Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P78316

- NOP14_HUMAN

UniProt

P78316 - NOP14_HUMAN

Protein

Nucleolar protein 14

Gene

NOP14

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 114 (01 Oct 2014)
      Sequence version 3 (07 Dec 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Involved in nucleolar processing of pre-18S ribosomal RNA. Has a role in the nuclear export of 40S pre-ribosomal subunit to the cytoplasm By similarity.By similarity

    GO - Molecular functioni

    1. enzyme binding Source: UniProt
    2. poly(A) RNA binding Source: UniProtKB
    3. snoRNA binding Source: UniProtKB

    GO - Biological processi

    1. endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Source: UniProtKB
    2. endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Source: UniProtKB
    3. endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Source: UniProtKB
    4. maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Source: UniProtKB
    5. ribosomal small subunit biogenesis Source: UniProtKB
    6. rRNA processing Source: UniProtKB

    Keywords - Biological processi

    Ribosome biogenesis, rRNA processing

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Nucleolar protein 14
    Alternative name(s):
    Nucleolar complex protein 14
    Gene namesi
    Name:NOP14
    Synonyms:C4orf9, NOL14
    ORF Names:RES4-25
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 4

    Organism-specific databases

    HGNCiHGNC:16821. NOP14.

    Subcellular locationi

    Nucleusnucleolus By similarity

    GO - Cellular componenti

    1. 90S preribosome Source: UniProtKB
    2. membrane Source: UniProtKB
    3. mitochondrion Source: UniProtKB
    4. Noc4p-Nop14p complex Source: UniProtKB
    5. nucleolus Source: UniProtKB
    6. nucleus Source: HPA
    7. small-subunit processome Source: UniProtKB

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA164723982.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 857857Nucleolar protein 14PRO_0000137155Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei96 – 961Phosphoserine4 Publications
    Modified residuei146 – 1461Phosphoserine5 Publications
    Modified residuei148 – 1481Phosphoserine4 Publications
    Modified residuei349 – 3491Phosphoserine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiP78316.
    PaxDbiP78316.
    PRIDEiP78316.

    PTM databases

    PhosphoSiteiP78316.

    Miscellaneous databases

    PMAP-CutDBP78316.

    Expressioni

    Gene expression databases

    ArrayExpressiP78316.
    BgeeiP78316.
    CleanExiHS_NOP14.
    GenevestigatoriP78316.

    Organism-specific databases

    HPAiHPA039596.
    HPA055652.

    Interactioni

    Subunit structurei

    Component of the ribosomal small subunit (SSU) processome.By similarity

    Protein-protein interaction databases

    BioGridi114162. 10 interactions.
    MINTiMINT-3022939.
    STRINGi9606.ENSP00000315674.

    Structurei

    3D structure databases

    ProteinModelPortaliP78316.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the NOP14 family.Curated

    Phylogenomic databases

    eggNOGiNOG242520.
    HOGENOMiHOG000285983.
    HOVERGENiHBG052649.
    InParanoidiP78316.
    KOiK14766.
    OMAiHRPLAIK.
    OrthoDBiEOG78PV8T.
    PhylomeDBiP78316.
    TreeFamiTF105698.

