Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P78329

- CP4F2_HUMAN

UniProt

P78329 - CP4F2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Phylloquinone omega-hydroxylase CYP4F2

Gene

CYP4F2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Omega-hydroxylase that oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids and xenobiotics. Plays a key role in vitamin K catabolism by mediating omega-hydroxylation of vitamin K1 (phylloquinone), and menaquinone-4 (MK-4), a form of vitamin K2. Hydroxylation of phylloquinone and MK-4 probably regulates blood coagulation (PubMed:19297519, PubMed:24138531). Also shows arachidonic acid omega-hydroxylase activity in kidney, by mediating conversion of arachidonic acid to 20-hydroxyeicosatetraenoic acid (20-HETE), possibly influencing blood pressure control (PubMed:10660572, PubMed:17341693, PubMed:18574070). Also acts as a leukotriene-B4 omega-hydroxylase by mediating conversion of leukotriene-B4 (LTB4) to its omega-hydroxylated metabolite 20-hydroxyleukotriene-B4 (20-OH LTB4) (PubMed:8026587, PubMed:9799565).7 Publications

Catalytic activityi

(6Z,8E,10E,14Z)-(5S,12R)-5,12-dihydroxyicosa-6,8,10,14-tetraenoate + NADPH + O2 = (6Z,8E,10E,14Z)-(5S,12R)-5,12,20-trihydroxyicosa-6,8,10,14-tetraenoate + NADP+ + H2O.2 Publications
Phylloquinone + NADPH + O2 = omega-hydroxyphylloquinone + NADP+ + H2O.1 Publication
(5Z,8Z,11Z,14Z)-icosatetraenoate + NADPH + O2 = (5Z,8Z,11Z,14Z)-20-hydroxyicosa-5,8,11,14-tetraenoate + NADP+ + H2O.1 Publication

Cofactori

hemeBy similarity

Kineticsi

kcat is 0.067 min(-1) with menaquinone-4 (MK-4) as substrate1 Publication

  1. KM=74.8 µM for leukotriene-B41 Publication
  2. KM=1.7 µM for menaquinone-4 (MK-4)1 Publication

Vmax=2.42 nmol/min/mg enzyme1 Publication

Pathwayi

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei328 – 3281Heme (covalent; via 1 link)By similarity
Metal bindingi468 – 4681Iron (heme axial ligand)By similarity

GO - Molecular functioni

  1. alkane 1-monooxygenase activity Source: BHF-UCL
  2. alpha-tocopherol omega-hydroxylase activity Source: UniProtKB
  3. arachidonic acid epoxygenase activity Source: UniProtKB
  4. arachidonic acid omega-hydroxylase activity Source: UniProtKB
  5. heme binding Source: InterPro
  6. iron ion binding Source: InterPro
  7. leukotriene-B4 20-monooxygenase activity Source: UniProtKB
  8. oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen Source: UniProtKB
  9. tocotrienol omega-hydroxylase activity Source: UniProtKB
  10. vitamin-K-epoxide reductase (warfarin-sensitive) activity Source: UniProtKB

GO - Biological processi

  1. arachidonic acid metabolic process Source: UniProtKB
  2. blood coagulation Source: UniProtKB
  3. drug metabolic process Source: UniProtKB
  4. epoxygenase P450 pathway Source: UniProtKB
  5. icosanoid metabolic process Source: Reactome
  6. leukotriene B4 catabolic process Source: UniProtKB
  7. leukotriene metabolic process Source: Reactome
  8. long-chain fatty acid metabolic process Source: BHF-UCL
  9. menaquinone catabolic process Source: UniProtKB
  10. negative regulation of blood coagulation Source: UniProtKB
  11. negative regulation of icosanoid secretion Source: UniProtKB
  12. omega-hydroxylase P450 pathway Source: Reactome
  13. oxidation-reduction process Source: UniProtKB
  14. phylloquinone catabolic process Source: UniProtKB
  15. positive regulation of icosanoid secretion Source: UniProtKB
  16. pressure natriuresis Source: UniProtKB
  17. regulation of blood pressure Source: UniProtKB
  18. renal water homeostasis Source: UniProtKB
  19. small molecule metabolic process Source: Reactome
  20. sodium ion homeostasis Source: UniProtKB
  21. very long-chain fatty acid metabolic process Source: BHF-UCL
  22. vitamin E metabolic process Source: UniProtKB
  23. vitamin K biosynthetic process Source: UniProtKB
  24. vitamin K catabolic process Source: UniProtKB
  25. xenobiotic metabolic process Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Monooxygenase, Oxidoreductase

