Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

SH3 domain-binding protein 2

Gene

SH3BP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Binds differentially to the SH3 domains of certain proteins of signal transduction pathways. Binds to phosphatidylinositols; linking the hemopoietic tyrosine kinase fes to the cytoplasmic membrane in a phosphorylation dependent mechanism.

GO - Molecular functioni

  • SH3/SH2 adaptor activity Source: ProtInc

GO - Biological processi

  • signal transduction Source: ProtInc
Complete GO annotation...

Enzyme and pathway databases

BioCyciZFISH:ENSG00000087266-MONOMER.
SignaLinkiP78314.
SIGNORiP78314.

Names & Taxonomyi

Protein namesi
Recommended name:
SH3 domain-binding protein 2
Short name:
3BP-2
Gene namesi
Name:SH3BP2
Synonyms:3BP2
ORF Names:RES4-23
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

HGNCiHGNC:10825. SH3BP2.

Pathology & Biotechi

Involvement in diseasei

Cherubism (CRBM)3 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal dominant syndrome characterized by excessive bone degradation of the upper and lower jaws, which often begins around three years of age. It is followed by development of fibrous tissue masses, which causes a characteristic facial swelling.
See also OMIM:118400
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_013257415R → P in CRBM. 1 PublicationCorresponds to variant rs121909149dbSNPEnsembl.1
Natural variantiVAR_013258415R → Q in CRBM. 1 PublicationCorresponds to variant rs121909149dbSNPEnsembl.1
Natural variantiVAR_013259418P → H in CRBM. 1 PublicationCorresponds to variant rs121909146dbSNPEnsembl.1
Natural variantiVAR_013260418P → L in CRBM. 1 PublicationCorresponds to variant rs121909146dbSNPEnsembl.1
Natural variantiVAR_013261418P → R in CRBM. 2 PublicationsCorresponds to variant rs121909146dbSNPEnsembl.1
Natural variantiVAR_013262420G → E in CRBM. 1 PublicationCorresponds to variant rs28938171dbSNPEnsembl.1
Natural variantiVAR_013263420G → R in CRBM. 2 PublicationsCorresponds to variant rs28938170dbSNPEnsembl.1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNETi6452.
MalaCardsiSH3BP2.
MIMi118400. phenotype.
OpenTargetsiENSG00000087266.
Orphaneti184. Cherubism.
PharmGKBiPA35733.

Polymorphism and mutation databases

BioMutaiSH3BP2.
DMDMi3023207.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000643651 – 561SH3 domain-binding protein 2Add BLAST561

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei174Phosphotyrosine; by SYKBy similarity1
Modified residuei183Phosphotyrosine; by SYKBy similarity1
Modified residuei278PhosphoserineCombined sources1
Modified residuei416PhosphoserineCombined sources1
Modified residuei427PhosphoserineCombined sources1
Modified residuei448Phosphotyrosine; by SYKBy similarity1

Post-translational modificationi

Phosphorylated. Phosphorylation at Tyr-448 may stimulate the activity of the LYN kinase (By similarity).By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiP78314.
PaxDbiP78314.
PeptideAtlasiP78314.
PRIDEiP78314.

PTM databases

iPTMnetiP78314.
PhosphoSitePlusiP78314.

Expressioni

Tissue specificityi

Expressed in a variety of tissues including lung, liver, skeletal muscle, kidney and pancreas.1 Publication

Gene expression databases

BgeeiENSG00000087266.
CleanExiHS_SH3BP2.
ExpressionAtlasiP78314. baseline and differential.
GenevisibleiP78314. HS.

Organism-specific databases

HPAiHPA036790.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
DBNLQ9UJU67EBI-727062,EBI-751783
KITP107213EBI-727062,EBI-1379503
SH3KBP1Q96B978EBI-727062,EBI-346595
TNKS2Q9H2K25EBI-727062,EBI-4398527
VAV1P154988EBI-727062,EBI-625518
VAV2P527354EBI-727062,EBI-297549

GO - Molecular functioni

  • SH3/SH2 adaptor activity Source: ProtInc

Protein-protein interaction databases

BioGridi112350. 20 interactors.
IntActiP78314. 23 interactors.
MINTiMINT-254189.
STRINGi9606.ENSP00000422168.

