SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P78346

- RPP30_HUMAN

UniProt

P78346 - RPP30_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Ribonuclease P protein subunit p30
Gene
RPP30, RNASEP2
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends.

Catalytic activityi

Endonucleolytic cleavage of RNA, removing 5'-extranucleotides from tRNA precursor.

GO - Molecular functioni

  1. poly(A) RNA binding Source: UniProtKB
  2. ribonuclease P activity Source: ProtInc
Complete GO annotation...

GO - Biological processi

  1. RNA phosphodiester bond hydrolysis Source: GOC
  2. RNA phosphodiester bond hydrolysis, endonucleolytic Source: GOC
  3. tRNA processing Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Biological processi

tRNA processing

Names & Taxonomyi

Protein namesi
Recommended name:
Ribonuclease P protein subunit p30 (EC:3.1.26.5)
Short name:
RNaseP protein p30
Alternative name(s):
RNase P subunit 2
Gene namesi
Name:RPP30
Synonyms:RNASEP2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 10

Organism-specific databases

HGNCiHGNC:17688. RPP30.

Subcellular locationi

Nucleusnucleolus Reviewed prediction

GO - Cellular componenti

  1. nucleolar ribonuclease P complex Source: ProtInc
  2. nucleus Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134876345.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed1 Publication
Chaini2 – 268267Ribonuclease P protein subunit p30
PRO_0000140031Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylalanine2 Publications
Modified residuei251 – 2511Phosphoserine3 Publications

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiP78346.
PaxDbiP78346.
PRIDEiP78346.

PTM databases

PhosphoSiteiP78346.

Expressioni

Gene expression databases

ArrayExpressiP78346.
BgeeiP78346.
CleanExiHS_RPP30.
GenevestigatoriP78346.

Organism-specific databases

HPAiHPA037578.

Interactioni

Subunit structurei

RNase P consists of an RNA moiety and at least 8 protein subunits; POP1, RPP14, RPP20/POP7, RPP25, RPP29/POP4, RPP30, RPP38 and RPP40.

Protein-protein interaction databases

BioGridi115807. 21 interactions.
IntActiP78346. 3 interactions.
MINTiMINT-3023090.
STRINGi9606.ENSP00000389182.

Structurei

3D structure databases

ProteinModelPortaliP78346.

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiCOG1603.
HOGENOMiHOG000157793.
HOVERGENiHBG010226.
KOiK03539.
OMAiGVCFELV.
OrthoDBiEOG73FQNP.
PhylomeDBiP78346.
TreeFamiTF106113.

Family and domain databases

InterProiIPR016195. Pol/histidinol_Pase-like.
IPR002738. RNase_P_p30.
[Graphical view]
PANTHERiPTHR13031. PTHR13031. 1 hit.
PfamiPF01876. RNase_P_p30. 1 hit.
[Graphical view]
SUPFAMiSSF89550. SSF89550. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P78346-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAVFADLDLR AGSDLKALRG LVETAAHLGY SVVAINHIVD FKEKKQEIEK    50
PVAVSELFTT LPIVQGKSRP IKILTRLTII VSDPSHCNVL RATSSRARLY 100
DVVAVFPKTE KLFHIACTHL DVDLVCITVT EKLPFYFKRP PINVAIDRGL 150
AFELVYSPAI KDSTMRRYTI SSALNLMQIC KGKNVIISSA AERPLEIRGP 200
YDVANLGLLF GLSESDAKAA VSTNCRAALL HGETRKTAFG IISTVKKPRP 250
SEGDEDCLPA SKKAKCEG 268
Length:268
Mass (Da):29,321
Last modified:May 1, 1997 - v1
Checksum:i2AB492D98ACDCCBB
GO
Isoform 2 (identifier: P78346-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     266-268: CEG → WSHSVTQAGVQWHNLGSLQPLPLGLKPSSHLSLPRTRIQQRQLLISHQRDHTPKNRL

Note: No experimental confirmation available.

Show »
Length:322
Mass (Da):35,564
Checksum:iB6700D9E4A95C181
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti12 – 121G → D.
Corresponds to variant rs11544145 [ dbSNP | Ensembl ].
VAR_051870

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei266 – 2683CEG → WSHSVTQAGVQWHNLGSLQP LPLGLKPSSHLSLPRTRIQQ RQLLISHQRDHTPKNRL in isoform 2.
VSP_045673

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti65 – 651Q → R in AK225532. 1 Publication
Sequence conflicti189 – 1891S → I AA sequence 1 Publication
Isoform 2 (identifier: P78346-2)
Sequence conflicti291 – 2911K → R in AK225532. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U77665 mRNA. Translation: AAC51143.1.
AK312900 mRNA. Translation: BAG35746.1.
AK225532 mRNA. No translation available.
AL590622 Genomic DNA. Translation: CAC70100.1.
CH471066 Genomic DNA. Translation: EAW50117.1.
BC006991 mRNA. Translation: AAH06991.1.
CCDSiCCDS44458.1. [P78346-2]
CCDS7411.1. [P78346-1]
RefSeqiNP_001098016.1. NM_001104546.1. [P78346-2]
NP_006404.1. NM_006413.4. [P78346-1]
UniGeneiHs.139120.