Keywords - Ligandi

Heme, Iron, Metal-binding, NADP

Enzyme and pathway databases

BioCyciMetaCyc:HS02675-MONOMER.
ReactomeiREACT_13425. Miscellaneous substrates.
REACT_13645. Eicosanoids.
REACT_13814. Fatty acids.
REACT_150134. Synthesis of (16-20)-hydroxyeicosatetraenoic acids (HETE).
REACT_150420. Synthesis of Leukotrienes (LT) and Eoxins (EX).
UniPathwayiUPA01054.

Names & Taxonomyi

Protein namesi
Recommended name:
Phylloquinone omega-hydroxylase CYP4F2Curated (EC:1.14.13.1941 Publication)
Alternative name(s):
20-hydroxyeicosatetraenoic acid synthase1 Publication (EC:1.14.13.-1 Publication)
Short name:
20-HETE synthase1 Publication
Arachidonic acid omega-hydroxylase1 Publication
CYPIVF2
Cytochrome P450 4F2
Cytochrome P450-LTB-omega
Leukotriene-B(4) 20-monooxygenase 1
Leukotriene-B(4) omega-hydroxylase 1Curated (EC:1.14.13.302 Publications)
Gene namesi
Name:CYP4F2Imported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 19

Organism-specific databases

HGNCiHGNC:2645. CYP4F2.

Subcellular locationi

Microsome membrane 3 Publications; Peripheral membrane protein Curated. Endoplasmic reticulum membrane 1 Publication; Peripheral membrane protein Curated

GO - Cellular componenti

  1. apical plasma membrane Source: UniProtKB
  2. cytoplasm Source: UniProtKB
  3. endoplasmic reticulum membrane Source: UniProtKB
  4. intracellular membrane-bounded organelle Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Microsome

Pathology & Biotechi

Involvement in diseasei

Coumarin resistance (CMRES) [MIM:122700]: A condition characterized by partial or complete resistance to warfarin or other 4-hydroxycoumarin derivatives. These drugs are used as anti-coagulants for the prevention of thromboembolic diseases in subjects with deep vein thrombosis, atrial fibrillation, or mechanical heart valve replacement.
Note: Disease susceptibility may be associated with variations affecting the gene represented in this entry. The variant Met-433 is associated with coumarin (the brand name of warfarin) resistance by increasing coumarin maintenance dose in patients on this anti-coagulant therapy. This is probably due to decreased activity of the phylloquinone omega-hydroxylase activity, leading to an increase in hepatic vitamin K levels that warfarin must antagonize (PubMed:24138531).7 Publications
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti433 – 4331V → M Polymorphism probably associated with CMRES; increases warfarin maintenance dose in patients on warfarin anti-coagulant therapy, possibly due to increased hepatic vitamin K levels that warfarin must antagonize. Decreased phylloquinone omega-hydroxylase activity. Decreased production of 20-hydroxyeicosatetraenoic acid (20-HETE). 10 Publications
Corresponds to variant rs2108622 [ dbSNP | Ensembl ].
VAR_013119

Organism-specific databases

MIMi122700. phenotype.
Orphaneti240997. Susceptibility to bleeding due to warfarine treatment.
240923. Warfarine toxicity.
PharmGKBiPA27121.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Propeptidei1 – 441 PublicationPRO_0000430581
Chaini5 – 520516Phylloquinone omega-hydroxylase CYP4F2PRO_0000051850Add
BLAST

Proteomic databases

MaxQBiP78329.
PaxDbiP78329.
PRIDEiP78329.

PTM databases

PhosphoSiteiP78329.

