity1
Modified residuei422PhosphoserineBy similarity1
Modified residuei425PhosphoserineBy similarity1
Modified residuei449PhosphoserineBy similarity1
Modified residuei480PhosphoserineBy similarity1
Modified residuei580PhosphotyrosineBy similarity1
Modified residuei606PhosphoserineBy similarity1
Modified residuei654PhosphoserineBy similarity1
Modified residuei715PhosphotyrosineBy similarity1

Post-translational modificationi

Palmitoylation of isoform 1 is required for targeting to postsynaptic density.By similarity

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

MaxQBiP78352.
PaxDbiP78352.
PeptideAtlasiP78352.
PRIDEiP78352.

PTM databases

iPTMnetiP78352.
PhosphoSitePlusiP78352.
SwissPalmiP78352.

Expressioni

Tissue specificityi

Brain.

Gene expression databases

BgeeiENSG00000132535.
CleanExiHS_DLG4.
ExpressionAtlasiP78352. baseline and differential.
GenevisibleiP78352. HS.

Organism-specific databases

HPAiCAB001999.
CAB002000.
HPA010122.

Interactioni

Subunit structurei

Interacts through its PDZ domains with ANO2 and NETO1. Interacts through its first two PDZ domains with GRIN2A, GRIN2B, GRIN2C, GRIN2D, ASIC3, certain splice forms of GRIN1, KCND2, CXADR, SYNGAP1, KCNA1, KCNA2, KCNA3, KCNA4, ERBB4, LRRC4; LRRC4B and SEMA4C. Interacts through its first PDZ domain with GRIK2, KCNA4 and CRIPT. Interacts through its second PDZ domain with the PDZ domain of NOS1 or the C-terminus of CAPON. Interacts through its third PDZ domain with NLGN1 and CRIPT, and probably with NLGN2 and NLGN3. Interacts through its guanylate kinase-like domain with DLGAP1/GKAP, DLGAP2, DLGAP3, DLGAP4, MAP1A, BEGAIN, SIPA1L1 and KIF13B. Isoform 2 interacts through an L27 domain with HGS/HRS and the first L27 domain of CASK. Interacts with ADR1B, ANKS1B and PRR7. May interact with HTR2A. Interacts with ADAM22, KLHL17 and LGI1. Interacts with FRMPD4 (via C-terminus). Interacts with LRFN1, LRFN2 and LRFN4, but not with LRFN3 nor LRFN5. Interacts (via N-terminal tandem pair of PDZ domains) with GPER1 (via C-terminus tail motif); the interaction is direct and induces the increase of GPER1 protein levels residing at the plasma membrane surface in a estradiol-independent manner. Interacts (via N-terminus tandem pair of PDZ domains) with NOS1 (via N-terminal domain). Interacts with SHANK3. Interacts with KCNJ4 (By similarity). Interacts with GPR85 (PubMed:25780553).By similarity8 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
CRIPTQ9P0214EBI-80389,EBI-946968
DLGAP1O144905EBI-80389,EBI-1753207
Dlgap1P97836-53EBI-80389,EBI-6269434From a different organism.
ERBB4Q153036EBI-80389,EBI-80371
Gpsm2Q8VDU07EBI-80389,EBI-7575403From a different organism.
GRIN2AQ128793EBI-80389,EBI-7249937
GRIN2BQ132242EBI-80389,EBI-2256942
GRIN2CQ149574EBI-80389,EBI-8285963
KCNA1Q094702EBI-80389,EBI-8286599
Kcna1P104992EBI-80389,EBI-631463From a different organism.
Kcna2P631422EBI-80389,EBI-631446From a different organism.
Kcna3P153842EBI-80389,EBI-631478From a different organism.
KCNA4P224592EBI-80389,EBI-631235
Kcna4P153859EBI-80389,EBI-631417From a different organism.
KIF1BO60333-34EBI-80389,EBI-465669
MDM2Q009873EBI-80389,EBI-389668

GO - Molecular functioni

Protein-protein interaction databases

BioGridi108086. 85 interactors.
DIPiDIP-30919N.
IntActiP78352. 33 interactors.
MINTiMINT-199061.
STRINGi9606.ENSP00000293813.

Chemistry databases

BindingDBiP78352.

