P78348 (ACCN2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 104.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Amiloride-sensitive cation channel 2, neuronal Alternative name(s): Acid-sensing ion channel 1 Short name=ASIC1 Brain sodium channel 2 Short name=BNaC2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 528 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Cation channel with high affinity for sodium, which is gated by extracellular protons and inhibited by the diuretic amiloride. Also permeable for Ca2+, Li+ and K+. Generates a biphasic current with a fast inactivating and a slow sustained phase. Mediates glutamate-independent Ca2+ entry into neurons upon acidosis. This Ca2+ overloading is toxic for cortical neurons and may be in part responsible for ischemic brain injury. Heteromeric channel assembly seems to modulate channel properties. Functions as a postsynaptic proton receptor that influences intracellular Ca2+ concentration and calmodulin-dependent protein kinase II phosphorylation and thereby the density of dendritic spines. Modulates activity in the circuits underlying innate fear By similarity. |
| Subunit structure | Homotrimer or heterotrimer with other ASIC proteins By similarity. Interacts with STOM and ACCN1 By similarity. Interacts with PRKCABP. Ref.7 Ref.9 |
| Subcellular location | Cell membrane; Multi-pass membrane protein By similarity. Note: Localizes in synaptosomes at dendritic synapses of neurons. Colocalizes with DLG4 By similarity. Ref.9 |
| Tissue specificity | Expressed in most or all neurons. |
| Post-translational modification | Phosphorylation by PKA regulates interaction with PRKCABP and subcellular location. Phosphorylation by PKC may regulate the channel. |
| Miscellaneous | Potentiated by Ca2+, Mg2+, Ba2+ and multivalent cations. Inhibited by anti-inflammatory drugs like salicylic acid By similarity. Potentiated by FMRFamide-related neuropeptides. PH dependence may be regulated by serine proteases. |
| Sequence similarities | Belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. ACCN2 subfamily. [View classification] |
Ontologies
| Keywords | |
|---|---|
| Biological process | Calcium transport Ion transport Sodium transport Transport |
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane Transmembrane helix |
| Ligand | Calcium Sodium |
| Molecular function | Ionic channel Sodium channel |
| PTM | Disulfide bond Glycoprotein Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | calcium ion transport Inferred from electronic annotation. Source: UniProtKB-KW response to pHTraceable author statement. Source: ProtInc signal transductionTraceable author statement. Source: ProtInc |
| Cellular component | integral to plasma membrane Traceable author statement. Source: ProtInc |
| Molecular function | ligand-gated sodium channel activity Non-traceable author statement. Source: UniProtKB protein bindingInferred from physical interaction Ref.7. Source: IntAct |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| PICK1 | Q9NRD5 | 3 | EBI-79189,EBI-79165 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] Note: The splice variant from ASIC1a described in mouse and rat, which gives rise to an isoform with different N-termini (Asic1b), does not seem to exist in human. | ||||||
| Isoform 2 (identifier: P78348-2) Also known as: Asic1a; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 (identifier: P78348-1) The sequence of this isoform differs from the canonical sequence as follows: 433-433: G → GELLMTPVPFSCHGHGVAPYHPKAGCSLLSHEGPPPQRPFPKPCCLG |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 528 | 528 | Amiloride-sensitive cation channel 2, neuronal | PRO_0000181294 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 45 | 45 | Cytoplasmic By similarity | ||||||||
| Transmembrane | 46 – 69 | 24 | Helical; By similarity | ||||||||
| Topological domain | 70 – 427 | 358 | Extracellular By similarity | ||||||||
| Transmembrane | 428 – 454 | 27 | Helical; By similarity | ||||||||
| Topological domain | 455 – 528 | 74 | Cytoplasmic By similarity | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 479 | 1 | Phosphoserine; by PKA Ref.9 | ||||||||
| Glycosylation | 368 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 395 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 93 ↔ 194 | By similarity | |||||||||
| Disulfide bond | 172 ↔ 179 | By similarity | |||||||||
| Disulfide bond | 290 ↔ 367 | By similarity | |||||||||
| Disulfide bond | 310 ↔ 363 | By similarity | |||||||||
| Disulfide bond | 314 ↔ 361 | By similarity | |||||||||
| Disulfide bond | 323 ↔ 345 | By similarity | |||||||||
| Disulfide bond | 325 ↔ 337 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 433 | 1 | G → GELLMTPVPFSCHGHGVAPY HPKAGCSLLSHEGPPPQRPF PKPCCLG in isoform 1. | VSP_015596 | |||||||
Experimental info | |||||||||||
