Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P70587

- LRRC7_RAT

UniProt

P70587 - LRRC7_RAT

Protein

Leucine-rich repeat-containing protein 7

Gene

Lrrc7

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 107 (01 Oct 2014)
      Sequence version 2 (18 Apr 2012)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Required for normal synaptic spine architecture and function. Necessary for DISC1 and GRM5 localization to postsynaptic density complexes and for both N-methyl D-aspartate receptor-dependent and metabotropic glutamate receptor-dependent long term depression By similarity.By similarity

    GO - Molecular functioni

    1. protein binding Source: IntAct
    2. protein C-terminus binding Source: RGD

    GO - Biological processi

    1. positive regulation of neuron projection development Source: RGD
    2. response to organic cyclic compound Source: RGD

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Leucine-rich repeat-containing protein 7
    Alternative name(s):
    Densin-180
    Short name:
    Densin
    Protein LAP1
    Gene namesi
    Name:Lrrc7
    Synonyms:Lap1
    OrganismiRattus norvegicus (Rat)
    Taxonomic identifieri10116 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
    ProteomesiUP000002494: Unplaced

    Organism-specific databases

    RGDi708527. Lrrc7.

    Subcellular locationi

    GO - Cellular componenti

    1. axon initial segment Source: RGD
    2. cell junction Source: UniProtKB-KW
    3. cytoplasm Source: RGD
    4. dendritic spine Source: RGD
    5. filopodium Source: RGD
    6. neuron projection Source: RGD
    7. plasma membrane Source: RGD
    8. postsynaptic density Source: RGD
    9. postsynaptic membrane Source: UniProtKB-KW
    10. synapse Source: RGD

    Keywords - Cellular componenti

    Cell junction, Cell membrane, Cytoplasm, Membrane, Postsynaptic cell membrane, Synapse

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi90 – 901S → D: Decrease in the level of phosphorylation. Strong decrease in the level of phosphorylation; when associated with D-2-3. 1 Publication
    Mutagenesisi197 – 1971S → D: Strong decrease in the level of phosphorylation; when associated with D-95. 1 Publication

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 14901490Leucine-rich repeat-containing protein 7PRO_0000188300Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei90 – 901Phosphoserine1 Publication
    Modified residuei197 – 1971Phosphoserine1 Publication
    Modified residuei1392 – 13921PhosphoserineBy similarity

    Post-translational modificationi

    O-glycosylated and phosphorylated.1 Publication

    Keywords - PTMi

    Glycoprotein, Phosphoprotein

    Proteomic databases

    PaxDbiP70587.
    PRIDEiP70587.

    PTM databases

    PhosphoSiteiP70587.

    Expressioni

    Tissue specificityi

    Brain-specific. Highly concentrated at synapses.1 Publication

    Developmental stagei

    Expression of isoform 2 is predominant at E18, but decreased during postnatal development paralleling increased expression of isoform 4 and isoform 5.1 Publication

    Gene expression databases

    GenevestigatoriP70587.

    Interactioni

    Subunit structurei

    Interacts with CAMKII and CTNND2/Catenin delta-2. Forms a complex with N-cadherin through CTNND2 By similarity. Isoform 5 appears not to bind CAMKII. Interacts with CNKSR2 and DLG4.By similarity2 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    Camk2aP112752EBI-7798464,EBI-2640645
    Camk2aP117982EBI-7798464,EBI-400384From a different organism.
    Cnksr2Q9Z1T43EBI-7798464,EBI-8548356
    Dlg4P310165EBI-7798464,EBI-375655

    Protein-protein interaction databases

    BioGridi250730. 5 interactions.
    IntActiP70587. 9 interactions.
    MINTiMINT-1785354.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati23 – 4422LRR 1Add
    BLAST
    Repeati47 – 6822LRR 2Add
    BLAST
    Repeati70 – 9122LRR 3Add
    BLAST
    Repeati93 – 11422LRR 4Add
    BLAST
    Repeati116 – 13722LRR 5Add
    BLAST
    Repeati139 – 16123LRR 6Add
    BLAST
    Repeati162 – 18322LRR 7Add
    BLAST
    Repeati185 – 20622LRR 8Add
    BLAST
    Repeati208 – 22922LRR 9Add
    BLAST
    Repeati231 – 25323LRR 10Add
    BLAST
    Repeati254 – 27522LRR 11Add
    BLAST
    Repeati277 – 29822LRR 12Add
    BLAST
    Repeati300 – 32122LRR 13Add
    BLAST
    Repeati323 – 34422LRR 14Add
    BLAST
    Repeati346 – 36722LRR 15Add
    BLAST
    Repeati369 – 39123LRR 16Add
    BLAST
    Repeati392 – 41322LRR 17Add
    BLAST
    Domaini1398 – 148891PDZPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the LAP (LRR and PDZ) protein family.Curated
    Contains 17 LRR (leucine-rich) repeats.Curated
    Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Leucine-rich repeat, Repeat

    Phylogenomic databases

    eggNOGiCOG4886.
    HOGENOMiHOG000060229.
    HOVERGENiHBG052305.

