Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nucleolar protein 14

Gene

NOP14

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Involved in nucleolar processing of pre-18S ribosomal RNA. Has a role in the nuclear export of 40S pre-ribosomal subunit to the cytoplasm (By similarity).By similarity

GO - Molecular functioni

  1. enzyme binding Source: UniProtKB
  2. poly(A) RNA binding Source: UniProtKB
  3. snoRNA binding Source: UniProtKB

GO - Biological processi

  1. endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Source: UniProtKB
  2. endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Source: UniProtKB
  3. endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Source: UniProtKB
  4. maturation of SSU-rRNA Source: GO_Central
  5. maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Source: UniProtKB
  6. ribosomal small subunit biogenesis Source: UniProtKB
  7. rRNA processing Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Ribosome biogenesis, rRNA processing

Names & Taxonomyi

Protein namesi
Recommended name:
Nucleolar protein 14
Alternative name(s):
Nucleolar complex protein 14
Gene namesi
Name:NOP14
Synonyms:C4orf9, NOL14
ORF Names:RES4-25
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 4

Organism-specific databases

HGNCiHGNC:16821. NOP14.

Subcellular locationi

Nucleusnucleolus By similarity

GO - Cellular componenti

  1. 90S preribosome Source: UniProtKB
  2. membrane Source: UniProtKB
  3. mitochondrion Source: UniProtKB
  4. Noc4p-Nop14p complex Source: UniProtKB
  5. nucleolus Source: UniProtKB
  6. nucleus Source: HPA
  7. small-subunit processome Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA164723982.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 857857Nucleolar protein 14PRO_0000137155Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei96 – 961Phosphoserine4 Publications
Modified residuei146 – 1461Phosphoserine6 Publications
Modified residuei148 – 1481Phosphoserine5 Publications
Modified residuei349 – 3491Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiP78316.
PaxDbiP78316.
PRIDEiP78316.

PTM databases

PhosphoSiteiP78316.

Miscellaneous databases

PMAP-CutDBP78316.

Expressioni

Gene expression databases

BgeeiP78316.
CleanExiHS_NOP14.
ExpressionAtlasiP78316. baseline and differential.
GenevestigatoriP78316.

Organism-specific databases

HPAiHPA039596.
HPA055652.

Interactioni

Subunit structurei

Component of the ribosomal small subunit (SSU) processome.By similarity

Protein-protein interaction databases

BioGridi114162. 16 interactions.
MINTiMINT-3022939.
STRINGi9606.ENSP00000315674.

Structurei

3D structure databases

ProteinModelPortaliP78316.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the NOP14 family.Curated

Phylogenomic databases

eggNOGiNOG242520.
GeneTreeiENSGT00390000017459.
HOGENOMiHOG000285983.
HOVERGENiHBG052649.
InParanoidiP78316.
KOiK14766.
OMAiHRPLAIK.
OrthoDBiEOG78PV8T.
PhylomeDBiP78316.
TreeFamiTF105698.

