SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P70587

- LRRC7_RAT

UniProt

P70587 - LRRC7_RAT

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Leucine-rich repeat-containing protein 7
Gene
Lrrc7, Lap1
Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Required for normal synaptic spine architecture and function. Necessary for DISC1 and GRM5 localization to postsynaptic density complexes and for both N-methyl D-aspartate receptor-dependent and metabotropic glutamate receptor-dependent long term depression By similarity.

GO - Molecular functioni

  1. protein C-terminus binding Source: RGD
  2. protein binding Source: IntAct

GO - Biological processi

  1. positive regulation of neuron projection development Source: RGD
  2. response to organic cyclic compound Source: RGD
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Leucine-rich repeat-containing protein 7
Alternative name(s):
Densin-180
Short name:
Densin
Protein LAP1
Gene namesi
Name:Lrrc7
Synonyms:Lap1
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
ProteomesiUP000002494: Unplaced

Organism-specific databases

RGDi708527. Lrrc7.

Subcellular locationi

GO - Cellular componenti

  1. axon initial segment Source: RGD
  2. cell junction Source: UniProtKB-KW
  3. cytoplasm Source: RGD
  4. dendritic spine Source: RGD
  5. filopodium Source: RGD
  6. neuron projection Source: RGD
  7. plasma membrane Source: RGD
  8. postsynaptic density Source: RGD
  9. postsynaptic membrane Source: UniProtKB-KW
  10. synapse Source: RGD
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasm, Membrane, Postsynaptic cell membrane, Synapse

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi90 – 901S → D: Decrease in the level of phosphorylation. Strong decrease in the level of phosphorylation; when associated with D-2-3. 1 Publication
Mutagenesisi197 – 1971S → D: Strong decrease in the level of phosphorylation; when associated with D-95. 1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 14901490Leucine-rich repeat-containing protein 7
PRO_0000188300Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei90 – 901Phosphoserine Inferred
Modified residuei197 – 1971Phosphoserine Inferred
Modified residuei1392 – 13921Phosphoserine By similarity

Post-translational modificationi

O-glycosylated and phosphorylated.1 Publication

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiP70587.
PRIDEiP70587.

PTM databases

PhosphoSiteiP70587.

Expressioni

Tissue specificityi

Brain-specific. Highly concentrated at synapses.1 Publication

Developmental stagei

Expression of isoform 2 is predominant at E18, but decreased during postnatal development paralleling increased expression of isoform 4 and isoform 5.1 Publication

Gene expression databases

GenevestigatoriP70587.

Interactioni

Subunit structurei

Interacts with CAMKII and CTNND2/Catenin delta-2. Forms a complex with N-cadherin through CTNND2 By similarity. Isoform 5 appears not to bind CAMKII. Interacts with CNKSR2 and DLG4.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
Camk2aP112752EBI-7798464,EBI-2640645
Camk2aP117982EBI-7798464,EBI-400384From a different organism.
Cnksr2Q9Z1T43EBI-7798464,EBI-8548356
Dlg4P310165EBI-7798464,EBI-375655

Protein-protein interaction databases

BioGridi250730. 5 interactions.
IntActiP70587. 9 interactions.
MINTiMINT-1785354.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati23 – 4422LRR 1
Add
BLAST
Repeati47 – 6822LRR 2
Add
BLAST
Repeati70 – 9122LRR 3
Add
BLAST
Repeati93 – 11422LRR 4
Add
BLAST
Repeati116 – 13722LRR 5
Add
BLAST
Repeati139 – 16123LRR 6
Add
BLAST
Repeati162 – 18322LRR 7
Add
BLAST
Repeati185 – 20622LRR 8
Add
BLAST
Repeati208 – 22922LRR 9
Add
BLAST
Repeati231 – 25323LRR 10
Add
BLAST
Repeati254 – 27522LRR 11
Add
BLAST
Repeati277 – 29822LRR 12
Add
BLAST
Repeati300 – 32122LRR 13
Add
BLAST
Repeati323 – 34422LRR 14
Add
BLAST
Repeati346 – 36722LRR 15
Add
BLAST
Repeati369 – 39123LRR 16
Add
BLAST
Repeati392 – 41322LRR 17
Add
BLAST
Domaini1398 – 148891PDZ
Add
BLAST

Sequence similaritiesi

Contains 1 PDZ (DHR) domain.

Keywords - Domaini

Leucine-rich repeat, Repeat

Phylogenomic databases

eggNOGiCOG4886.
HOGENOMiHOG000060229.
HOVERGENiHBG052305.

