Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P78329

- CP4F2_HUMAN

UniProt

P78329 - CP4F2_HUMAN

Protein

Leukotriene-B(4) omega-hydroxylase 1

Gene

CYP4F2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 142 (01 Oct 2014)
      Sequence version 1 (01 May 1997)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.

    Catalytic activityi

    (6Z,8E,10E,14Z)-(5S,12R)-5,12-dihydroxyicosa-6,8,10,14-tetraenoate + NADPH + O2 = (6Z,8E,10E,14Z)-(5S,12R)-5,12,20-trihydroxyicosa-6,8,10,14-tetraenoate + NADP+ + H2O.

    Cofactori

    Heme group.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei328 – 3281Heme (covalent; via 1 link)By similarity
    Metal bindingi468 – 4681Iron (heme axial ligand)By similarity

    GO - Molecular functioni

    1. alkane 1-monooxygenase activity Source: BHF-UCL
    2. alpha-tocopherol omega-hydroxylase activity Source: UniProtKB
    3. arachidonic acid epoxygenase activity Source: UniProtKB
    4. arachidonic acid omega-hydroxylase activity Source: UniProtKB
    5. heme binding Source: InterPro
    6. iron ion binding Source: InterPro
    7. leukotriene-B4 20-monooxygenase activity Source: UniProtKB
    8. oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Source: InterPro
    9. protein binding Source: IntAct
    10. tocotrienol omega-hydroxylase activity Source: UniProtKB
    11. vitamin-K-epoxide reductase (warfarin-sensitive) activity Source: UniProtKB

    GO - Biological processi

    1. arachidonic acid metabolic process Source: UniProtKB
    2. drug metabolic process Source: UniProtKB
    3. epoxygenase P450 pathway Source: UniProtKB
    4. icosanoid metabolic process Source: Reactome
    5. leukotriene B4 catabolic process Source: UniProtKB
    6. leukotriene metabolic process Source: Reactome
    7. long-chain fatty acid metabolic process Source: BHF-UCL
    8. negative regulation of blood coagulation Source: UniProtKB
    9. negative regulation of icosanoid secretion Source: UniProtKB
    10. omega-hydroxylase P450 pathway Source: Reactome
    11. oxidation-reduction process Source: UniProtKB
    12. positive regulation of icosanoid secretion Source: UniProtKB
    13. pressure natriuresis Source: UniProtKB
    14. regulation of blood pressure Source: UniProtKB
    15. renal water homeostasis Source: UniProtKB
    16. small molecule metabolic process Source: Reactome
    17. sodium ion homeostasis Source: UniProtKB
    18. very long-chain fatty acid metabolic process Source: BHF-UCL
    19. vitamin E metabolic process Source: UniProtKB
    20. vitamin K biosynthetic process Source: UniProtKB
    21. xenobiotic metabolic process Source: Reactome

    Keywords - Molecular functioni

    Monooxygenase, Oxidoreductase

    Keywords - Ligandi

    Heme, Iron, Metal-binding, NADP

    Enzyme and pathway databases

    BioCyciMetaCyc:HS02675-MONOMER.
    ReactomeiREACT_13425. Miscellaneous substrates.
    REACT_13645. Eicosanoids.
    REACT_13814. Fatty acids.
    REACT_150134. Synthesis of (16-20)-hydroxyeicosatetraenoic acids (HETE).
    REACT_150420. Synthesis of Leukotrienes (LT) and Eoxins (EX).

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Leukotriene-B(4) omega-hydroxylase 1 (EC:1.14.13.30)
    Alternative name(s):
    CYPIVF2
    Cytochrome P450 4F2
    Cytochrome P450-LTB-omega
    Leukotriene-B(4) 20-monooxygenase 1
    Gene namesi
    Name:CYP4F2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 19

    Organism-specific databases

    HGNCiHGNC:2645. CYP4F2.