Family and domain databases

InterProiIPR007276. Nop14.
[Graphical view]
PANTHERiPTHR23183. PTHR23183. 1 hit.
PfamiPF04147. Nop14. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P78316-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAKAKKVGAR RKASGAPAGA RGGPAKANSN PFEVKVNRQK FQILGRKTRH
60 70 80 90 100
DVGLPGVSRA RALRKRTQTL LKEYKERDKS NVFRDKRFGE YNSNMSPEEK
110 120 130 140 150
MMKRFALEQQ RHHEKKSIYN LNEDEELTHY GQSLADIEKH NDIVDSDSDA
160 170 180 190 200
EDRGTLSAEL TAAHFGGGGG LLHKKTQQEG EEREKPKSRK ELIEELIAKS
210 220 230 240 250
KQEKRERQAQ REDALELTEK LDQDWKEIQT LLSHKTPKSE NRDKKEKPKP
260 270 280 290 300
DAYDMMVREL GFEMKAQPSN RMKTEAELAK EEQEHLRKLE AERLRRMLGK
310 320 330 340 350
DEDENVKKPK HMSADDLNDG FVLDKDDRRL LSYKDGKMNV EEDVQEEQSK
360 370 380 390 400
EASDPESNEE EGDSSGGEDT EESDSPDSHL DLESNVESEE ENEKPAKEQR
410 420 430 440 450
QTPGKGLISG KERAGKATRD ELPYTFAAPE SYEELRSLLL GRSMEEQLLV
460 470 480 490 500
VERIQKCNHP SLAEGNKAKL EKLFGFLLEY VGDLATDDPP DLTVIDKLVV
510 520 530 540 550
HLYHLCQMFP ESASDAIKFV LRDAMHEMEE MIETKGRAAL PGLDVLIYLK
560 570 580 590 600
ITGLLFPTSD FWHPVVTPAL VCLSQLLTKC PILSLQDVVK GLFVCCLFLE
610 620 630 640 650
YVALSQRFIP ELINFLLGIL YIATPNKASQ GSTLVHPFRA LGKNSELLVV
660 670 680 690 700
SAREDVATWQ QSSLSLRWAS RLRAPTSTEA NHIRLSCLAV GLALLKRCVL
710 720 730 740 750
MYGSLPSFHA IMGPLQALLT DHLADCSHPQ ELQELCQSTL TEMESQKQLC
760 770 780 790 800
RPLTCEKSKP VPLKLFTPRL VKVLEFGRKQ GSSKEEQERK RLIHKHKREF
810 820 830 840 850
KGAVREIRKD NQFLARMQLS EIMERDAERK RKVKQLFNSL ATQEGEWKAL

KRKKFKK
Length:857
Mass (Da):97,668
Last modified:December 6, 2004 - v3
Checksum:iCDADFB91083DBB75
GO
Isoform 2 (identifier: P78316-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     772-819: KVLEFGRKQG...DNQFLARMQL → SNSRPQVIHLPWPPNYRCEPQHPAKKVIFFRVIML
     820-857: Missing.

Note: No experimental confirmation available.

Show »
Length:806
Mass (Da):91,385
Checksum:iB7EEF5F61E6D6390
GO

Sequence cautioni

The sequence AAB97011.1 differs from that shown. Reason: Erroneous initiation. Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti380 – 3801L → S.1 Publication
Corresponds to variant rs2515960 [ dbSNP | Ensembl ].
VAR_053540
Natural varianti716 – 7161Q → R.
Corresponds to variant rs1054090 [ dbSNP | Ensembl ].
VAR_060075

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei772 – 81948KVLEF…ARMQL → SNSRPQVIHLPWPPNYRCEP QHPAKKVIFFRVIML in isoform 2. 1 PublicationVSP_018021Add
BLAST
Alternative sequencei820 – 85738Missing in isoform 2. 1 PublicationVSP_018022Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF040965 mRNA. Translation: AAB97011.1. Different initiation.
CH471131 Genomic DNA. Translation: EAW82489.1.
CH471131 Genomic DNA. Translation: EAW82491.1.
CH471131 Genomic DNA. Translation: EAW82492.1.
BC026035 mRNA. Translation: AAH26035.1.
BC053635 mRNA. Translation: AAH53635.1.
AB000467 mRNA. Translation: BAA19121.1.
CCDSiCCDS33945.1. [P78316-1]
PIRiJE0188.
RefSeqiNP_001278907.1. NM_001291978.1. [P78316-1]
NP_001278908.1. NM_001291979.1. [P78316-2]
NP_003694.1. NM_003703.2. [P78316-1]
UniGeneiHs.627133.