Genome annotation databases

EnsembliENST00000371703; ENSP00000360768; ENSG00000148688. [P78346-1]
ENST00000413330; ENSP00000389182; ENSG00000148688. [P78346-2]
GeneIDi10556.
KEGGihsa:10556.
UCSCiuc001khd.2. human.
uc009xtx.3. human. [P78346-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U77665 mRNA. Translation: AAC51143.1 .
AK312900 mRNA. Translation: BAG35746.1 .
AK225532 mRNA. No translation available.
AL590622 Genomic DNA. Translation: CAC70100.1 .
CH471066 Genomic DNA. Translation: EAW50117.1 .
BC006991 mRNA. Translation: AAH06991.1 .
CCDSi CCDS44458.1. [P78346-2 ]
CCDS7411.1. [P78346-1 ]
RefSeqi NP_001098016.1. NM_001104546.1. [P78346-2 ]
NP_006404.1. NM_006413.4. [P78346-1 ]
UniGenei Hs.139120.

3D structure databases

ProteinModelPortali P78346.
ModBasei Search...

Protein-protein interaction databases

BioGridi 115807. 21 interactions.
IntActi P78346. 3 interactions.
MINTi MINT-3023090.
STRINGi 9606.ENSP00000389182.

PTM databases

PhosphoSitei P78346.

Proteomic databases

MaxQBi P78346.
PaxDbi P78346.
PRIDEi P78346.

Protocols and materials databases

DNASUi 10556.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000371703 ; ENSP00000360768 ; ENSG00000148688 . [P78346-1 ]
ENST00000413330 ; ENSP00000389182 ; ENSG00000148688 . [P78346-2 ]
GeneIDi 10556.
KEGGi hsa:10556.
UCSCi uc001khd.2. human.
uc009xtx.3. human. [P78346-1 ]

Organism-specific databases

CTDi 10556.
GeneCardsi GC10P092621.
HGNCi HGNC:17688. RPP30.
HPAi HPA037578.
MIMi 606115. gene.
neXtProti NX_P78346.
PharmGKBi PA134876345.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG1603.
HOGENOMi HOG000157793.
HOVERGENi HBG010226.
KOi K03539.
OMAi GVCFELV.
OrthoDBi EOG73FQNP.
PhylomeDBi P78346.
TreeFami TF106113.

Miscellaneous databases

GeneWikii RPP30.
GenomeRNAii 10556.
NextBioi 40053.
PROi P78346.
SOURCEi Search...

Gene expression databases

ArrayExpressi P78346.
Bgeei P78346.
CleanExi HS_RPP30.
Genevestigatori P78346.

Family and domain databases

InterProi IPR016195. Pol/histidinol_Pase-like.
IPR002738. RNase_P_p30.
[Graphical view ]
PANTHERi PTHR13031. PTHR13031. 1 hit.
Pfami PF01876. RNase_P_p30. 1 hit.
[Graphical view ]
SUPFAMi SSF89550. SSF89550. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Characterization of two scleroderma autoimmune antigens that copurify with human ribonuclease P."
    Eder P.S., Kekuda R., Stolc V., Altman S.
    Proc. Natl. Acad. Sci. U.S.A. 94:1101-1106(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PROTEIN SEQUENCE OF 21-30; 140-148 AND 185-198.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  3. Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
    Submitted (JUL-2006) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Signet-ring cell carcinoma.
  4. "The DNA sequence and comparative analysis of human chromosome 10."
    Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
    , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
    Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Kidney.
  7. Bienvenut W.V., Lao L., Ryan K.M.
    Submitted (JUN-2009) to UniProtKB
    Cited for: PROTEIN SEQUENCE OF 2-10; 99-108; 139-161; 184-198 AND 237-246, CLEAVAGE OF INITIATOR METHIONINE, ACETYLATION AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY.
    Tissue: Osteosarcoma.
  8. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-251, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
    Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
    J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-251, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  10. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-251, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  11. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  12. "Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features."
    Bienvenut W.V., Sumpton D., Martinez A., Lilla S., Espagne C., Meinnel T., Giglione C.
    Mol. Cell. Proteomics 11:M111.015131-M111.015131(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  13. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiRPP30_HUMAN
AccessioniPrimary (citable) accession number: P78346
Secondary accession number(s): B2R799, E9PB02
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: May 1, 1997
Last modified: July 9, 2014
This is version 131 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Autoantibodies against RPP30 are found in sera from scleroderma patients.

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi