Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ribonuclease P protein subunit p30

Gene

RPP30

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends.

Catalytic activityi

Endonucleolytic cleavage of RNA, removing 5'-extranucleotides from tRNA precursor.

GO - Molecular functioni

  • poly(A) RNA binding Source: UniProtKB
  • ribonuclease P activity Source: ProtInc
  • RNA binding Source: GO_Central

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Biological processi

tRNA processing

Enzyme and pathway databases

BioCyciZFISH:HS07551-MONOMER.
ReactomeiR-HSA-6784531. tRNA processing in the nucleus.
R-HSA-6791226. Major pathway of rRNA processing in the nucleolus and cytosol.

Names & Taxonomyi

Protein namesi
Recommended name:
Ribonuclease P protein subunit p30 (EC:3.1.26.5)
Short name:
RNaseP protein p30
Alternative name(s):
RNase P subunit 2
Gene namesi
Name:RPP30
Synonyms:RNASEP2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:17688. RPP30.

Subcellular locationi

GO - Cellular componenti

  • nucleolar ribonuclease P complex Source: ProtInc
  • nucleoplasm Source: Reactome
  • nucleus Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000148688.
PharmGKBiPA134876345.

Polymorphism and mutation databases

BioMutaiRPP30.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources1 Publication
ChainiPRO_00001400312 – 268Ribonuclease P protein subunit p30Add BLAST267

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1 Publication1
Modified residuei251PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiP78346.
MaxQBiP78346.
PaxDbiP78346.
PeptideAtlasiP78346.
PRIDEiP78346.
TopDownProteomicsiP78346-1. [P78346-1]

PTM databases

iPTMnetiP78346.
PhosphoSitePlusiP78346.
SwissPalmiP78346.

Expressioni

Gene expression databases

BgeeiENSG00000148688.
CleanExiHS_RPP30.
ExpressionAtlasiP78346. baseline and differential.
GenevisibleiP78346. HS.

Organism-specific databases

HPAiHPA037578.

Interactioni

Subunit structurei

RNase P consists of an RNA moiety and at least 8 protein subunits; POP1, RPP14, RPP20/POP7, RPP25, RPP29/POP4, RPP30, RPP38 and RPP40.

Binary interactionsi

WithEntry#Exp.IntActNotes
HMG20AQ9NP665EBI-366553,EBI-740641

Protein-protein interaction databases

BioGridi115807. 33 interactors.
IntActiP78346. 12 interactors.
MINTiMINT-3023090.
STRINGi9606.ENSP00000389182.

Structurei

3D structure databases

ProteinModelPortaliP78346.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG2363. Eukaryota.
COG1603. LUCA.
GeneTreeiENSGT00390000000883.
HOGENOMiHOG000157793.
HOVERGENiHBG010226.
InParanoidiP78346.
KOiK03539.
OMAiSFELVYS.
OrthoDBiEOG091G0LMY.
PhylomeDBiP78346.
TreeFamiTF106113.

Family and domain databases

InterProiIPR016195. Pol/histidinol_Pase-like.
IPR002738. RNase_P_p30.
[Graphical view]
PANTHERiPTHR13031. PTHR13031. 1 hit.
PfamiPF01876. RNase_P_p30. 1 hit.
[Graphical view]
SUPFAMiSSF89550. SSF89550. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P78346-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAVFADLDLR AGSDLKALRG LVETAAHLGY SVVAINHIVD FKEKKQEIEK
60 70 80 90 100
PVAVSELFTT LPIVQGKSRP IKILTRLTII VSDPSHCNVL RATSSRARLY
110 120 130 140 150
DVVAVFPKTE KLFHIACTHL DVDLVCITVT EKLPFYFKRP PINVAIDRGL
160 170 180 190 200
AFELVYSPAI KDSTMRRYTI SSALNLMQIC KGKNVIISSA AERPLEIRGP
210 220 230 240 250
YDVANLGLLF GLSESDAKAA VSTNCRAALL HGETRKTAFG IISTVKKPRP
260
SEGDEDCLPA SKKAKCEG
Length:268
Mass (Da):29,321
Last modified:May 1, 1997 - v1
Checksum:i2AB492D98ACDCCBB
GO
Isoform 2 (identifier: P78346-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     266-268: CEG → WSHSVTQAGVQWHNLGSLQPLPLGLKPSSHLSLPRTRIQQRQLLISHQRDHTPKNRL

Note: No experimental confirmation available.Curated
Show »
Length:322
Mass (Da):35,564
Checksum:iB6700D9E4A95C181
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti65Q → R in AK225532 (Ref. 3) Curated1
Sequence conflicti189S → I AA sequence (PubMed:9037013).Curated1
Isoform 2 (identifier: P78346-2)
Sequence conflicti291K → R in AK225532 (Ref. 3) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05187012G → D.Corresponds to variant rs11544145dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_045673266 – 268CEG → WSHSVTQAGVQWHNLGSLQP LPLGLKPSSHLSLPRTRIQQ RQLLISHQRDHTPKNRL in isoform 2. 1 Publication3