Structurei

Secondary structure

1724
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi2 – 15Combined sources14
Beta strandi61 – 69Combined sources9
Beta strandi72 – 74Combined sources3
Beta strandi77 – 81Combined sources5
Beta strandi83 – 85Combined sources3
Beta strandi87 – 90Combined sources4
Beta strandi94 – 99Combined sources6
Helixi104 – 108Combined sources5
Beta strandi116 – 120Combined sources5
Beta strandi126 – 128Combined sources3
Helixi130 – 138Combined sources9
Beta strandi142 – 151Combined sources10
Beta strandi156 – 164Combined sources9
Beta strandi169 – 176Combined sources8
Beta strandi178 – 180Combined sources3
Beta strandi189 – 194Combined sources6
Helixi199 – 203Combined sources5
Beta strandi211 – 215Combined sources5
Helixi225 – 233Combined sources9
Beta strandi237 – 245Combined sources9
Beta strandi312 – 317Combined sources6
Beta strandi324 – 329Combined sources6
Beta strandi336 – 341Combined sources6
Helixi346 – 350Combined sources5
Beta strandi357 – 362Combined sources6
Helixi372 – 380Combined sources9
Beta strandi384 – 392Combined sources9
Helixi394 – 401Combined sources8

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1KEFNMR-A62-154[»]
2MESNMR-B1-71[»]
3I4WX-ray1.35A/B/C/D302-403[»]
3K82X-ray1.40A305-402[»]
3ZRTX-ray3.40A/B/C/D61-249[»]
5JXBX-ray2.90A/C309-413[»]
ProteinModelPortaliP78352.
SMRiP78352.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP78352.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini65 – 151PDZ 1PROSITE-ProRule annotationAdd BLAST87
Domaini160 – 246PDZ 2PROSITE-ProRule annotationAdd BLAST87
Domaini313 – 393PDZ 3PROSITE-ProRule annotationAdd BLAST81
Domaini428 – 498SH3PROSITE-ProRule annotationAdd BLAST71
Domaini534 – 709Guanylate kinase-likePROSITE-ProRule annotationAdd BLAST176

Domaini

The PDZ domain 3 mediates interaction with ADR1B.
The L27 domain near the N-terminus of isoform 2 is required for HGS/HRS-dependent targeting to postsynaptic density.

Sequence similaritiesi

Belongs to the MAGUK family.Curated
Contains 1 guanylate kinase-like domain.PROSITE-ProRule annotation
Contains 3 PDZ (DHR) domains.PROSITE-ProRule annotation
Contains 1 SH3 domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, SH3 domain

Phylogenomic databases

eggNOGiKOG0708. Eukaryota.
COG0194. LUCA.
GeneTreeiENSGT00760000118866.
HOGENOMiHOG000232102.
HOVERGENiHBG107814.
InParanoidiP78352.
KOiK11828.
OMAiHREPRRI.
OrthoDBiEOG091G0BB1.
PhylomeDBiP78352.
TreeFamiTF323171.

Family and domain databases

Gene3Di2.30.42.10. 3 hits.
3.40.50.300. 2 hits.
InterProiIPR016313. DLG1.
IPR019590. DLG1_PEST_dom.
IPR008145. GK/Ca_channel_bsu.
IPR008144. Guanylate_kin-like_dom.
IPR020590. Guanylate_kinase_CS.
IPR027417. P-loop_NTPase.
IPR001478. PDZ.
IPR019583. PDZ_assoc.
IPR001452. SH3_domain.
[Graphical view]
PANTHERiPTHR23119:SF33. PTHR23119:SF33. 1 hit.
PfamiPF00625. Guanylate_kin. 1 hit.
PF10608. MAGUK_N_PEST. 1 hit.
PF00595. PDZ. 3 hits.
PF10600. PDZ_assoc. 1 hit.
PF00018. SH3_1. 1 hit.
[Graphical view]
SMARTiSM00072. GuKc. 1 hit.
SM01277. MAGUK_N_PEST. 1 hit.
SM00228. PDZ. 3 hits.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 1 hit.
SSF50156. SSF50156. 3 hits.
SSF52540. SSF52540. 1 hit.
PROSITEiPS00856. GUANYLATE_KINASE_1. 1 hit.
PS50052. GUANYLATE_KINASE_2. 1 hit.
PS50106. PDZ. 3 hits.
PS50002. SH3. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P78352-1) [UniParc]FASTAAdd to basket
Also known as: PSD95-alpha