    Family and domain databases

    InterProiIPR007276. Nop14.
    [Graphical view]
    PANTHERiPTHR23183. PTHR23183. 1 hit.
    PfamiPF04147. Nop14. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P78316-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAKAKKVGAR RKASGAPAGA RGGPAKANSN PFEVKVNRQK FQILGRKTRH    50
    DVGLPGVSRA RALRKRTQTL LKEYKERDKS NVFRDKRFGE YNSNMSPEEK 100
    MMKRFALEQQ RHHEKKSIYN LNEDEELTHY GQSLADIEKH NDIVDSDSDA 150
    EDRGTLSAEL TAAHFGGGGG LLHKKTQQEG EEREKPKSRK ELIEELIAKS 200
    KQEKRERQAQ REDALELTEK LDQDWKEIQT LLSHKTPKSE NRDKKEKPKP 250
    DAYDMMVREL GFEMKAQPSN RMKTEAELAK EEQEHLRKLE AERLRRMLGK 300
    DEDENVKKPK HMSADDLNDG FVLDKDDRRL LSYKDGKMNV EEDVQEEQSK 350
    EASDPESNEE EGDSSGGEDT EESDSPDSHL DLESNVESEE ENEKPAKEQR 400
    QTPGKGLISG KERAGKATRD ELPYTFAAPE SYEELRSLLL GRSMEEQLLV 450
    VERIQKCNHP SLAEGNKAKL EKLFGFLLEY VGDLATDDPP DLTVIDKLVV 500
    HLYHLCQMFP ESASDAIKFV LRDAMHEMEE MIETKGRAAL PGLDVLIYLK 550
    ITGLLFPTSD FWHPVVTPAL VCLSQLLTKC PILSLQDVVK GLFVCCLFLE 600
    YVALSQRFIP ELINFLLGIL YIATPNKASQ GSTLVHPFRA LGKNSELLVV 650
    SAREDVATWQ QSSLSLRWAS RLRAPTSTEA NHIRLSCLAV GLALLKRCVL 700
    MYGSLPSFHA IMGPLQALLT DHLADCSHPQ ELQELCQSTL TEMESQKQLC 750
    RPLTCEKSKP VPLKLFTPRL VKVLEFGRKQ GSSKEEQERK RLIHKHKREF 800
    KGAVREIRKD NQFLARMQLS EIMERDAERK RKVKQLFNSL ATQEGEWKAL 850
    KRKKFKK 857
    Length:857
    Mass (Da):97,668
    Last modified:December 7, 2004 - v3
    Checksum:iCDADFB91083DBB75
    GO
    Isoform 2 (identifier: P78316-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         772-819: KVLEFGRKQG...DNQFLARMQL → SNSRPQVIHLPWPPNYRCEPQHPAKKVIFFRVIML
         820-857: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:806
    Mass (Da):91,385
    Checksum:iB7EEF5F61E6D6390
    GO

    Sequence cautioni

    The sequence AAB97011.1 differs from that shown. Reason: Erroneous initiation.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti380 – 3801L → S.1 Publication
    Corresponds to variant rs2515960 [ dbSNP | Ensembl ].
    VAR_053540
    Natural varianti716 – 7161Q → R.
    Corresponds to variant rs1054090 [ dbSNP | Ensembl ].
    VAR_060075

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei772 – 81948KVLEF…ARMQL → SNSRPQVIHLPWPPNYRCEP QHPAKKVIFFRVIML in isoform 2. 1 PublicationVSP_018021Add
    BLAST
    Alternative sequencei820 – 85738Missing in isoform 2. 1 PublicationVSP_018022Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF040965 mRNA. Translation: AAB97011.1. Different initiation.
    CH471131 Genomic DNA. Translation: EAW82489.1.
    CH471131 Genomic DNA. Translation: EAW82491.1.
    CH471131 Genomic DNA. Translation: EAW82492.1.
    BC026035 mRNA. Translation: AAH26035.1.
    BC053635 mRNA. Translation: AAH53635.1.
    AB000467 mRNA. Translation: BAA19121.1.
    CCDSiCCDS33945.1. [P78316-1]
    PIRiJE0188.
    RefSeqiNP_003694.1. NM_003703.2. [P78316-1]
    UniGeneiHs.627133.