Genome annotation databases

EnsembliENST00000314262; ENSP00000315674; ENSG00000087269. [P78316-1]
ENST00000398071; ENSP00000381146; ENSG00000087269. [P78316-2]
ENST00000416614; ENSP00000405068; ENSG00000087269. [P78316-1]
GeneIDi8602.
KEGGihsa:8602.
UCSCiuc003ggj.1. human. [P78316-1]

Polymorphism databases

DMDMi56404449.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF040965 mRNA. Translation: AAB97011.1. Different initiation.
CH471131 Genomic DNA. Translation: EAW82489.1.
CH471131 Genomic DNA. Translation: EAW82491.1.
CH471131 Genomic DNA. Translation: EAW82492.1.
BC026035 mRNA. Translation: AAH26035.1.
BC053635 mRNA. Translation: AAH53635.1.
AB000467 mRNA. Translation: BAA19121.1.
CCDSiCCDS33945.1. [P78316-1]
PIRiJE0188.
RefSeqiNP_001278907.1. NM_001291978.1. [P78316-1]
NP_001278908.1. NM_001291979.1. [P78316-2]
NP_003694.1. NM_003703.2. [P78316-1]
UniGeneiHs.627133.

3D structure databases

ProteinModelPortaliP78316.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114162. 16 interactions.
MINTiMINT-3022939.
STRINGi9606.ENSP00000315674.

PTM databases

PhosphoSiteiP78316.

Polymorphism databases

DMDMi56404449.

Proteomic databases

MaxQBiP78316.
PaxDbiP78316.
PRIDEiP78316.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000314262; ENSP00000315674; ENSG00000087269. [P78316-1]
ENST00000398071; ENSP00000381146; ENSG00000087269. [P78316-2]
ENST00000416614; ENSP00000405068; ENSG00000087269. [P78316-1]
GeneIDi8602.
KEGGihsa:8602.
UCSCiuc003ggj.1. human. [P78316-1]

Organism-specific databases

CTDi8602.
GeneCardsiGC04M002939.
H-InvDBHIX0004040.
HGNCiHGNC:16821. NOP14.
HPAiHPA039596.
HPA055652.
MIMi611526. gene.
neXtProtiNX_P78316.
PharmGKBiPA164723982.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG242520.
GeneTreeiENSGT00390000017459.
HOGENOMiHOG000285983.
HOVERGENiHBG052649.
InParanoidiP78316.
KOiK14766.
OMAiHRPLAIK.
OrthoDBiEOG78PV8T.
PhylomeDBiP78316.
TreeFamiTF105698.

Miscellaneous databases

GenomeRNAii8602.
NextBioi32233.
PMAP-CutDBP78316.
PROiP78316.
SOURCEiSearch...

Gene expression databases

BgeeiP78316.
CleanExiHS_NOP14.
ExpressionAtlasiP78316. baseline and differential.
GenevestigatoriP78316.

Family and domain databases

InterProiIPR007276. Nop14.
[Graphical view]
PANTHERiPTHR23183. PTHR23183. 1 hit.
PfamiPF04147. Nop14. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT SER-380.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Cervix and Colon.
  4. "The primary structure and genomic organization of five novel transcripts located close to the Huntington's disease gene on human chromosome 4p16.3."
    Hadano S., Ishida Y., Ikeda J.-E.
    DNA Res. 5:177-186(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 140-857 (ISOFORM 1).
    Tissue: Brain.
  5. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-146 AND SER-148, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-96, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  7. "Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography."
    Han G., Ye M., Zhou H., Jiang X., Feng S., Jiang X., Tian R., Wan D., Zou H., Gu J.
    Proteomics 8:1346-1361(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-146 AND SER-148, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  8. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  9. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-96; SER-146 AND SER-148, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  10. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-96; SER-146 AND SER-148, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  11. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  12. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-96; SER-146 AND SER-349, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  13. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  14. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-146 AND SER-148, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiNOP14_HUMAN
AccessioniPrimary (citable) accession number: P78316
Secondary accession number(s): D3DVR6
, Q7LGI5, Q7Z6K0, Q8TBR6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 6, 2004
Last sequence update: December 6, 2004
Last modified: March 31, 2015
This is version 119 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.