    Subcellular locationi

    GO - Cellular componenti

    1. apical plasma membrane Source: UniProtKB
    2. cytoplasm Source: UniProtKB
    3. endoplasmic reticulum membrane Source: UniProtKB
    4. intracellular membrane-bounded organelle Source: UniProtKB

    Keywords - Cellular componenti

    Endoplasmic reticulum, Membrane, Microsome

    Pathology & Biotechi

    Organism-specific databases

    Orphaneti240997. Susceptibility to bleeding due to warfarine treatment.
    240923. Warfarine toxicity.
    PharmGKBiPA27121.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 520520Leukotriene-B(4) omega-hydroxylase 1PRO_0000051850Add
    BLAST

    Proteomic databases

    PaxDbiP78329.
    PRIDEiP78329.

    PTM databases

    PhosphoSiteiP78329.

    Expressioni

    Tissue specificityi

    Liver.

    Gene expression databases

    ArrayExpressiP78329.
    BgeeiP78329.
    CleanExiHS_CYP4F2.
    GenevestigatoriP78329.

    Organism-specific databases

    HPAiHPA014048.
    HPA017265.

    Interactioni

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    NCK1P163332EBI-1752413,EBI-389883

    Protein-protein interaction databases

    BioGridi114099. 3 interactions.
    IntActiP78329. 5 interactions.
    STRINGi9606.ENSP00000221700.

    Structurei

    3D structure databases

    ProteinModelPortaliP78329.
    SMRiP78329. Positions 71-520.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the cytochrome P450 family.Curated

    Phylogenomic databases

    eggNOGiCOG2124.
    HOVERGENiHBG000182.
    KOiK17726.
    OMAiQGMVNPT.
    OrthoDBiEOG7CNZFK.
    PhylomeDBiP78329.
    TreeFamiTF105088.

    Family and domain databases

    Gene3Di1.10.630.10. 1 hit.
    InterProiIPR001128. Cyt_P450.
    IPR017972. Cyt_P450_CS.
    IPR002401. Cyt_P450_E_grp-I.
    [Graphical view]
    PfamiPF00067. p450. 1 hit.
    [Graphical view]
    PRINTSiPR00463. EP450I.
    PR00385. P450.
    SUPFAMiSSF48264. SSF48264. 1 hit.
    PROSITEiPS00086. CYTOCHROME_P450. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P78329-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSQLSLSWLG LWPVAASPWL LLLLVGASWL LAHVLAWTYA FYDNCRRLRC    50
    FPQPPRRNWF WGHQGMVNPT EEGMRVLTQL VATYPQGFKV WMGPISPLLS 100
    LCHPDIIRSV INASAAIAPK DKFFYSFLEP WLGDGLLLSA GDKWSRHRRM 150
    LTPAFHFNIL KPYMKIFNES VNIMHAKWQL LASEGSACLD MFEHISLMTL 200
    DSLQKCVFSF DSHCQEKPSE YIAAILELSA LVSKRHHEIL LHIDFLYYLT 250
    PDGQRFRRAC RLVHDFTDAV IQERRRTLPS QGVDDFLQAK AKSKTLDFID 300
    VLLLSKDEDG KKLSDEDIRA EADTFMFEGH DTTASGLSWV LYHLAKHPEY 350
    QERCRQEVQE LLKDREPKEI EWDDLAHLPF LTMCMKESLR LHPPVPVISR 400
    HVTQDIVLPD GRVIPKGIIC LISVFGTHHN PAVWPDPEVY DPFRFDPENI 450
    KERSPLAFIP FSAGPRNCIG QTFAMAEMKV VLALTLLRFR VLPDHTEPRR 500
    KPELVLRAEG GLWLRVEPLS 520
    Length:520
    Mass (Da):59,853
    Last modified:May 1, 1997 - v1
    Checksum:i1791F9E6EECB59B5
    GO
    Isoform 2 (identifier: P78329-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-149: Missing.
         307-339: DEDGKKLSDEDIRAEADTFMFEGHDTTASGLSW → AMTPRPVVSPGSCTTLQSTQNTRSAAGRRCKNF
         340-520: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:190
    Mass (Da):21,709
    Checksum:iE137B6FDB0B39573
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti12 – 132WP → CR in AAC50052. 1 PublicationCurated
    Sequence conflicti12 – 132WP → CR in AAF86378. (PubMed:10860554)Curated
    Sequence conflicti25 – 251V → A in AAH67437. (PubMed:15489334)Curated
    Sequence conflicti169 – 1691E → D in AAH67440. (PubMed:15489334)Curated
    Sequence conflicti336 – 3361G → V in AAC50052. 1 PublicationCurated
    Sequence conflicti391 – 3911L → V in AAC50052. 1 PublicationCurated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti7 – 71S → Y.1 Publication
    Corresponds to variant rs3093104 [ dbSNP | Ensembl ].
    VAR_013116
    Natural varianti12 – 121W → G.2 Publications
    Corresponds to variant rs3093105 [ dbSNP | Ensembl ].
    VAR_013117
    Natural varianti185 – 1851G → V.2 Publications
    Corresponds to variant rs3093153 [ dbSNP | Ensembl ].
    VAR_013118
    Natural varianti269 – 2691A → D.
    Corresponds to variant rs1805040 [ dbSNP | Ensembl ].
    VAR_020125
    Natural varianti433 – 4331V → M.2 Publications
    Corresponds to variant rs2108622 [ dbSNP | Ensembl ].
    VAR_013119
    Natural varianti519 – 5191L → M.1 Publication
    Corresponds to variant rs3093200 [ dbSNP | Ensembl ].
    VAR_013120

