Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

P70587 (LRRC7_RAT) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 104. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (1) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Leucine-rich repeat-containing protein 7
Alternative name(s):
Densin-180
Short name=Densin
Protein LAP1
Gene names
Name:Lrrc7
Synonyms:Lap1
OrganismRattus norvegicus (Rat) [Reference proteome]
Taxonomic identifier10116 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus

Protein attributes

Sequence length1490 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Required for normal synaptic spine architecture and function. Necessary for DISC1 and GRM5 localization to postsynaptic density complexes and for both N-methyl D-aspartate receptor-dependent and metabotropic glutamate receptor-dependent long term depression By similarity.

Subunit structure

Interacts with CAMKII and CTNND2/Catenin delta-2. Forms a complex with N-cadherin through CTNND2 By similarity. Isoform 5 appears not to bind CAMKII. Interacts with CNKSR2 and DLG4. Ref.2 Ref.3

Subcellular location

Cytoplasm By similarity. Cell junctionsynapsepostsynaptic cell membranepostsynaptic density By similarity.

Tissue specificity

Brain-specific. Highly concentrated at synapses. Ref.1

Developmental stage

Expression of isoform 2 is predominant at E18, but decreased during postnatal development paralleling increased expression of isoform 4 and isoform 5. Ref.2

Post-translational modification

O-glycosylated and phosphorylated. Ref.1

Sequence similarities

Belongs to the LAP (LRR and PDZ) protein family.

Contains 17 LRR (leucine-rich) repeats.

Contains 1 PDZ (DHR) domain.

Binary interactions

With

Entry

#Exp.

IntAct

Notes

Camk2aP112752EBI-7798464,EBI-2640645
Camk2aP117982EBI-7798464,EBI-400384From a different organism.
Cnksr2Q9Z1T43EBI-7798464,EBI-8548356
Dlg4P310165EBI-7798464,EBI-375655

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: P70587-1)

Also known as: Variant A;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: P70587-2)

Also known as: Variant D;

The sequence of this isoform differs from the canonical sequence as follows:
     1285-1285: R → RNAAYKHNTVNLGMLPYGGISAMHAGRSMTLNLQTKSKFDLQDLPLQK
Note: This is the only isoform to have a potential transmembrane domain.
Isoform 3 (identifier: P70587-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1218-1241: Missing.
Note: No experimental confirmation available.
Isoform 4 (identifier: P70587-4)

Also known as: Variant B;

The sequence of this isoform differs from the canonical sequence as follows:
     1286-1325: Missing.
Note: No experimental confirmation available.
Isoform 5 (identifier: P70587-5)

Also known as: Variant C;

The sequence of this isoform differs from the canonical sequence as follows:
     1326-1399: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 14901490Leucine-rich repeat-containing protein 7
PRO_0000188300

Regions

Repeat23 – 4422LRR 1
Repeat47 – 6822LRR 2
Repeat70 – 9122LRR 3
Repeat93 – 11422LRR 4
Repeat116 – 13722LRR 5
Repeat139 – 16123LRR 6
Repeat162 – 18322LRR 7
Repeat185 – 20622LRR 8
Repeat208 – 22922LRR 9
Repeat231 – 25323LRR 10
Repeat254 – 27522LRR 11
Repeat277 – 29822LRR 12
Repeat300 – 32122LRR 13
Repeat323 – 34422LRR 14
Repeat346 – 36722LRR 15
Repeat369 – 39123LRR 16
Repeat392 – 41322LRR 17
Domain1398 – 148891PDZ

Amino acid modifications

Modified residue901Phosphoserine Probable
Modified residue1971Phosphoserine Probable
Modified residue13921Phosphoserine By similarity

Natural variations

Alternative sequence1218 – 124124Missing in isoform 3.
VSP_010798
Alternative sequence12851R → RNAAYKHNTVNLGMLPYGGI SAMHAGRSMTLNLQTKSKFD LQDLPLQK in isoform 2.
VSP_010799
Alternative sequence1286 – 132540Missing in isoform 4.
VSP_010800
Alternative sequence1326 – 139974Missing in isoform 5.
VSP_010801

Experimental info

Mutagenesis901S → D: Decrease in the level of phosphorylation. Strong decrease in the level of phosphorylation; when associated with D-2-3. Ref.2
Mutagenesis1971S → D: Strong decrease in the level of phosphorylation; when associated with D-95. Ref.2
Sequence conflict7221W → R AA sequence Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (Variant A) [UniParc].