    Family and domain databases

    Gene3Di2.30.42.10. 1 hit.
    InterProiIPR001611. Leu-rich_rpt.
    IPR025875. Leu-rich_rpt_4.
    IPR001478. PDZ.
    [Graphical view]
    PfamiPF00560. LRR_1. 1 hit.
    PF12799. LRR_4. 2 hits.
    PF13855. LRR_8. 1 hit.
    PF00595. PDZ. 1 hit.
    [Graphical view]
    SMARTiSM00228. PDZ. 1 hit.
    [Graphical view]
    SUPFAMiSSF50156. SSF50156. 1 hit.
    PROSITEiPS51450. LRR. 15 hits.
    PS50106. PDZ. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P70587-1) [UniParc]FASTAAdd to Basket

    Also known as: Variant A

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MTTKRKLIGR LVPCRCFRGE EEIISVLDYS HCSLQQVPKE VFNFERTLEE     50
    LYLDANQIEE LPKQLFNCQA LRKLSIPDND LSSLPTSIAS LVNLKELDIS 100
    KNGVQEFPEN IKCCKCLTII EASVNPISKL PDGFTQLLNL TQLYLNDAFL 150
    EFLPANFGRL VKLRILELRE NHLKTLPKSM HKLAQLERLD LGNNEFSELP 200
    EVLDQIQNLR ELWMDNNALQ VLPGSIGKLK MLVYLDMSKN RIETVDMDIS 250
    GCEALEDLLL SSNMLQQLPD SIGLLKKLTT LKVDDNQLTM LPNTIGNLSL 300
    LEEFDCSCNE LESLPPTIGY LHSLRTLAVD ENFLPELPRE IGSCKNVTVM 350
    SLRSNKLEFL PEEIGQMQRL RVLNLSDNRL KNLPFSFTKL KELAALWLSD 400
    NQSKALIPLQ TEAHPETKQR VLTNYMFPQQ PRGDEDFQSD SDSFNPTLWE 450
    EQRQQRMTVA FEFEDKKEDD ESAGKVKALS CQAPWDRGQR GITLQPARLS 500
    GDCCTPWARC DQQIQDMPVP QSDPQLAWGC ISGLQQERSM CAPLPVAAQS 550
    TTLPSLSGRQ VEINLKRYPT PYPEDLKNMV KSVQNLVGKP SHGVRVENAN 600
    PTANTEQTVK EKFEHKWPVA PKEITVEDSF VHPANEMRIG ELHPSLAETP 650
    LYPPKLVLLG KDKKESTDES EVDKTHCLNN SVSSGTYSDY SPSQASSASS 700
    NTRVKVGSLQ PTTKDAVHNS LWGNRIAPPF PQPLDAKPLL TQREAVPPGN 750
    LPQRPDRLPM SDAFPDNWTD GSHYDNTGFV SEEATGENAN NNPLLSSKAR 800
    SVPAHGRRPL IRQERIVGVP LELEQSTHRH TPETEVPPSN PWQNWTRTPS 850
    PFEDRTAFPS KLETTPTTSP LPERKDHMKE PTETPGPFSP GVPWEYHDPT 900
    PNRSLGNVFS QIHCRPDSSK GVIAISKSTE RLSPLMKDIK SNKFKKSQSI 950
    DEIDVGTYKV YNIPLENYAS GSDHLGSHER PDKFLGPEHG MSSMSRSQSV 1000
    PMLDDEMLMY GSSKGPPQQK ASMTKKVYQF DQSFNPQGAV EVKAEKRIPP 1050
    PFAHNSEYVQ QPGKNIAKDL VSPRAYRGYP PMEQMFSFSQ PSVNEDAMVN 1100
    AQFASQGPRA GFLRRADSLA SSTEMAMFRR VSEPHELPPG DRYGRAAYRG 1150
    GLEGQSSVSM TDPQFLKRNG RYEDEHPSYQ EVKAQAGSFP AKNLTQRRPL 1200
    SARSYSTESY GASQTRPVSA RPTMAALLEK IPSDYNLGNY GDKTSDNSDI 1250
    KTRPTPVKGE ESCGKMPADW RQQLLRHIEA RRLDRTPSQQ SNILDNGQED 1300
    VSPSGQWNPY PLGRRDVPPD TITKKAGSHI QTLMGSQSLQ HRSREQQPYE 1350
    GNINKVTIQQ FQSPLPIQIP SSQATRGPQP GRCLIQTKGQ RSMDGYPEQF 1400
    CVRIEKNPGL GFSISGGISG QGNPFKPSDK GIFVTRVQPD GPASNLLQPG 1450
    DKILQANGHS FVHMEHEKAV LLLKSFQNTV DLVIQRELTV 1490
    Length:1,490
    Mass (Da):166,879
    Last modified:April 18, 2012 - v2
    Checksum:i30DC3E92EB44F2A5
    GO
    Isoform 2 (identifier: P70587-2) [UniParc]FASTAAdd to Basket

    Also known as: Variant D

    The sequence of this isoform differs from the canonical sequence as follows:
         1285-1285: R → RNAAYKHNTVNLGMLPYGGISAMHAGRSMTLNLQTKSKFDLQDLPLQK

    Note: This is the only isoform to have a potential transmembrane domain.