Family and domain databases

Gene3Di2.30.42.10. 1 hit.
InterProiIPR001611. Leu-rich_rpt.
IPR025875. Leu-rich_rpt_4.
IPR001478. PDZ.
[Graphical view]
PfamiPF00560. LRR_1. 1 hit.
PF12799. LRR_4. 2 hits.
PF13855. LRR_8. 1 hit.
PF00595. PDZ. 1 hit.
[Graphical view]
SMARTiSM00228. PDZ. 1 hit.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 1 hit.
PROSITEiPS51450. LRR. 15 hits.
PS50106. PDZ. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P70587-1) [UniParc]FASTAAdd to Basket

Also known as: Variant A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MTTKRKLIGR LVPCRCFRGE EEIISVLDYS HCSLQQVPKE VFNFERTLEE     50
LYLDANQIEE LPKQLFNCQA LRKLSIPDND LSSLPTSIAS LVNLKELDIS 100
KNGVQEFPEN IKCCKCLTII EASVNPISKL PDGFTQLLNL TQLYLNDAFL 150
EFLPANFGRL VKLRILELRE NHLKTLPKSM HKLAQLERLD LGNNEFSELP 200
EVLDQIQNLR ELWMDNNALQ VLPGSIGKLK MLVYLDMSKN RIETVDMDIS 250
GCEALEDLLL SSNMLQQLPD SIGLLKKLTT LKVDDNQLTM LPNTIGNLSL 300
LEEFDCSCNE LESLPPTIGY LHSLRTLAVD ENFLPELPRE IGSCKNVTVM 350
SLRSNKLEFL PEEIGQMQRL RVLNLSDNRL KNLPFSFTKL KELAALWLSD 400
NQSKALIPLQ TEAHPETKQR VLTNYMFPQQ PRGDEDFQSD SDSFNPTLWE 450
EQRQQRMTVA FEFEDKKEDD ESAGKVKALS CQAPWDRGQR GITLQPARLS 500
GDCCTPWARC DQQIQDMPVP QSDPQLAWGC ISGLQQERSM CAPLPVAAQS 550
TTLPSLSGRQ VEINLKRYPT PYPEDLKNMV KSVQNLVGKP SHGVRVENAN 600
PTANTEQTVK EKFEHKWPVA PKEITVEDSF VHPANEMRIG ELHPSLAETP 650
LYPPKLVLLG KDKKESTDES EVDKTHCLNN SVSSGTYSDY SPSQASSASS 700
NTRVKVGSLQ PTTKDAVHNS LWGNRIAPPF PQPLDAKPLL TQREAVPPGN 750
LPQRPDRLPM SDAFPDNWTD GSHYDNTGFV SEEATGENAN NNPLLSSKAR 800
SVPAHGRRPL IRQERIVGVP LELEQSTHRH TPETEVPPSN PWQNWTRTPS 850
PFEDRTAFPS KLETTPTTSP LPERKDHMKE PTETPGPFSP GVPWEYHDPT 900
PNRSLGNVFS QIHCRPDSSK GVIAISKSTE RLSPLMKDIK SNKFKKSQSI 950
DEIDVGTYKV YNIPLENYAS GSDHLGSHER PDKFLGPEHG MSSMSRSQSV 1000
PMLDDEMLMY GSSKGPPQQK ASMTKKVYQF DQSFNPQGAV EVKAEKRIPP 1050
PFAHNSEYVQ QPGKNIAKDL VSPRAYRGYP PMEQMFSFSQ PSVNEDAMVN 1100
AQFASQGPRA GFLRRADSLA SSTEMAMFRR VSEPHELPPG DRYGRAAYRG 1150
GLEGQSSVSM TDPQFLKRNG RYEDEHPSYQ EVKAQAGSFP AKNLTQRRPL 1200
SARSYSTESY GASQTRPVSA RPTMAALLEK IPSDYNLGNY GDKTSDNSDI 1250
KTRPTPVKGE ESCGKMPADW RQQLLRHIEA RRLDRTPSQQ SNILDNGQED 1300
VSPSGQWNPY PLGRRDVPPD TITKKAGSHI QTLMGSQSLQ HRSREQQPYE 1350
GNINKVTIQQ FQSPLPIQIP SSQATRGPQP GRCLIQTKGQ RSMDGYPEQF 1400
CVRIEKNPGL GFSISGGISG QGNPFKPSDK GIFVTRVQPD GPASNLLQPG 1450
DKILQANGHS FVHMEHEKAV LLLKSFQNTV DLVIQRELTV 1490
Length:1,490
Mass (Da):166,879
Last modified:April 18, 2012 - v2
Checksum:i30DC3E92EB44F2A5
GO
Isoform 2 (identifier: P70587-2) [UniParc]FASTAAdd to Basket

Also known as: Variant D

The sequence of this isoform differs from the canonical sequence as follows:
     1285-1285: R → RNAAYKHNTVNLGMLPYGGISAMHAGRSMTLNLQTKSKFDLQDLPLQK

Note: This is the only isoform to have a potential transmembrane domain.