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 149149Missing in isoform 2. 1 PublicationVSP_055578Add
    BLAST
    Alternative sequencei307 – 33933DEDGK…SGLSW → AMTPRPVVSPGSCTTLQSTQ NTRSAAGRRCKNF in isoform 2. 1 PublicationVSP_055579Add
    BLAST
    Alternative sequencei340 – 520181Missing in isoform 2. 1 PublicationVSP_055580Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D26480 mRNA. Translation: BAA05490.1.
    U02388 mRNA. Translation: AAC50052.2.
    AB015306 Genomic DNA. Translation: BAA75823.1.
    AK290790 mRNA. Translation: BAF83479.1.
    AK300961 mRNA. Translation: BAG62587.1.
    AF467894 Genomic DNA. Translation: AAL67578.1.
    AC005336 Genomic DNA. Translation: AAC27730.1.
    AC004791 Genomic DNA. No translation available.
    BC067437 mRNA. Translation: AAH67437.1.
    BC067439 mRNA. Translation: AAH67439.1.
    BC067440 mRNA. Translation: AAH67440.1.
    AF221943 Genomic DNA. Translation: AAF86378.1.
    CCDSiCCDS12336.1.
    PIRiS45702.
    RefSeqiNP_001073.3. NM_001082.4.
    UniGeneiHs.558423.

    Genome annotation databases

    EnsembliENST00000011989; ENSP00000011989; ENSG00000186115. [P78329-2]
    ENST00000221700; ENSP00000221700; ENSG00000186115. [P78329-1]
    GeneIDi8529.
    KEGGihsa:8529.
    UCSCiuc002nbs.1. human.

    Polymorphism databases

    DMDMi6166044.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    SeattleSNPs

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D26480 mRNA. Translation: BAA05490.1 .
    U02388 mRNA. Translation: AAC50052.2 .
    AB015306 Genomic DNA. Translation: BAA75823.1 .
    AK290790 mRNA. Translation: BAF83479.1 .
    AK300961 mRNA. Translation: BAG62587.1 .
    AF467894 Genomic DNA. Translation: AAL67578.1 .
    AC005336 Genomic DNA. Translation: AAC27730.1 .
    AC004791 Genomic DNA. No translation available.
    BC067437 mRNA. Translation: AAH67437.1 .
    BC067439 mRNA. Translation: AAH67439.1 .
    BC067440 mRNA. Translation: AAH67440.1 .
    AF221943 Genomic DNA. Translation: AAF86378.1 .
    CCDSi CCDS12336.1.
    PIRi S45702.
    RefSeqi NP_001073.3. NM_001082.4.
    UniGenei Hs.558423.

    3D structure databases

    ProteinModelPortali P78329.
    SMRi P78329. Positions 71-520.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 114099. 3 interactions.
    IntActi P78329. 5 interactions.
    STRINGi 9606.ENSP00000221700.

    Chemistry

    BindingDBi P78329.
    ChEMBLi CHEMBL3379.

