Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ribonuclease P protein subunit p30

Gene

RPP30

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends.

Miscellaneous

Autoantibodies against RPP30 are found in sera from scleroderma patients.

Catalytic activityi

Endonucleolytic cleavage of RNA, removing 5'-extranucleotides from tRNA precursor.

GO - Molecular functioni

  • ribonuclease P activity Source: ProtInc
  • RNA binding Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionHydrolase
Biological processtRNA processing

Enzyme and pathway databases

ReactomeiR-HSA-6784531 tRNA processing in the nucleus
R-HSA-6791226 Major pathway of rRNA processing in the nucleolus and cytosol

Names & Taxonomyi

Protein namesi
Recommended name:
Ribonuclease P protein subunit p30 (EC:3.1.26.5)
Short name:
RNaseP protein p30
Alternative name(s):
RNase P subunit 2
Gene namesi
Name:RPP30
Synonyms:RNASEP2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

EuPathDBiHostDB:ENSG00000148688.13
HGNCiHGNC:17688 RPP30
MIMi606115 gene
neXtProtiNX_P78346

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000148688
PharmGKBiPA134876345

Polymorphism and mutation databases

BioMutaiRPP30

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources2 Publications
ChainiPRO_00001400312 – 268Ribonuclease P protein subunit p30Add BLAST267

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources2 Publications1
Modified residuei251PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiP78346
MaxQBiP78346
PaxDbiP78346
PeptideAtlasiP78346
PRIDEiP78346
TopDownProteomicsiP78346-1 [P78346-1]

PTM databases

iPTMnetiP78346
PhosphoSitePlusiP78346
SwissPalmiP78346

Expressioni

Gene expression databases

BgeeiENSG00000148688
CleanExiHS_RPP30
ExpressionAtlasiP78346 baseline and differential
GenevisibleiP78346 HS

Organism-specific databases

HPAiHPA037578

Interactioni

Subunit structurei

RNase P consists of an RNA moiety and at least 8 protein subunits; POP1, RPP14, RPP20/POP7, RPP25, RPP29/POP4, RPP30, RPP38 and RPP40.

Binary interactionsi

WithEntry#Exp.IntActNotes
HMG20AQ9NP665EBI-366553,EBI-740641

Protein-protein interaction databases

BioGridi115807, 35 interactors
CORUMiP78346
IntActiP78346, 16 interactors
MINTiP78346
STRINGi9606.ENSP00000389182

Structurei

3D structure databases

ProteinModelPortaliP78346
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG2363 Eukaryota
COG1603 LUCA
GeneTreeiENSGT00390000000883
HOGENOMiHOG000157793
HOVERGENiHBG010226
InParanoidiP78346
KOiK03539
OMAiCKKAKCE
OrthoDBiEOG091G0LMY
PhylomeDBiP78346
TreeFamiTF106113

Family and domain databases

InterProiView protein in InterPro
IPR016195 Pol/histidinol_Pase-like
IPR002738 RNase_P_p30
PANTHERiPTHR13031 PTHR13031, 1 hit
PfamiView protein in Pfam
PF01876 RNase_P_p30, 1 hit
SUPFAMiSSF89550 SSF89550, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P78346-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAVFADLDLR AGSDLKALRG LVETAAHLGY SVVAINHIVD FKEKKQEIEK
60 70 80 90 100
PVAVSELFTT LPIVQGKSRP IKILTRLTII VSDPSHCNVL RATSSRARLY
110 120 130 140 150
DVVAVFPKTE KLFHIACTHL DVDLVCITVT EKLPFYFKRP PINVAIDRGL
160 170 180 190 200
AFELVYSPAI KDSTMRRYTI SSALNLMQIC KGKNVIISSA AERPLEIRGP
210 220 230 240 250
YDVANLGLLF GLSESDAKAA VSTNCRAALL HGETRKTAFG IISTVKKPRP
260
SEGDEDCLPA SKKAKCEG
Length:268
Mass (Da):29,321
Last modified:May 1, 1997 - v1
Checksum:i2AB492D98ACDCCBB
GO
Isoform 2 (identifier: P78346-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     266-268: CEG → WSHSVTQAGVQWHNLGSLQPLPLGLKPSSHLSLPRTRIQQRQLLISHQRDHTPKNRL

Note: No experimental confirmation available.Curated
Show »
Length:322
Mass (Da):35,564
Checksum:iB6700D9E4A95C181
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti65Q → R in AK225532 (Ref. 3) Curated1
Sequence conflicti189S → I AA sequence (PubMed:9037013).Curated1
Isoform 2 (identifier: P78346-2)
Sequence conflicti291K → R in AK225532 (Ref. 3) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05187012G → D. Corresponds to variant dbSNP:rs11544145Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_045673266 – 268CEG → WSHSVTQAGVQWHNLGSLQP LPLGLKPSSHLSLPRTRIQQ RQLLISHQRDHTPKNRL in isoform 2. 1 Publication3

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U77665 mRNA Translation: AAC51143.1
AK312900 mRNA Translation: BAG35746.1
AK225532 mRNA No translation available.
AL590622 Genomic DNA No translation available.
CH471066 Genomic DNA Translation: EAW50117.1
BC006991 mRNA Translation: AAH06991.1
CCDSiCCDS44458.1 [P78346-2]
CCDS7411.1 [P78346-1]
RefSeqiNP_001098016.1, NM_001104546.1 [P78346-2]
NP_006404.1, NM_006413.4 [P78346-1]
XP_011537422.1, XM_011539120.2 [P78346-2]
XP_011537423.1, XM_011539121.2 [P78346-2]
XP_016870964.1, XM_017015475.1 [P78346-2]
XP_016870966.1, XM_017015477.1 [P78346-1]
UniGeneiHs.139120

Genome annotation databases

EnsembliENST00000371703; ENSP00000360768; ENSG00000148688 [P78346-1]
ENST00000413330; ENSP00000389182; ENSG00000148688 [P78346-2]
GeneIDi10556
KEGGihsa:10556
UCSCiuc009xtx.4 human [P78346-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiRPP30_HUMAN
AccessioniPrimary (citable) accession number: P78346
Secondary accession number(s): B2R799, E9PB02
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: May 1, 1997
Last modified: May 23, 2018
This is version 163 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health