Show »
Length:1,537
Mass (Da):172,035
Checksum:i1710B4823C93F5FD
GO
Isoform 3 (identifier: P70587-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1218-1241: Missing.

Note: No experimental confirmation available.

Show »
Length:1,466
Mass (Da):164,316
Checksum:i80CF7AB619551849
GO
Isoform 4 (identifier: P70587-4) [UniParc]FASTAAdd to Basket

Also known as: Variant B

The sequence of this isoform differs from the canonical sequence as follows:
     1286-1325: Missing.

Note: No experimental confirmation available.

Show »
Length:1,450
Mass (Da):162,460
Checksum:i32B3A3C4CD5860D0
GO
Isoform 5 (identifier: P70587-5) [UniParc]FASTAAdd to Basket

Also known as: Variant C

The sequence of this isoform differs from the canonical sequence as follows:
     1326-1399: Missing.

Note: No experimental confirmation available.

Show »
Length:1,416
Mass (Da):158,650
Checksum:i5CD541D2CCABD0C3
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1218 – 124124Missing in isoform 3.
VSP_010798Add
BLAST
Alternative sequencei1285 – 12851R → RNAAYKHNTVNLGMLPYGGI SAMHAGRSMTLNLQTKSKFD LQDLPLQK in isoform 2.
VSP_010799
Alternative sequencei1286 – 132540Missing in isoform 4.
VSP_010800Add
BLAST
Alternative sequencei1326 – 139974Missing in isoform 5.
VSP_010801Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti722 – 7221W → R AA sequence 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U66707 mRNA. Translation: AAC52881.1.
AF266164 mRNA. Translation: AAF76466.1.
PIRiT31434.
RefSeqiNP_476483.1. NM_057142.1.
UniGeneiRn.89629.

Genome annotation databases

GeneIDi117284.
KEGGirno:117284.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U66707 mRNA. Translation: AAC52881.1 .
AF266164 mRNA. Translation: AAF76466.1 .
PIRi T31434.
RefSeqi NP_476483.1. NM_057142.1.
UniGenei Rn.89629.

3D structure databases

ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 250730. 5 interactions.
IntActi P70587. 9 interactions.
MINTi MINT-1785354.

PTM databases

PhosphoSitei P70587.

Proteomic databases

PaxDbi P70587.
PRIDEi P70587.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 117284.
KEGGi rno:117284.

Organism-specific databases

CTDi 57554.
RGDi 708527. Lrrc7.

Phylogenomic databases

eggNOGi COG4886.
HOGENOMi HOG000060229.
HOVERGENi HBG052305.

Miscellaneous databases

NextBioi 620243.
PROi P70587.

Gene expression databases

Genevestigatori P70587.

Family and domain databases

Gene3Di 2.30.42.10. 1 hit.
InterProi IPR001611. Leu-rich_rpt.
IPR025875. Leu-rich_rpt_4.
IPR001478. PDZ.
[Graphical view ]
Pfami PF00560. LRR_1. 1 hit.
PF12799. LRR_4. 2 hits.
PF13855. LRR_8. 1 hit.
PF00595. PDZ. 1 hit.
[Graphical view ]
SMARTi SM00228. PDZ. 1 hit.
[Graphical view ]
SUPFAMi SSF50156. SSF50156. 1 hit.
PROSITEi PS51450. LRR. 15 hits.
PS50106. PDZ. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Characterization of densin-180, a new brain-specific synaptic protein of the O-sialoglycoprotein family."
    Apperson M.L., Moon I.S., Kennedy M.B.
    J. Neurosci. 16:6839-6852(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), PROTEIN SEQUENCE OF 582-595; 715-725 AND 947-959, GLYCOSYLATION, PHOSPHORYLATION, TISSUE SPECIFICITY.
    Strain: Sprague-Dawley.
    Tissue: Brain.
  2. "Association of calcium/calmodulin-dependent kinase II with developmentally regulated splice variants of the postsynaptic density protein densin-180."
    Strack S., Robison A.J., Bass M.A., Colbran R.J.
    J. Biol. Chem. 275:25061-25064(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 898-1490 (ISOFORMS 1; 2; 4 AND 5), DEVELOPMENTAL STAGE, MUTAGENESIS OF SER-90 AND SER-197, INTERACTION WITH CAMKII.
    Strain: Sprague-Dawley.
  3. "Densin-180, a synaptic protein, links to PSD-95 through its direct interaction with MAGUIN-1."
    Ohtakara K., Nishizawa M., Izawa I., Hata Y., Matsushima S., Taki W., Inada H., Takai Y., Inagaki M.
    Genes Cells 7:1149-1160(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH CNKSR2 AND DLG4.

Entry informationi

Entry nameiLRRC7_RAT
AccessioniPrimary (citable) accession number: P70587
Secondary accession number(s): Q9JI42
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: April 18, 2012
Last modified: June 11, 2014
This is version 106 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi