P78346 (RPP30_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 121.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Ribonuclease P protein subunit p30 Short name=RNaseP protein p30 EC=3.1.26.5 Alternative name(s): RNase P subunit 2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 268 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. |
| Catalytic activity | Endonucleolytic cleavage of RNA, removing 5'-extranucleotides from tRNA precursor. |
| Subunit structure | RNase P consists of a RNA moiety and at least 8 protein subunits; POP1, RPP14, RPP20/POP7, RPP25, RPP29/POP4, RPP30, RPP38 and RPP40. |
| Subcellular location | |
| Miscellaneous | Autoantibodies against RPP30 are found in sera from scleroderma patients. |
| Sequence similarities | Belongs to the eukaryotic/archaeal RNase P protein component 3 family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | tRNA processing |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Molecular function | Hydrolase |
| PTM | Acetylation Phosphoprotein |
| Technical term | Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | tRNA processing Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | nucleolar ribonuclease P complex Traceable author statement PubMed 9630247. Source: ProtInc |
| Molecular_function | ribonuclease P activity Traceable author statement PubMed 9630247. Source: ProtInc |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P78346-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P78346-2) The sequence of this isoform differs from the canonical sequence as follows: 266-268: CEG → WSHSVTQAGVQWHNLGSLQPLPLGLKPSSHLSLPRTRIQQRQLLISHQRDHTPKNRL | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed Ref.7 | ||||||
| Chain | 2 – 268 | 267 | Ribonuclease P protein subunit p30 | PRO_0000140031 | |||||
Amino acid modifications | |||||||||
| Modified residue | 2 | 1 | N-acetylalanine Ref.7 | ||||||
| Modified residue | 251 | 1 | Phosphoserine Ref.8 Ref.9 Ref.10 | ||||||
Natural variations | |||||||||
| Alternative sequence | 266 – 268 | 3 | CEG → WSHSVTQAGVQWHNLGSLQP LPLGLKPSSHLSLPRTRIQQ RQLLISHQRDHTPKNRL in isoform 2. | VSP_045673 | |||||
| Natural variant | 12 | 1 | G → D. Corresponds to variant rs11544145 [ dbSNP | Ensembl ]. | VAR_051870 | |||||
Experimental info | |||||||||
| Sequence conflict | 65 | 1 | Q → R in AK225532. Ref.3 | ||||||
| Sequence conflict | 189 | 1 | S → I AA sequence Ref.1 | ||||||
| Isoform 2: | |||||||||
| Sequence conflict | 291 | 1 | K → R in AK225532. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Characterization of two scleroderma autoimmune antigens that copurify with human ribonuclease P." Eder P.S., Kekuda R., Stolc V., Altman S. Proc. Natl. Acad. Sci. U.S.A. 94:1101-1106(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PROTEIN SEQUENCE OF 21-30; 140-148 AND 185-198. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [3] | Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Submitted (JUL-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Signet-ring cell carcinoma. |
| [4] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Kidney. |
| [7] | Bienvenut W.V., Lao L., Ryan K.M. Submitted (JUN-2009) to UniProtKB Cited for: PROTEIN SEQUENCE OF 2-10; 99-108; 139-161; 184-198 AND 237-246, CLEAVAGE OF INITIATOR METHIONINE, ACETYLATION AT ALA-2, MASS SPECTROMETRY. Tissue: Osteosarcoma. |
| [8] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-251, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [9] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-251, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-251, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [11] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U77665 mRNA. Translation: AAC51143.1. AK312900 mRNA. Translation: BAG35746.1. AK225532 mRNA. No translation available. AL590622 Genomic DNA. Translation: CAC70100.1. CH471066 Genomic DNA. Translation: EAW50117.1. BC006991 mRNA. Translation: AAH06991.1. |
| IPI | IPI00019196. IPI00876864. |
| RefSeq | NP_001098016.1. NM_001104546.1. NP_006404.1. NM_006413.4. |
| UniGene | Hs.139120. |
3D structure databases | |
| ProteinModelPortal | P78346. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P78346. 3 interactions. |
| STRING | 9606.ENSP00000389182. |
PTM databases | |
| PhosphoSite | P78346. |
Polymorphism databases | |
| DMDM | 13124514. |
Proteomic databases | |
| PaxDb | P78346. |
| PRIDE | P78346. |
Protocols and materials databases | |
| DNASU | 10556. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000371703; ENSP00000360768; ENSG00000148688. ENST00000413330; ENSP00000389182; ENSG00000148688. |
| GeneID | 10556. |
| KEGG | hsa:10556. |
| UCSC | uc009xtx.3. human. |
Organism-specific databases | |
| CTD | 10556. |
| GeneCards | GC10P092621. |
| HGNC | HGNC:17688. RPP30. |
| HPA | HPA037578. |
| MIM | 606115. gene. |
| neXtProt | NX_P78346. |
| PharmGKB | PA134876345. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG1603. |
| HOGENOM | HOG000157793. |
| HOVERGEN | HBG010226. |
| KO | K03539. |
| OrthoDB | EOG4D52Z9. |
| PhylomeDB | P78346. |
Gene expression databases | |
| ArrayExpress | P78346. |
| Bgee | P78346. |
| CleanEx | HS_RPP30. |
| Genevestigator | P78346. |
| GermOnline | ENSG00000148688. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR016195. Pol/histidinol_Pase-like. IPR002738. RNase_P_p30. [Graphical view] |
| PANTHER | PTHR13031. PTHR13031. 1 hit. |
| Pfam | PF01876. RNase_P_p30. 1 hit. [Graphical view] |
| SUPFAM | SSF89550. PHP-like. 1 hit. |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 10556. |
| NextBio | 40053. |
| SOURCE | Search... |
Entry information
| Entry name | RPP30_HUMAN | ||||||||
| Accession | Primary (citable) accession number: P78346 Secondary accession number(s): B2R799, E9PB02 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