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDCLCIVTTK KYRYQDEDTP PLEHSPAHLP NQANSPPVIV NTDTLEAPGY
60 70 80 90 100
ELQVNGTEGE MEYEEITLER GNSGLGFSIA GGTDNPHIGD DPSIFITKII
110 120 130 140 150
PGGAAAQDGR LRVNDSILFV NEVDVREVTH SAAVEALKEA GSIVRLYVMR
160 170 180 190 200
RKPPAEKVME IKLIKGPKGL GFSIAGGVGN QHIPGDNSIY VTKIIEGGAA
210 220 230 240 250
HKDGRLQIGD KILAVNSVGL EDVMHEDAVA ALKNTYDVVY LKVAKPSNAY
260 270 280 290 300
LSDSYAPPDI TTSYSQHLDN EISHSSYLGT DYPTAMTPTS PRRYSPVAKD
310 320 330 340 350
LLGEEDIPRE PRRIVIHRGS TGLGFNIVGG EDGEGIFISF ILAGGPADLS
360 370 380 390 400
GELRKGDQIL SVNGVDLRNA SHEQAAIALK NAGQTVTIIA QYKPEEYSRF
410 420 430 440 450
EAKIHDLREQ LMNSSLGSGT ASLRSNPKRG FYIRALFDYD KTKDCGFLSQ
460 470 480 490 500
ALSFRFGDVL HVIDASDEEW WQARRVHSDS ETDDIGFIPS KRRVERREWS
510 520 530 540 550
RLKAKDWGSS SGSQGREDSV LSYETVTQME VHYARPIIIL GPTKDRANDD
560 570 580 590 600
LLSEFPDKFG SCVPHTTRPK REYEIDGRDY HFVSSREKME KDIQAHKFIE
610 620 630 640 650
AGQYNSHLYG TSVQSVREVA EQGKHCILDV SANAVRRLQA AHLHPIAIFI
660 670 680 690 700
RPRSLENVLE INKRITEEQA RKAFDRATKL EQEFTECFSA IVEGDSFEEI
710 720
YHKVKRVIED LSGPYIWVPA RERL
Length:724
Mass (Da):80,495
Last modified:August 2, 2005 - v3
Checksum:i7922D3F220F9A101
GO
Isoform 2 (identifier: P78352-2) [UniParc]FASTAAdd to basket
Also known as: PSD95-beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-10: MDCLCIVTTK → MSQRPRAPRSALWLLAPPLLRWAPPLLTVLHSDLFQALLDILDYYEASLSESQ

Show »
Length:767
Mass (Da):85,430
Checksum:iBE1019159E65B2D8
GO
Isoform 3 (identifier: P78352-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     51-53: Missing.

Show »
Length:721
Mass (Da):80,125
Checksum:i608104D1BF7AE2C7
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Isoform 2 (identifier: P78352-2)
Sequence conflicti46E → V in AAD56173 (PubMed:10582582).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0149291 – 10MDCLCIVTTK → MSQRPRAPRSALWLLAPPLL RWAPPLLTVLHSDLFQALLD ILDYYEASLSESQ in isoform 2. 1 Publication10
Alternative sequenceiVSP_04724751 – 53Missing in isoform 3. Curated3

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U83192 mRNA. Translation: AAC52113.1.
AF156495 Genomic DNA. Translation: AAD56173.1.
AK293835 mRNA. Translation: BAH11607.1.
AC120057 Genomic DNA. No translation available.
CH471108 Genomic DNA. Translation: EAW90255.1.
U68138 mRNA. Translation: AAB07736.1. Sequence problems.
CCDSiCCDS45599.1. [P78352-2]
CCDS45600.1. [P78352-3]
CCDS82050.1. [P78352-1]
PIRiT09599.
RefSeqiNP_001122299.1. NM_001128827.2. [P78352-3]
NP_001308004.1. NM_001321075.1. [P78352-1]
NP_001356.1. NM_001365.4. [P78352-2]
UniGeneiHs.463928.

Genome annotation databases

EnsembliENST00000302955; ENSP00000307471; ENSG00000132535. [P78352-3]
ENST00000399506; ENSP00000382425; ENSG00000132535. [P78352-1]
ENST00000399510; ENSP00000382428; ENSG00000132535. [P78352-2]
GeneIDi1742.
KEGGihsa:1742.
UCSCiuc002get.5. human. [P78352-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U83192 mRNA. Translation: AAC52113.1.
AF156495 Genomic DNA. Translation: AAD56173.1.
AK293835 mRNA. Translation: BAH11607.1.
AC120057 Genomic DNA. No translation available.
CH471108 Genomic DNA. Translation: EAW90255.1.
U68138 mRNA. Translation: AAB07736.1. Sequence problems.
CCDSiCCDS45599.1. [P78352-2]
CCDS45600.1. [P78352-3]
CCDS82050.1. [P78352-1]
PIRiT09599.
RefSeqiNP_001122299.1. NM_001128827.2. [P78352-3]
NP_001308004.1. NM_001321075.1. [P78352-1]
NP_001356.1. NM_001365.4. [P78352-2]
UniGeneiHs.463928.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1KEFNMR-A62-154[»]
2MESNMR-B1-71[»]
3I4WX-ray1.35A/B/C/D302-403[»]
3K82X-ray1.40A305-402[»]
3ZRTX-ray3.40A/B/C/D61-249[»]
5JXBX-ray2.90A/C309-413[»]
ProteinModelPortaliP78352.
SMRiP78352.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi108086. 85 interactors.
DIPiDIP-30919N.
IntActiP78352. 33 interactors.
MINTiMINT-199061.
STRINGi9606.ENSP00000293813.