Structurei

Secondary structure

1561
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Turni455 – 457Combined sources3
Helixi464 – 474Combined sources11
Beta strandi485 – 489Combined sources5
Beta strandi496 – 501Combined sources6
Turni503 – 505Combined sources3
Beta strandi506 – 508Combined sources3
Beta strandi514 – 516Combined sources3
Beta strandi519 – 525Combined sources7
Beta strandi527 – 530Combined sources4
Helixi531 – 538Combined sources8
Beta strandi544 – 548Combined sources5
Beta strandi553 – 556Combined sources4

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2CR4NMR-A446-558[»]
3TWRX-ray1.55E/F/G/H410-425[»]
ProteinModelPortaliP78314.
SMRiP78314.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP78314.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini26 – 130PHPROSITE-ProRule annotationAdd BLAST105
Domaini457 – 555SH2PROSITE-ProRule annotationAdd BLAST99

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi201 – 210SH3-binding10

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi205 – 212Poly-Pro8
Compositional biasi236 – 240Poly-Pro5

Sequence similaritiesi

Contains 1 PH domain.PROSITE-ProRule annotation
Contains 1 SH2 domain.PROSITE-ProRule annotation

Keywords - Domaini

SH2 domain, SH3-binding

Phylogenomic databases

eggNOGiENOG410IGI1. Eukaryota.
ENOG4111SD6. LUCA.
GeneTreeiENSGT00390000002216.
HOGENOMiHOG000190359.
HOVERGENiHBG000016.
InParanoidiP78314.
KOiK07984.
OMAiNEDYEHE.
OrthoDBiEOG091G050K.
PhylomeDBiP78314.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
3.30.505.10. 1 hit.
InterProiIPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR000980. SH2.
[Graphical view]
PfamiPF00169. PH. 1 hit.
PF00017. SH2. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00252. SH2. 1 hit.
[Graphical view]
SUPFAMiSSF50729. SSF50729. 1 hit.
SSF55550. SSF55550. 1 hit.
PROSITEiPS50003. PH_DOMAIN. 1 hit.
PS50001. SH2. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P78314-1) [UniParc]FASTAAdd to basket
Also known as: Long

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAEEMHWPV PMKAIGAQNL LTMPGGVAKA GYLHKKGGTQ LQLLKWPLRF
60 70 80 90 100
VIIHKRCVYY FKSSTSASPQ GAFSLSGYNR VMRAAEETTS NNVFPFKIIH
110 120 130 140 150
ISKKHRTWFF SASSEEERKS WMALLRREIG HFHEKKDLPL DTSDSSSDTD
160 170 180 190 200
SFYGAVERPV DISLSPYPTD NEDYEHDDED DSYLEPDSPE PGRLEDALMH
210 220 230 240 250
PPAYPPPPVP TPRKPAFSDM PRAHSFTSKG PGPLLPPPPP KHGLPDVGLA
260 270 280 290 300
AEDSKRDPLC PRRAEPCPRV PATPRRMSDP PLSTMPTAPG LRKPPCFRES
310 320 330 340 350
ASPSPEPWTP GHGACSTSSA AIMATATSRN CDKLKSFHLS PRGPPTSEPP
360 370 380 390 400
PVPANKPKFL KIAEEDPPRE AAMPGLFVPP VAPRPPALKL PVPEAMARPA
410 420 430 440 450
VLPRPEKPQL PHLQRSPPDG QSFRSFSFEK PRQPSQADTG GDDSDEDYEK
460 470 480 490 500
VPLPNSVFVN TTESCEVERL FKATSPRGEP QDGLYCIRNS STKSGKVLVV
510 520 530 540 550
WDETSNKVRN YRIFEKDSKF YLEGEVLFVS VGSMVEHYHT HVLPSHQSLL
560
LRHPYGYTGP R
Length:561
Mass (Da):62,244
Last modified:July 15, 1998 - v2
Checksum:i69E6846A4F6D8F15
GO
Isoform 2 (identifier: P78314-2) [UniParc]FASTAAdd to basket
Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     81-97: VMRAAEETTSNNVFPFK → QPRPQPAQALSQTEAGP
     98-561: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:97
Mass (Da):10,624
Checksum:i58CB0FBE9EB3A7FF
GO
Isoform 3 (identifier: P78314-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MASLGPRTPAPSRSRGRRAMCWVSTISFM