Expressioni

Tissue specificityi

Liver. Also present in kidney: specifically expressed in the S2 and S3 segments of proximal tubules in cortex and outer medulla (PubMed:10660572).2 Publications

Gene expression databases

BgeeiP78329.
CleanExiHS_CYP4F2.
ExpressionAtlasiP78329. baseline and differential.
GenevestigatoriP78329.

Organism-specific databases

HPAiHPA014048.
HPA017265.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
NCK1P163332EBI-1752413,EBI-389883

Protein-protein interaction databases

BioGridi114099. 3 interactions.
IntActiP78329. 5 interactions.
STRINGi9606.ENSP00000221700.

Structurei

3D structure databases

ProteinModelPortaliP78329.
SMRiP78329. Positions 97-510.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the cytochrome P450 family.Curated

Phylogenomic databases

eggNOGiCOG2124.
GeneTreeiENSGT00760000118816.
HOVERGENiHBG000182.
InParanoidiP78329.
KOiK17726.
OMAiQGMVNPT.
OrthoDBiEOG7CNZFK.
PhylomeDBiP78329.
TreeFamiTF105088.

Family and domain databases

Gene3Di1.10.630.10. 1 hit.
InterProiIPR001128. Cyt_P450.
IPR017972. Cyt_P450_CS.
IPR002401. Cyt_P450_E_grp-I.
[Graphical view]
PfamiPF00067. p450. 1 hit.
[Graphical view]
PRINTSiPR00463. EP450I.
PR00385. P450.
SUPFAMiSSF48264. SSF48264. 1 hit.
PROSITEiPS00086. CYTOCHROME_P450. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P78329-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSQLSLSWLG LWPVAASPWL LLLLVGASWL LAHVLAWTYA FYDNCRRLRC
60 70 80 90 100
FPQPPRRNWF WGHQGMVNPT EEGMRVLTQL VATYPQGFKV WMGPISPLLS
110 120 130 140 150
LCHPDIIRSV INASAAIAPK DKFFYSFLEP WLGDGLLLSA GDKWSRHRRM
160 170 180 190 200
LTPAFHFNIL KPYMKIFNES VNIMHAKWQL LASEGSACLD MFEHISLMTL
210 220 230 240 250
DSLQKCVFSF DSHCQEKPSE YIAAILELSA LVSKRHHEIL LHIDFLYYLT
260 270 280 290 300
PDGQRFRRAC RLVHDFTDAV IQERRRTLPS QGVDDFLQAK AKSKTLDFID
310 320 330 340 350
VLLLSKDEDG KKLSDEDIRA EADTFMFEGH DTTASGLSWV LYHLAKHPEY
360 370 380 390 400
QERCRQEVQE LLKDREPKEI EWDDLAHLPF LTMCMKESLR LHPPVPVISR
410 420 430 440 450
HVTQDIVLPD GRVIPKGIIC LISVFGTHHN PAVWPDPEVY DPFRFDPENI
460 470 480 490 500
KERSPLAFIP FSAGPRNCIG QTFAMAEMKV VLALTLLRFR VLPDHTEPRR
510 520
KPELVLRAEG GLWLRVEPLS
Length:520
Mass (Da):59,853
Last modified:May 1, 1997 - v1
Checksum:i1791F9E6EECB59B5
GO
Isoform 2 (identifier: P78329-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-149: Missing.
     307-339: DEDGKKLSDEDIRAEADTFMFEGHDTTASGLSW → AMTPRPVVSPGSCTTLQSTQNTRSAAGRRCKNF
     340-520: Missing.

Note: No experimental confirmation available.