| Mutagenesis | 478 | 1 | S → A: No effect on phosphorylation. Ref.9 | ||||||||
| Mutagenesis | 479 | 1 | S → A: Loss of phosphorylation. Ref.9 | ||||||||
| Sequence conflict | 212 | 1 | G → D in AAB48980. Ref.1 | ||||||||
| Sequence conflict | 212 | 1 | G → D in AAB48981. Ref.1 | ||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "BNaC1 and BNaC2 constitute a new family of human neuronal sodium channels related to degenerins and epithelial sodium channels." Garcia-Anoveros J., Derfler B.H., Neville-Golden J., Hyman B.T., Corey D.P. Proc. Natl. Acad. Sci. U.S.A. 94:1459-1464(1997) [PubMed: 9037075] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). Tissue: Brain. |
| [2] | "Acid sensing ion channels in human taste tissue." Huque T., Cao J., Lischka F.W., Spielman A.I., Feldman R.S., Cowart B.J., Wise P.M., Pribitkin E.A., Mackler S.A., Brand J.G. Submitted (AUG-2007) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA]. |
| [3] | "The finished DNA sequence of human chromosome 12." Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. Gibbs R.A.Nature 440:346-351(2006) [PubMed: 16541075] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 231-528 (ISOFORM 1). Tissue: Ovary. |
| [6] | "Neuropeptide FF and FMRFamide potentiate acid-evoked currents from sensory neurons and proton-gated DEG/ENaC channels." Askwith C.C., Cheng C., Ikuma M., Benson C., Price M.P., Welsh M.J. Neuron 26:133-141(2000) [PubMed: 10798398] [Abstract] Cited for: REGULATION BY FMRFAMIDE-RELATED PEPTIDES. |
| [7] | "Interaction of the synaptic protein PICK1 (protein interacting with C kinase 1) with the non-voltage gated sodium channels BNC1 (brain Na+ channel 1) and ASIC (acid-sensing ion channel)." Hruska-Hageman A.M., Wemmie J.A., Price M.P., Welsh M.J. Biochem. J. 361:443-450(2002) [PubMed: 11802773] [Abstract] Cited for: INTERACTION WITH PRKCABP. |
| [8] | "Protein kinase C isoform antagonism controls BNaC2 (ASIC1) function." Berdiev B.K., Xia J., Jovov B., Markert J.M., Mapstone T.B., Gillespie G.Y., Fuller C.M., Bubien J.K., Benos D.J. J. Biol. Chem. 277:45734-45740(2002) [PubMed: 12244121] [Abstract] Cited for: PHOSPHORYLATION BY PKC. |
| [9] | "cAMP-dependent protein kinase phosphorylation of the acid-sensing ion channel-1 regulates its binding to the protein interacting with C-kinase-1." Leonard A.S., Yermolaieva O., Hruska-Hageman A., Askwith C.C., Price M.P., Wemmie J.A., Welsh M.J. Proc. Natl. Acad. Sci. U.S.A. 100:2029-2034(2003) [PubMed: 12578970] [Abstract] Cited for: PHOSPHORYLATION BY PKA, MUTAGENESIS OF SER-478 AND SER-479, PHOSPHORYLATION AT SER-479, INTERACTION WITH PRKCABP, SUBCELLULAR LOCATION. |
| [10] | "Selective regulation of acid-sensing ion channel 1 by serine proteases." Poirot O., Vukicevic M., Boesch A., Kellenberger S. J. Biol. Chem. 279:38448-38457(2004) [PubMed: 15247234] [Abstract] Cited for: REGULATION BY SERINE PROTEASES. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U78180 mRNA. Translation: AAB48980.1. U78181 mRNA. Translation: AAB48981.1. EU078959 mRNA. Translation: ABU48925.1. AC025154 Genomic DNA. No translation available. CH471111 Genomic DNA. Translation: EAW58118.1. BC013891 mRNA. Translation: AAH13891.2. BC133707 mRNA. Translation: AAI33708.1. |
| IPI | IPI00293398. IPI00293399. |
| RefSeq | NP_001086.2. NM_001095.2. NP_064423.2. NM_020039.2. |
| UniGene | Hs.274361. |
3D structure databases | |
| ProteinModelPortal | P78348. |
| SMR | P78348. Positions 40-462. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P78348. 1 interaction. |
| STRING | P78348. |
Polymorphism databases | |
| DMDM | 296439456. |
Proteomic databases | |
| PRIDE | P78348. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000447966; ENSP00000400228; ENSG00000110881. |
| GeneID | 41. |
| KEGG | hsa:41. |
| UCSC | uc001rvv.1. human. |
Organism-specific databases | |
| CTD | 41. |
| GeneCards | GC12P050451. |
| HGNC | HGNC:100. ACCN2. |
| MIM | 602866. gene. |
| neXtProt | NX_P78348. |
| PharmGKB | PA24434. |
| GenAtlas | Search... |
Phylogenomic databases | |
| GeneTree | ENSGT00550000074208. |
| HOVERGEN | HBG004150. |
| OMA | PVPFPCH. |
Gene expression databases | |
| ArrayExpress | P78348. |
| Bgee | P78348. |
| CleanEx | HS_ACCN2. |
| Genevestigator | P78348. |
Family and domain databases | |
| InterPro | IPR004724. EnaC. IPR001873. Na+channel_ASC. IPR020903. Na+channel_ASC_CS. [Graphical view] |
| KO | K04829. |
| PANTHER | PTHR11690. Na+channel_ASC. 1 hit. |
| Pfam | PF00858. ASC. 1 hit. [Graphical view] |
| PRINTS | PR01078. AMINACHANNEL. |
| TIGRFAMs | TIGR00859. ENaC. 1 hit. |
| PROSITE | PS01206. ASC. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| DrugBank | DB00594. Amiloride. |
| NextBio | 167. |
| SOURCE | Search... |
Entry information
| Entry name | ACCN2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P78348 Secondary accession number(s): A3KN86, P78349, Q96CV2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with