Note: No experimental confirmation available.
Show »
Length:589
Mass (Da):65,305
Checksum:iB41A1B1688245A77
GO
Isoform 4 (identifier: P78314-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAGSGPRPRSWGRREAGARDEAAAAGGRGPGPCRCSQGRRAWIAPGKPAMPAAWTPFM

Note: No experimental confirmation available.
Show »
Length:618
Mass (Da):68,129
Checksum:i4A1A055BBB057AD9
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti27V → L in AAB59973 (PubMed:9734812).Curated1
Sequence conflicti224H → N in AAB59973 (PubMed:9734812).Curated1
Sequence conflicti249L → R in AAB59973 (PubMed:9734812).Curated1
Sequence conflicti251A → P in AAB59973 (PubMed:9734812).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_013257415R → P in CRBM. 1 PublicationCorresponds to variant rs121909149dbSNPEnsembl.1
Natural variantiVAR_013258415R → Q in CRBM. 1 PublicationCorresponds to variant rs121909149dbSNPEnsembl.1
Natural variantiVAR_013259418P → H in CRBM. 1 PublicationCorresponds to variant rs121909146dbSNPEnsembl.1
Natural variantiVAR_013260418P → L in CRBM. 1 PublicationCorresponds to variant rs121909146dbSNPEnsembl.1
Natural variantiVAR_013261418P → R in CRBM. 2 PublicationsCorresponds to variant rs121909146dbSNPEnsembl.1
Natural variantiVAR_013262420G → E in CRBM. 1 PublicationCorresponds to variant rs28938171dbSNPEnsembl.1
Natural variantiVAR_013263420G → R in CRBM. 2 PublicationsCorresponds to variant rs28938170dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0436361M → MASLGPRTPAPSRSRGRRAM CWVSTISFM in isoform 3. 1 Publication1
Alternative sequenceiVSP_0550461M → MAGSGPRPRSWGRREAGARD EAAAAGGRGPGPCRCSQGRR AWIAPGKPAMPAAWTPFM in isoform 4. Curated1
Alternative sequenceiVSP_00408581 – 97VMRAA…VFPFK → QPRPQPAQALSQTEAGP in isoform 2. 2 PublicationsAdd BLAST17
Alternative sequenceiVSP_00408698 – 561Missing in isoform 2. 2 PublicationsAdd BLAST464

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF000936 mRNA. Translation: AAB59973.1.
U56386 mRNA. Translation: AAB72034.1.
AB000462 mRNA. Translation: BAA19119.1.
AB000463 mRNA. Translation: BAA19120.1.
AK299996 mRNA. Translation: BAG61816.1.
AK312286 mRNA. Translation: BAG35213.1.
AL121750 Genomic DNA. No translation available.
CH471131 Genomic DNA. Translation: EAW82509.1.
CH471131 Genomic DNA. Translation: EAW82510.1.
CH471131 Genomic DNA. Translation: EAW82511.1.
CH471131 Genomic DNA. Translation: EAW82512.1.
BC022996 mRNA. Translation: AAH22996.1.
CCDSiCCDS33944.1. [P78314-1]
CCDS54715.1. [P78314-3]
CCDS54716.1. [P78314-4]
RefSeqiNP_001116153.1. NM_001122681.1. [P78314-1]
NP_001139327.1. NM_001145855.1. [P78314-3]
NP_001139328.1. NM_001145856.1. [P78314-4]
NP_003014.3. NM_003023.4. [P78314-1]
UniGeneiHs.167679.

Genome annotation databases

EnsembliENST00000356331; ENSP00000348685; ENSG00000087266. [P78314-1]
ENST00000435136; ENSP00000403231; ENSG00000087266. [P78314-1]
ENST00000442312; ENSP00000388152; ENSG00000087266. [P78314-3]
ENST00000452765; ENSP00000409746; ENSG00000087266. [P78314-1]
ENST00000503393; ENSP00000422168; ENSG00000087266. [P78314-4]
ENST00000511747; ENSP00000424846; ENSG00000087266. [P78314-1]
ENST00000513020; ENSP00000424072; ENSG00000087266. [P78314-2]
ENST00000515737; ENSP00000422605; ENSG00000087266. [P78314-2]
GeneIDi6452.
KEGGihsa:6452.
UCSCiuc003gfi.5. human. [P78314-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF000936 mRNA. Translation: AAB59973.1.
U56386 mRNA. Translation: AAB72034.1.
AB000462 mRNA. Translation: BAA19119.1.
AB000463 mRNA. Translation: BAA19120.1.
AK299996 mRNA. Translation: BAG61816.1.
AK312286 mRNA. Translation: BAG35213.1.
AL121750 Genomic DNA. No translation available.
CH471131 Genomic DNA. Translation: EAW82509.1.
CH471131 Genomic DNA. Translation: EAW82510.1.
CH471131 Genomic DNA. Translation: EAW82511.1.
CH471131 Genomic DNA. Translation: EAW82512.1.
BC022996 mRNA. Translation: AAH22996.1.
CCDSiCCDS33944.1. [P78314-1]
CCDS54715.1. [P78314-3]
CCDS54716.1. [P78314-4]
RefSeqiNP_001116153.1. NM_001122681.1. [P78314-1]
NP_001139327.1. NM_001145855.1. [P78314-3]
NP_001139328.1. NM_001145856.1. [P78314-4]
NP_003014.3. NM_003023.4. [P78314-1]
UniGeneiHs.167679.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2CR4NMR-A446-558[»]
3TWRX-ray1.55E/F/G/H410-425[»]
ProteinModelPortaliP78314.
SMRiP78314.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112350. 20 interactors.
IntActiP78314. 23 interactors.
MINTiMINT-254189.
STRINGi9606.ENSP00000422168.

PTM databases

iPTMnetiP78314.
PhosphoSitePlusiP78314.

Polymorphism and mutation databases

BioMutaiSH3BP2.
DMDMi3023207.

Proteomic databases

MaxQBiP78314.
PaxDbiP78314.
PeptideAtlasiP78314.
PRIDEiP78314.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000356331; ENSP00000348685; ENSG00000087266. [P78314-1]
ENST00000435136; ENSP00000403231; ENSG00000087266. [P78314-1]
ENST00000442312; ENSP00000388152; ENSG00000087266. [P78314-3]
ENST00000452765; ENSP00000409746; ENSG00000087266. [P78314-1]
ENST00000503393; ENSP00000422168; ENSG00000087266. [P78314-4]
ENST00000511747; ENSP00000424846; ENSG00000087266. [P78314-1]
ENST00000513020; ENSP00000424072; ENSG00000087266. [P78314-2]
ENST00000515737; ENSP00000422605; ENSG00000087266. [P78314-2]
GeneIDi6452.
KEGGihsa:6452.
UCSCiuc003gfi.5. human. [P78314-1]

Organism-specific databases

CTDi6452.
DisGeNETi6452.
GeneCardsiSH3BP2.
GeneReviewsiSH3BP2.
HGNCiHGNC:10825. SH3BP2.
HPAiHPA036790.
MalaCardsiSH3BP2.
MIMi118400. phenotype.
602104. gene.
neXtProtiNX_P78314.
OpenTargetsiENSG00000087266.
Orphaneti184. Cherubism.
PharmGKBiPA35733.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IGI1. Eukaryota.
ENOG4111SD6. LUCA.
GeneTreeiENSGT00390000002216.
HOGENOMiHOG000190359.
HOVERGENiHBG000016.
InParanoidiP78314.
KOiK07984.
OMAiNEDYEHE.
OrthoDBiEOG091G050K.
PhylomeDBiP78314.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000087266-MONOMER.
SignaLinkiP78314.
SIGNORiP78314.

Miscellaneous databases

ChiTaRSiSH3BP2. human.
EvolutionaryTraceiP78314.
GenomeRNAii6452.
PROiP78314.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000087266.
CleanExiHS_SH3BP2.
ExpressionAtlasiP78314. baseline and differential.
GenevisibleiP78314. HS.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
3.30.505.10. 1 hit.
InterProiIPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR000980. SH2.
[Graphical view]
PfamiPF00169. PH. 1 hit.
PF00017. SH2. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00252. SH2. 1 hit.
[Graphical view]
SUPFAMiSSF50729. SSF50729. 1 hit.
SSF55550. SSF55550. 1 hit.
PROSITEiPS50003. PH_DOMAIN. 1 hit.
PS50001. SH2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry namei3BP2_HUMAN
AccessioniPrimary (citable) accession number: P78314
Secondary accession number(s): A6NNC2
, B2R5R6, B4DT04, D3DVR0, D6R919, O00500, O15373, P78315
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: July 15, 1998
Last modified: November 30, 2016
This is version 156 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.