Show »
Length:190
Mass (Da):21,709
Checksum:iE137B6FDB0B39573
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti12 – 132WP → CR in AAC50052. 1 PublicationCurated
Sequence conflicti12 – 132WP → CR in AAF86378. (PubMed:10860554)Curated
Sequence conflicti25 – 251V → A in AAH67437. (PubMed:15489334)Curated
Sequence conflicti169 – 1691E → D in AAH67440. (PubMed:15489334)Curated
Sequence conflicti336 – 3361G → V in AAC50052. 1 PublicationCurated
Sequence conflicti391 – 3911L → V in AAC50052. 1 PublicationCurated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti7 – 71S → Y.1 Publication
Corresponds to variant rs3093104 [ dbSNP | Ensembl ].
VAR_013116
Natural varianti12 – 121W → G.3 Publications
Corresponds to variant rs3093105 [ dbSNP | Ensembl ].
VAR_013117
Natural varianti185 – 1851G → V.2 Publications
Corresponds to variant rs3093153 [ dbSNP | Ensembl ].
VAR_013118
Natural varianti269 – 2691A → D.
Corresponds to variant rs1805040 [ dbSNP | Ensembl ].
VAR_020125
Natural varianti433 – 4331V → M Polymorphism probably associated with CMRES; increases warfarin maintenance dose in patients on warfarin anti-coagulant therapy, possibly due to increased hepatic vitamin K levels that warfarin must antagonize. Decreased phylloquinone omega-hydroxylase activity. Decreased production of 20-hydroxyeicosatetraenoic acid (20-HETE). 10 Publications
Corresponds to variant rs2108622 [ dbSNP | Ensembl ].
VAR_013119
Natural varianti519 – 5191L → M.1 Publication
Corresponds to variant rs3093200 [ dbSNP | Ensembl ].
VAR_013120

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 149149Missing in isoform 2. 1 PublicationVSP_055578Add
BLAST
Alternative sequencei307 – 33933DEDGK…SGLSW → AMTPRPVVSPGSCTTLQSTQ NTRSAAGRRCKNF in isoform 2. 1 PublicationVSP_055579Add
BLAST
Alternative sequencei340 – 520181Missing in isoform 2. 1 PublicationVSP_055580Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D26480 mRNA. Translation: BAA05490.1.
AB015306 Genomic DNA. Translation: BAA75823.1.
U02388 mRNA. Translation: AAC50052.2.
AK290790 mRNA. Translation: BAF83479.1.
AK300961 mRNA. Translation: BAG62587.1.
AF467894 Genomic DNA. Translation: AAL67578.1.
AC005336 Genomic DNA. Translation: AAC27730.1.
AC004791 Genomic DNA. No translation available.
CH471106 Genomic DNA. Translation: EAW84509.1.
CH471106 Genomic DNA. Translation: EAW84510.1.
BC067437 mRNA. Translation: AAH67437.1.
BC067439 mRNA. Translation: AAH67439.1.
BC067440 mRNA. Translation: AAH67440.1.
AF221943 Genomic DNA. Translation: AAF86378.1.
CCDSiCCDS12336.1. [P78329-1]
PIRiS45702.
RefSeqiNP_001073.3. NM_001082.4. [P78329-1]
UniGeneiHs.558423.

Genome annotation databases

EnsembliENST00000221700; ENSP00000221700; ENSG00000186115. [P78329-1]
GeneIDi8529.
KEGGihsa:8529.
UCSCiuc002nbs.1. human. [P78329-1]

Polymorphism databases

DMDMi6166044.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

SeattleSNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D26480 mRNA. Translation: BAA05490.1 .
AB015306 Genomic DNA. Translation: BAA75823.1 .
U02388 mRNA. Translation: AAC50052.2 .
AK290790 mRNA. Translation: BAF83479.1 .
AK300961 mRNA. Translation: BAG62587.1 .
AF467894 Genomic DNA. Translation: AAL67578.1 .
AC005336 Genomic DNA. Translation: AAC27730.1 .
AC004791 Genomic DNA. No translation available.
CH471106 Genomic DNA. Translation: EAW84509.1 .
CH471106 Genomic DNA. Translation: EAW84510.1 .
BC067437 mRNA. Translation: AAH67437.1 .
BC067439 mRNA. Translation: AAH67439.1 .
BC067440 mRNA. Translation: AAH67440.1 .
AF221943 Genomic DNA. Translation: AAF86378.1 .
CCDSi CCDS12336.1. [P78329-1 ]
PIRi S45702.
RefSeqi NP_001073.3. NM_001082.4. [P78329-1 ]
UniGenei Hs.558423.

3D structure databases

ProteinModelPortali P78329.
SMRi P78329. Positions 97-510.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 114099. 3 interactions.
IntActi P78329. 5 interactions.
STRINGi 9606.ENSP00000221700.