Chemistry databases

BindingDBiP78352.
ChEMBLiCHEMBL5666.
DrugBankiDB00536. Guanidine.

Protein family/group databases

TCDBi8.A.24.1.3. the ezrin/radixin/moesin-binding phosphoprotein 50 (ebp50) family.

PTM databases

iPTMnetiP78352.
PhosphoSitePlusiP78352.
SwissPalmiP78352.

Polymorphism and mutation databases

BioMutaiDLG4.
DMDMi71658825.

Proteomic databases

MaxQBiP78352.
PaxDbiP78352.
PeptideAtlasiP78352.
PRIDEiP78352.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000302955; ENSP00000307471; ENSG00000132535. [P78352-3]
ENST00000399506; ENSP00000382425; ENSG00000132535. [P78352-1]
ENST00000399510; ENSP00000382428; ENSG00000132535. [P78352-2]
GeneIDi1742.
KEGGihsa:1742.
UCSCiuc002get.5. human. [P78352-1]

Organism-specific databases

CTDi1742.
DisGeNETi1742.
GeneCardsiDLG4.
HGNCiHGNC:2903. DLG4.
HPAiCAB001999.
CAB002000.
HPA010122.
MIMi602887. gene.
neXtProtiNX_P78352.
OpenTargetsiENSG00000132535.
PharmGKBiPA27359.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0708. Eukaryota.
COG0194. LUCA.
GeneTreeiENSGT00760000118866.
HOGENOMiHOG000232102.
HOVERGENiHBG107814.
InParanoidiP78352.
KOiK11828.
OMAiHREPRRI.
OrthoDBiEOG091G0BB1.
PhylomeDBiP78352.
TreeFamiTF323171.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000132535-MONOMER.
ReactomeiR-HSA-399719. Trafficking of AMPA receptors.
R-HSA-438066. Unblocking of NMDA receptor, glutamate binding and activation.
R-HSA-442729. CREB phosphorylation through the activation of CaMKII.
R-HSA-442982. Ras activation uopn Ca2+ infux through NMDA receptor.
R-HSA-447038. NrCAM interactions.
R-HSA-451308. Activation of Ca-permeable Kainate Receptor.
R-HSA-5625900. RHO GTPases activate CIT.
R-HSA-5673001. RAF/MAP kinase cascade.
R-HSA-5682910. LGI-ADAM interactions.
R-HSA-6794361. Interactions of neurexins and neuroligins at synapses.
R-HSA-8849932. SALM protein interactions at the synapses.
SignaLinkiP78352.
SIGNORiP78352.

Miscellaneous databases

ChiTaRSiDLG4. human.
EvolutionaryTraceiP78352.
GeneWikiiDLG4.
GenomeRNAii1742.
PROiP78352.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000132535.
CleanExiHS_DLG4.
ExpressionAtlasiP78352. baseline and differential.
GenevisibleiP78352. HS.

Family and domain databases

Gene3Di2.30.42.10. 3 hits.
3.40.50.300. 2 hits.
InterProiIPR016313. DLG1.
IPR019590. DLG1_PEST_dom.
IPR008145. GK/Ca_channel_bsu.
IPR008144. Guanylate_kin-like_dom.
IPR020590. Guanylate_kinase_CS.
IPR027417. P-loop_NTPase.
IPR001478. PDZ.
IPR019583. PDZ_assoc.
IPR001452. SH3_domain.
[Graphical view]
PANTHERiPTHR23119:SF33. PTHR23119:SF33. 1 hit.
PfamiPF00625. Guanylate_kin. 1 hit.
PF10608. MAGUK_N_PEST. 1 hit.
PF00595. PDZ. 3 hits.
PF10600. PDZ_assoc. 1 hit.
PF00018. SH3_1. 1 hit.
[Graphical view]
SMARTiSM00072. GuKc. 1 hit.
SM01277. MAGUK_N_PEST. 1 hit.
SM00228. PDZ. 3 hits.
SM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 1 hit.
SSF50156. SSF50156. 3 hits.
SSF52540. SSF52540. 1 hit.
PROSITEiPS00856. GUANYLATE_KINASE_1. 1 hit.
PS50052. GUANYLATE_KINASE_2. 1 hit.
PS50106. PDZ. 3 hits.
PS50002. SH3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiDLG4_HUMAN
AccessioniPrimary (citable) accession number: P78352
Secondary accession number(s): B7Z1S1
, G5E939, Q92941, Q9UKK8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: August 2, 2005
Last modified: November 30, 2016
This is version 191 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.