Last modified April 18, 2012. Version 2.
Checksum: 30DC3E92EB44F2A5

FASTA1,490166,879
        10         20         30         40         50         60 
MTTKRKLIGR LVPCRCFRGE EEIISVLDYS HCSLQQVPKE VFNFERTLEE LYLDANQIEE 

        70         80         90        100        110        120 
LPKQLFNCQA LRKLSIPDND LSSLPTSIAS LVNLKELDIS KNGVQEFPEN IKCCKCLTII 

       130        140        150        160        170        180 
EASVNPISKL PDGFTQLLNL TQLYLNDAFL EFLPANFGRL VKLRILELRE NHLKTLPKSM 

       190        200        210        220        230        240 
HKLAQLERLD LGNNEFSELP EVLDQIQNLR ELWMDNNALQ VLPGSIGKLK MLVYLDMSKN 

       250        260        270        280        290        300 
RIETVDMDIS GCEALEDLLL SSNMLQQLPD SIGLLKKLTT LKVDDNQLTM LPNTIGNLSL 

       310        320        330        340        350        360 
LEEFDCSCNE LESLPPTIGY LHSLRTLAVD ENFLPELPRE IGSCKNVTVM SLRSNKLEFL 

       370        380        390        400        410        420 
PEEIGQMQRL RVLNLSDNRL KNLPFSFTKL KELAALWLSD NQSKALIPLQ TEAHPETKQR 

       430        440        450        460        470        480 
VLTNYMFPQQ PRGDEDFQSD SDSFNPTLWE EQRQQRMTVA FEFEDKKEDD ESAGKVKALS 

       490        500        510        520        530        540 
CQAPWDRGQR GITLQPARLS GDCCTPWARC DQQIQDMPVP QSDPQLAWGC ISGLQQERSM 

       550        560        570        580        590        600 
CAPLPVAAQS TTLPSLSGRQ VEINLKRYPT PYPEDLKNMV KSVQNLVGKP SHGVRVENAN 

       610        620        630        640        650        660 
PTANTEQTVK EKFEHKWPVA PKEITVEDSF VHPANEMRIG ELHPSLAETP LYPPKLVLLG 

       670        680        690        700        710        720 
KDKKESTDES EVDKTHCLNN SVSSGTYSDY SPSQASSASS NTRVKVGSLQ PTTKDAVHNS 

       730        740        750        760        770        780 
LWGNRIAPPF PQPLDAKPLL TQREAVPPGN LPQRPDRLPM SDAFPDNWTD GSHYDNTGFV 

       790        800        810        820        830        840 
SEEATGENAN NNPLLSSKAR SVPAHGRRPL IRQERIVGVP LELEQSTHRH TPETEVPPSN 

       850        860        870        880        890        900 
PWQNWTRTPS PFEDRTAFPS KLETTPTTSP LPERKDHMKE PTETPGPFSP GVPWEYHDPT 

       910        920        930        940        950        960 
PNRSLGNVFS QIHCRPDSSK GVIAISKSTE RLSPLMKDIK SNKFKKSQSI DEIDVGTYKV 

       970        980        990       1000       1010       1020 
YNIPLENYAS GSDHLGSHER PDKFLGPEHG MSSMSRSQSV PMLDDEMLMY GSSKGPPQQK 

      1030       1040       1050       1060       1070       1080 
ASMTKKVYQF DQSFNPQGAV EVKAEKRIPP PFAHNSEYVQ QPGKNIAKDL VSPRAYRGYP 

      1090       1100       1110       1120       1130       1140 
PMEQMFSFSQ PSVNEDAMVN AQFASQGPRA GFLRRADSLA SSTEMAMFRR VSEPHELPPG 

      1150       1160       1170       1180       1190       1200 
DRYGRAAYRG GLEGQSSVSM TDPQFLKRNG RYEDEHPSYQ EVKAQAGSFP AKNLTQRRPL 

      1210       1220       1230       1240       1250       1260 
SARSYSTESY GASQTRPVSA RPTMAALLEK IPSDYNLGNY GDKTSDNSDI KTRPTPVKGE 