Chemistry

ChEMBLi CHEMBL3379.
DrugBanki DB08868. Fingolimod.

PTM databases

PhosphoSitei P78329.

Polymorphism databases

DMDMi 6166044.

Proteomic databases

MaxQBi P78329.
PaxDbi P78329.
PRIDEi P78329.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000221700 ; ENSP00000221700 ; ENSG00000186115 . [P78329-1 ]
GeneIDi 8529.
KEGGi hsa:8529.
UCSCi uc002nbs.1. human. [P78329-1 ]

Organism-specific databases

CTDi 8529.
GeneCardsi GC19M015988.
HGNCi HGNC:2645. CYP4F2.
HPAi HPA014048.
HPA017265.
MIMi 122700. phenotype.
604426. gene.
neXtProti NX_P78329.
Orphaneti 240997. Susceptibility to bleeding due to warfarine treatment.
240923. Warfarine toxicity.
PharmGKBi PA27121.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG2124.
GeneTreei ENSGT00760000118816.
HOVERGENi HBG000182.
InParanoidi P78329.
KOi K17726.
OMAi QGMVNPT.
OrthoDBi EOG7CNZFK.
PhylomeDBi P78329.
TreeFami TF105088.

Enzyme and pathway databases

UniPathwayi UPA01054 .
BioCyci MetaCyc:HS02675-MONOMER.
Reactomei REACT_13425. Miscellaneous substrates.
REACT_13645. Eicosanoids.
REACT_13814. Fatty acids.
REACT_150134. Synthesis of (16-20)-hydroxyeicosatetraenoic acids (HETE).
REACT_150420. Synthesis of Leukotrienes (LT) and Eoxins (EX).

Miscellaneous databases

GeneWikii CYP4F2.
GenomeRNAii 8529.
NextBioi 31940.
PROi P78329.
SOURCEi Search...

Gene expression databases

Bgeei P78329.
CleanExi HS_CYP4F2.
ExpressionAtlasi P78329. baseline and differential.
Genevestigatori P78329.