    Genome annotation databases

    EnsembliENST00000314262; ENSP00000315674; ENSG00000087269. [P78316-1]
    ENST00000398071; ENSP00000381146; ENSG00000087269. [P78316-2]
    ENST00000416614; ENSP00000405068; ENSG00000087269. [P78316-1]
    GeneIDi8602.
    KEGGihsa:8602.
    UCSCiuc003ggj.1. human. [P78316-1]

    Polymorphism databases

    DMDMi56404449.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF040965 mRNA. Translation: AAB97011.1 . Different initiation.
    CH471131 Genomic DNA. Translation: EAW82489.1 .
    CH471131 Genomic DNA. Translation: EAW82491.1 .
    CH471131 Genomic DNA. Translation: EAW82492.1 .
    BC026035 mRNA. Translation: AAH26035.1 .
    BC053635 mRNA. Translation: AAH53635.1 .
    AB000467 mRNA. Translation: BAA19121.1 .
    CCDSi CCDS33945.1. [P78316-1 ]
    PIRi JE0188.
    RefSeqi NP_003694.1. NM_003703.2. [P78316-1 ]
    UniGenei Hs.627133.

    3D structure databases

    ProteinModelPortali P78316.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 114162. 10 interactions.
    MINTi MINT-3022939.
    STRINGi 9606.ENSP00000315674.

    PTM databases

    PhosphoSitei P78316.

    Polymorphism databases

    DMDMi 56404449.

    Proteomic databases

    MaxQBi P78316.
    PaxDbi P78316.
    PRIDEi P78316.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000314262 ; ENSP00000315674 ; ENSG00000087269 . [P78316-1 ]
    ENST00000398071 ; ENSP00000381146 ; ENSG00000087269 . [P78316-2 ]
    ENST00000416614 ; ENSP00000405068 ; ENSG00000087269 . [P78316-1 ]
    GeneIDi 8602.
    KEGGi hsa:8602.
    UCSCi uc003ggj.1. human. [P78316-1 ]

    Organism-specific databases

    CTDi 8602.
    GeneCardsi GC04M002910.
    H-InvDB HIX0004040.
    HGNCi HGNC:16821. NOP14.
    HPAi HPA039596.
    HPA055652.
    MIMi 611526. gene.
    neXtProti NX_P78316.
    PharmGKBi PA164723982.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG242520.
    HOGENOMi HOG000285983.
    HOVERGENi HBG052649.
    InParanoidi P78316.
    KOi K14766.
    OMAi HRPLAIK.
    OrthoDBi EOG78PV8T.
    PhylomeDBi P78316.
    TreeFami TF105698.

    Miscellaneous databases

    GenomeRNAii 8602.
    NextBioi 32233.
    PMAP-CutDB P78316.
    PROi P78316.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P78316.
    Bgeei P78316.
    CleanExi HS_NOP14.
    Genevestigatori P78316.

    Family and domain databases

    InterProi IPR007276. Nop14.
    [Graphical view ]
    PANTHERi PTHR23183. PTHR23183. 1 hit.
    Pfami PF04147. Nop14. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT SER-380.
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Cervix and Colon.
    4. "The primary structure and genomic organization of five novel transcripts located close to the Huntington's disease gene on human chromosome 4p16.3."
      Hadano S., Ishida Y., Ikeda J.-E.
      DNA Res. 5:177-186(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 140-857 (ISOFORM 1).
      Tissue: Brain.
    5. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
      Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
      Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-146 AND SER-148, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-96, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    7. "Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography."
      Han G., Ye M., Zhou H., Jiang X., Feng S., Jiang X., Tian R., Wan D., Zou H., Gu J.
      Proteomics 8:1346-1361(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-146 AND SER-148, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Liver.
    8. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    9. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-96; SER-146 AND SER-148, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    10. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-96; SER-146 AND SER-148, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    11. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    12. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-96; SER-146 AND SER-349, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    13. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiNOP14_HUMAN
    AccessioniPrimary (citable) accession number: P78316
    Secondary accession number(s): D3DVR6
    , Q7LGI5, Q7Z6K0, Q8TBR6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 7, 2004
    Last sequence update: December 7, 2004
    Last modified: October 1, 2014
    This is version 114 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 4
      Human chromosome 4: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3