    PTM databases

    PhosphoSitei P78329.

    Polymorphism databases

    DMDMi 6166044.

    Proteomic databases

    PaxDbi P78329.
    PRIDEi P78329.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000011989 ; ENSP00000011989 ; ENSG00000186115 . [P78329-2 ]
    ENST00000221700 ; ENSP00000221700 ; ENSG00000186115 . [P78329-1 ]
    GeneIDi 8529.
    KEGGi hsa:8529.
    UCSCi uc002nbs.1. human.

    Organism-specific databases

    CTDi 8529.
    GeneCardsi GC19M015988.
    HGNCi HGNC:2645. CYP4F2.
    HPAi HPA014048.
    HPA017265.
    MIMi 604426. gene.
    neXtProti NX_P78329.
    Orphaneti 240997. Susceptibility to bleeding due to warfarine treatment.
    240923. Warfarine toxicity.
    PharmGKBi PA27121.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG2124.
    HOVERGENi HBG000182.
    KOi K17726.
    OMAi QGMVNPT.
    OrthoDBi EOG7CNZFK.
    PhylomeDBi P78329.
    TreeFami TF105088.

    Enzyme and pathway databases

    BioCyci MetaCyc:HS02675-MONOMER.
    Reactomei REACT_13425. Miscellaneous substrates.
    REACT_13645. Eicosanoids.
    REACT_13814. Fatty acids.
    REACT_150134. Synthesis of (16-20)-hydroxyeicosatetraenoic acids (HETE).
    REACT_150420. Synthesis of Leukotrienes (LT) and Eoxins (EX).

    Miscellaneous databases

    GeneWikii CYP4F2.
    GenomeRNAii 8529.
    NextBioi 31940.
    PROi P78329.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P78329.
    Bgeei P78329.
    CleanExi HS_CYP4F2.
    Genevestigatori P78329.

    Family and domain databases

    Gene3Di 1.10.630.10. 1 hit.
    InterProi IPR001128. Cyt_P450.
    IPR017972. Cyt_P450_CS.
    IPR002401. Cyt_P450_E_grp-I.
    [Graphical view ]
    Pfami PF00067. p450. 1 hit.
    [Graphical view ]
    PRINTSi PR00463. EP450I.
    PR00385. P450.
    SUPFAMi SSF48264. SSF48264. 1 hit.
    PROSITEi PS00086. CYTOCHROME_P450. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and expression of a novel form of leukotriene B4 omega-hydroxylase from human liver."
      Kikuta Y., Kusunose E., Kondo T., Yamamoto S., Kinoshita H., Kusunose M.
      FEBS Lett. 348:70-74(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Liver.
    2. "The human liver CYP4F2 cDNA sequence and expression in baculovirus-infected insect cells."
      Chen L., Hardwick J.P.
      Submitted (JUL-2000) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Liver.
    3. "Expression and molecular cloning of human liver leukotriene B4 omega-hydroxylase (CYP4F2) gene."
      Kikuta Y., Miyauchi Y., Kusunose E., Kusunose M.
      DNA Cell Biol. 18:723-730(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT VAL-185.
      Tissue: Kidney and Small intestine.
    5. SeattleSNPs variation discovery resource
      Submitted (JAN-2002) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS TYR-7; GLY-12; VAL-185; MET-433 AND MET-519.
    6. "The DNA sequence and biology of human chromosome 19."
      Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
      , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
      Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS GLY-12 AND MET-433.
    8. "Promoter activity and regulation of the CYP4F2 leukotriene B4 omega hydroxylase gene by peroxisomal proliferators and retinoic acid in HepG2 cells."
      Zhang X., Chen L., Hardwick J.P.
      Arch. Biochem. Biophys. 378:364-376(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-175.
      Tissue: Liver.

    Entry informationi

    Entry nameiCP4F2_HUMAN
    AccessioniPrimary (citable) accession number: P78329
    Secondary accession number(s): A8K425
    , B4DV75, Q16677, Q6NWT4, Q6NWT6, Q9NNZ0, Q9UIU8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 15, 1998
    Last sequence update: May 1, 1997
    Last modified: October 1, 2014
    This is version 142 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 19
      Human chromosome 19: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3