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U77665 mRNA. Translation: AAC51143.1.
AK312900 mRNA. Translation: BAG35746.1.
AK225532 mRNA. No translation available.
AL590622 Genomic DNA. Translation: CAC70100.1.
CH471066 Genomic DNA. Translation: EAW50117.1.
BC006991 mRNA. Translation: AAH06991.1.
CCDSiCCDS44458.1. [P78346-2]
CCDS7411.1. [P78346-1]
RefSeqiNP_001098016.1. NM_001104546.1. [P78346-2]
NP_006404.1. NM_006413.4. [P78346-1]
XP_011537422.1. XM_011539120.2. [P78346-2]
XP_011537423.1. XM_011539121.2. [P78346-2]
XP_016870964.1. XM_017015475.1. [P78346-2]
XP_016870966.1. XM_017015477.1. [P78346-1]
UniGeneiHs.139120.

Genome annotation databases

EnsembliENST00000371703; ENSP00000360768; ENSG00000148688. [P78346-1]
ENST00000413330; ENSP00000389182; ENSG00000148688. [P78346-2]
GeneIDi10556.
KEGGihsa:10556.
UCSCiuc009xtx.4. human. [P78346-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U77665 mRNA. Translation: AAC51143.1.
AK312900 mRNA. Translation: BAG35746.1.
AK225532 mRNA. No translation available.
AL590622 Genomic DNA. Translation: CAC70100.1.
CH471066 Genomic DNA. Translation: EAW50117.1.
BC006991 mRNA. Translation: AAH06991.1.
CCDSiCCDS44458.1. [P78346-2]
CCDS7411.1. [P78346-1]
RefSeqiNP_001098016.1. NM_001104546.1. [P78346-2]
NP_006404.1. NM_006413.4. [P78346-1]
XP_011537422.1. XM_011539120.2. [P78346-2]
XP_011537423.1. XM_011539121.2. [P78346-2]
XP_016870964.1. XM_017015475.1. [P78346-2]
XP_016870966.1. XM_017015477.1. [P78346-1]
UniGeneiHs.139120.

3D structure databases

ProteinModelPortaliP78346.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115807. 33 interactors.
IntActiP78346. 12 interactors.
MINTiMINT-3023090.
STRINGi9606.ENSP00000389182.

PTM databases

iPTMnetiP78346.
PhosphoSitePlusiP78346.
SwissPalmiP78346.

Polymorphism and mutation databases

BioMutaiRPP30.

Proteomic databases

EPDiP78346.
MaxQBiP78346.
PaxDbiP78346.
PeptideAtlasiP78346.
PRIDEiP78346.
TopDownProteomicsiP78346-1. [P78346-1]

Protocols and materials databases

DNASUi10556.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000371703; ENSP00000360768; ENSG00000148688. [P78346-1]
ENST00000413330; ENSP00000389182; ENSG00000148688. [P78346-2]
GeneIDi10556.
KEGGihsa:10556.
UCSCiuc009xtx.4. human. [P78346-1]

Organism-specific databases

CTDi10556.
GeneCardsiRPP30.
HGNCiHGNC:17688. RPP30.
HPAiHPA037578.
MIMi606115. gene.
neXtProtiNX_P78346.
OpenTargetsiENSG00000148688.
PharmGKBiPA134876345.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2363. Eukaryota.
COG1603. LUCA.
GeneTreeiENSGT00390000000883.
HOGENOMiHOG000157793.
HOVERGENiHBG010226.
InParanoidiP78346.
KOiK03539.
OMAiSFELVYS.
OrthoDBiEOG091G0LMY.
PhylomeDBiP78346.
TreeFamiTF106113.

Enzyme and pathway databases

BioCyciZFISH:HS07551-MONOMER.
ReactomeiR-HSA-6784531. tRNA processing in the nucleus.
R-HSA-6791226. Major pathway of rRNA processing in the nucleolus and cytosol.

Miscellaneous databases

ChiTaRSiRPP30. human.
GeneWikiiRPP30.
GenomeRNAii10556.
PROiP78346.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000148688.
CleanExiHS_RPP30.
ExpressionAtlasiP78346. baseline and differential.
GenevisibleiP78346. HS.

Family and domain databases

InterProiIPR016195. Pol/histidinol_Pase-like.
IPR002738. RNase_P_p30.
[Graphical view]
PANTHERiPTHR13031. PTHR13031. 1 hit.
PfamiPF01876. RNase_P_p30. 1 hit.
[Graphical view]
SUPFAMiSSF89550. SSF89550. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiRPP30_HUMAN
AccessioniPrimary (citable) accession number: P78346
Secondary accession number(s): B2R799, E9PB02
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 21, 2001
Last sequence update: May 1, 1997
Last modified: November 30, 2016
This is version 155 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Autoantibodies against RPP30 are found in sera from scleroderma patients.

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.