      1270       1280       1290       1300       1310       1320 
ESCGKMPADW RQQLLRHIEA RRLDRTPSQQ SNILDNGQED VSPSGQWNPY PLGRRDVPPD 

      1330       1340       1350       1360       1370       1380 
TITKKAGSHI QTLMGSQSLQ HRSREQQPYE GNINKVTIQQ FQSPLPIQIP SSQATRGPQP 

      1390       1400       1410       1420       1430       1440 
GRCLIQTKGQ RSMDGYPEQF CVRIEKNPGL GFSISGGISG QGNPFKPSDK GIFVTRVQPD 

      1450       1460       1470       1480       1490 
GPASNLLQPG DKILQANGHS FVHMEHEKAV LLLKSFQNTV DLVIQRELTV 

« Hide

Isoform 2 (Variant D) [UniParc].

Checksum: 1710B4823C93F5FD
Show »

FASTA1,537172,035
Isoform 3 [UniParc].

Checksum: 80CF7AB619551849
Show »

FASTA1,466164,316
Isoform 4 (Variant B) [UniParc].

Checksum: 32B3A3C4CD5860D0
Show »

FASTA1,450162,460
Isoform 5 (Variant C) [UniParc].

Checksum: 5CD541D2CCABD0C3
Show »

FASTA1,416158,650

References

[1]"Characterization of densin-180, a new brain-specific synaptic protein of the O-sialoglycoprotein family."
Apperson M.L., Moon I.S., Kennedy M.B.
J. Neurosci. 16:6839-6852(1996) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), PROTEIN SEQUENCE OF 582-595; 715-725 AND 947-959, GLYCOSYLATION, PHOSPHORYLATION, TISSUE SPECIFICITY.
Strain: Sprague-Dawley.
Tissue: Brain.
[2]"Association of calcium/calmodulin-dependent kinase II with developmentally regulated splice variants of the postsynaptic density protein densin-180."
Strack S., Robison A.J., Bass M.A., Colbran R.J.
J. Biol. Chem. 275:25061-25064(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 898-1490 (ISOFORMS 1; 2; 4 AND 5), DEVELOPMENTAL STAGE, MUTAGENESIS OF SER-90 AND SER-197, INTERACTION WITH CAMKII.
Strain: Sprague-Dawley.
[3]"Densin-180, a synaptic protein, links to PSD-95 through its direct interaction with MAGUIN-1."
Ohtakara K., Nishizawa M., Izawa I., Hata Y., Matsushima S., Taki W., Inada H., Takai Y., Inagaki M.
Genes Cells 7:1149-1160(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH CNKSR2 AND DLG4.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U66707 mRNA. Translation: AAC52881.1.
AF266164 mRNA. Translation: AAF76466.1.
PIRT31434.
RefSeqNP_476483.1. NM_057142.1.
UniGeneRn.89629.

3D structure databases

ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid250730. 5 interactions.
IntActP70587. 9 interactions.
MINTMINT-1785354.

PTM databases

PhosphoSiteP70587.

Proteomic databases

PaxDbP70587.
PRIDEP70587.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

GeneID117284.
KEGGrno:117284.

Organism-specific databases

CTD57554.
RGD708527. Lrrc7.

Phylogenomic databases

eggNOGCOG4886.
HOGENOMHOG000060229.
HOVERGENHBG052305.

Gene expression databases

GenevestigatorP70587.

Family and domain databases

Gene3D2.30.42.10. 1 hit.
InterProIPR001611. Leu-rich_rpt.
IPR025875. Leu-rich_rpt_4.
IPR001478. PDZ.
[Graphical view]
PfamPF00560. LRR_1. 1 hit.
PF12799. LRR_4. 2 hits.
PF00595. PDZ. 1 hit.
[Graphical view]
SMARTSM00228. PDZ. 1 hit.
[Graphical view]
SUPFAMSSF50156. SSF50156. 1 hit.
PROSITEPS51450. LRR. 15 hits.
PS50106. PDZ. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio620243.
PROP70587.

Entry information

Entry nameLRRC7_RAT
AccessionPrimary (citable) accession number: P70587
Secondary accession number(s): Q9JI42
Entry history
Integrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: April 18, 2012
Last modified: April 16, 2014
This is version 104 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families