Family and domain databases

Gene3Di 1.10.630.10. 1 hit.
InterProi IPR001128. Cyt_P450.
IPR017972. Cyt_P450_CS.
IPR002401. Cyt_P450_E_grp-I.
[Graphical view ]
Pfami PF00067. p450. 1 hit.
[Graphical view ]
PRINTSi PR00463. EP450I.
PR00385. P450.
SUPFAMi SSF48264. SSF48264. 1 hit.
PROSITEi PS00086. CYTOCHROME_P450. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and expression of a novel form of leukotriene B4 omega-hydroxylase from human liver."
    Kikuta Y., Kusunose E., Kondo T., Yamamoto S., Kinoshita H., Kusunose M.
    FEBS Lett. 348:70-74(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, CATALYTIC ACTIVITY, SUBCELLULAR LOCATION.
    Tissue: Liver.
  2. "Expression and molecular cloning of human liver leukotriene B4 omega-hydroxylase (CYP4F2) gene."
    Kikuta Y., Miyauchi Y., Kusunose E., Kusunose M.
    DNA Cell Biol. 18:723-730(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], TISSUE SPECIFICITY.
  3. "The human liver CYP4F2 cDNA sequence and expression in baculovirus-infected insect cells."
    Chen L., Hardwick J.P.
    Submitted (JUL-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Liver.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT VAL-185.
    Tissue: Kidney and Small intestine.
  5. SeattleSNPs variation discovery resource
    Submitted (JAN-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS TYR-7; GLY-12; VAL-185; MET-433 AND MET-519.
  6. "The DNA sequence and biology of human chromosome 19."
    Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
    , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
    Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS GLY-12 AND MET-433.
  9. "Promoter activity and regulation of the CYP4F2 leukotriene B4 omega hydroxylase gene by peroxisomal proliferators and retinoic acid in HepG2 cells."
    Zhang X., Chen L., Hardwick J.P.
    Arch. Biochem. Biophys. 378:364-376(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-175.
    Tissue: Liver.
  10. "Role of human CYP4F2 in hepatic catabolism of the proinflammatory agent leukotriene B4."
    Jin R., Koop D.R., Raucy J.L., Lasker J.M.
    Arch. Biochem. Biophys. 359:89-98(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 5-21, FUNCTION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, VARIANT GLY-12.
  11. "Formation of 20-hydroxyeicosatetraenoic acid, a vasoactive and natriuretic eicosanoid, in human kidney. Role of Cyp4F2 and Cyp4A11."
    Lasker J.M., Chen W.B., Wolf I., Bloswick B.P., Wilson P.D., Powell P.K.
    J. Biol. Chem. 275:4118-4126(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, CATALYTIC ACTIVITY, TISSUE SPECIFICITY.
  12. "Functional polymorphism in human CYP4F2 decreases 20-HETE production."
    Stec D.E., Roman R.J., Flasch A., Rieder M.J.
    Physiol. Genomics 30:74-81(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, CHARACTERIZATION OF VARIANT MET-433.
  13. "The V433M variant of the CYP4F2 is associated with ischemic stroke in male Swedes beyond its effect on blood pressure."
    Fava C., Montagnana M., Almgren P., Rosberg L., Lippi G., Hedblad B., Engstrom G., Berglund G., Minuz P., Melander O.
    Hypertension 52:373-380(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, CHARACTERIZATION OF VARIANT MET-433.
  14. Cited for: INVOLVEMENT IN CMRES, CHARACTERIZATION OF VARIANT MET-433.
  15. "Pharmacogenetic relevance of CYP4F2 V433M polymorphism on acenocoumarol therapy."
    Perez-Andreu V., Roldan V., Anton A.I., Garcia-Barbera N., Corral J., Vicente V., Gonzalez-Conejero R.
    Blood 113:4977-4979(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: INVOLVEMENT IN CMRES, CHARACTERIZATION OF VARIANT MET-433.
  16. "CYP4F2 is a vitamin K1 oxidase: An explanation for altered warfarin dose in carriers of the V433M variant."
    McDonald M.G., Rieder M.J., Nakano M., Hsia C.K., Rettie A.E.
    Mol. Pharmacol. 75:1337-1346(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, INVOLVEMENT IN CMRES, CHARACTERIZATION OF VARIANT MET-433.
  17. "CYP4F2 genetic variant (rs2108622) significantly contributes to warfarin dosing variability in the Italian population."
    Borgiani P., Ciccacci C., Forte V., Sirianni E., Novelli L., Bramanti P., Novelli G.
    Pharmacogenomics 10:261-266(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: INVOLVEMENT IN CMRES, CHARACTERIZATION OF VARIANT MET-433.
  18. "Worldwide allele frequency distribution of four polymorphisms associated with warfarin dose requirements."
    Ross K.A., Bigham A.W., Edwards M., Gozdzik A., Suarez-Kurtz G., Parra E.J.
    J. Hum. Genet. 55:582-589(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: INVOLVEMENT IN CMRES, CHARACTERIZATION OF VARIANT MET-433.
  19. "Common variants of cytochrome P450 4F2 exhibit altered vitamin E-{omega}-hydroxylase specific activity."
    Bardowell S.A., Stec D.E., Parker R.S.
    J. Nutr. 140:1901-1906(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.
  20. Cited for: INVOLVEMENT IN CMRES, CHARACTERIZATION OF VARIANT MET-433.
  21. "Cytochrome P450-dependent catabolism of vitamin K: omega-hydroxylation catalyzed by human CYP4F2 and CYP4F11."
    Edson K.Z., Prasad B., Unadkat J.D., Suhara Y., Okano T., Guengerich F.P., Rettie A.E.
    Biochemistry 52:8276-8285(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, INVOLVEMENT IN CMRES, IDENTIFICATION BY MASS SPECTROMETRY, PATHWAY.

Entry informationi

Entry nameiCP4F2_HUMAN
AccessioniPrimary (citable) accession number: P78329
Secondary accession number(s): A0A024R7K3
, A8K425, B4DV75, Q16677, Q6NWT4, Q6NWT6, Q9NNZ0, Q9UIU8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 15, 1998
Last sequence update: May 1, 1997
Last modified: November 26, 2014
This is version 144 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3