    Show »
    Length:1,537
    Mass (Da):172,035
    Checksum:i1710B4823C93F5FD
    GO
    Isoform 3 (identifier: P70587-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1218-1241: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:1,466
    Mass (Da):164,316
    Checksum:i80CF7AB619551849
    GO
    Isoform 4 (identifier: P70587-4) [UniParc]FASTAAdd to Basket

    Also known as: Variant B

    The sequence of this isoform differs from the canonical sequence as follows:
         1286-1325: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:1,450
    Mass (Da):162,460
    Checksum:i32B3A3C4CD5860D0
    GO
    Isoform 5 (identifier: P70587-5) [UniParc]FASTAAdd to Basket

    Also known as: Variant C

    The sequence of this isoform differs from the canonical sequence as follows:
         1326-1399: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:1,416
    Mass (Da):158,650
    Checksum:i5CD541D2CCABD0C3
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti722 – 7221W → R AA sequence (PubMed:8824323)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1218 – 124124Missing in isoform 3. 1 PublicationVSP_010798Add
    BLAST
    Alternative sequencei1285 – 12851R → RNAAYKHNTVNLGMLPYGGI SAMHAGRSMTLNLQTKSKFD LQDLPLQK in isoform 2. 1 PublicationVSP_010799
    Alternative sequencei1286 – 132540Missing in isoform 4. 1 PublicationVSP_010800Add
    BLAST
    Alternative sequencei1326 – 139974Missing in isoform 5. 1 PublicationVSP_010801Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U66707 mRNA. Translation: AAC52881.1.
    AF266164 mRNA. Translation: AAF76466.1.
    PIRiT31434.
    RefSeqiNP_476483.1. NM_057142.1.
    UniGeneiRn.89629.

    Genome annotation databases

    GeneIDi117284.
    KEGGirno:117284.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U66707 mRNA. Translation: AAC52881.1 .
    AF266164 mRNA. Translation: AAF76466.1 .
    PIRi T31434.
    RefSeqi NP_476483.1. NM_057142.1.
    UniGenei Rn.89629.

    3D structure databases

    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 250730. 5 interactions.
    IntActi P70587. 9 interactions.
    MINTi MINT-1785354.

    PTM databases

    PhosphoSitei P70587.

    Proteomic databases

    PaxDbi P70587.
    PRIDEi P70587.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    GeneIDi 117284.
    KEGGi rno:117284.

    Organism-specific databases

    CTDi 57554.
    RGDi 708527. Lrrc7.

    Phylogenomic databases

    eggNOGi COG4886.
    HOGENOMi HOG000060229.
    HOVERGENi HBG052305.

    Miscellaneous databases

    NextBioi 620243.
    PROi P70587.

    Gene expression databases

    Genevestigatori P70587.

    Family and domain databases

    Gene3Di 2.30.42.10. 1 hit.
    InterProi IPR001611. Leu-rich_rpt.
    IPR025875. Leu-rich_rpt_4.
    IPR001478. PDZ.
    [Graphical view ]
    Pfami PF00560. LRR_1. 1 hit.
    PF12799. LRR_4. 2 hits.
    PF13855. LRR_8. 1 hit.
    PF00595. PDZ. 1 hit.
    [Graphical view ]
    SMARTi SM00228. PDZ. 1 hit.
    [Graphical view ]
    SUPFAMi SSF50156. SSF50156. 1 hit.
    PROSITEi PS51450. LRR. 15 hits.
    PS50106. PDZ. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Characterization of densin-180, a new brain-specific synaptic protein of the O-sialoglycoprotein family."
      Apperson M.L., Moon I.S., Kennedy M.B.
      J. Neurosci. 16:6839-6852(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), PROTEIN SEQUENCE OF 582-595; 715-725 AND 947-959, GLYCOSYLATION, PHOSPHORYLATION, TISSUE SPECIFICITY.
      Strain: Sprague-Dawley.
      Tissue: Brain.
    2. "Association of calcium/calmodulin-dependent kinase II with developmentally regulated splice variants of the postsynaptic density protein densin-180."
      Strack S., Robison A.J., Bass M.A., Colbran R.J.
      J. Biol. Chem. 275:25061-25064(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 898-1490 (ISOFORMS 1; 2; 4 AND 5), DEVELOPMENTAL STAGE, MUTAGENESIS OF SER-90 AND SER-197, INTERACTION WITH CAMKII.
      Strain: Sprague-Dawley.
    3. "Densin-180, a synaptic protein, links to PSD-95 through its direct interaction with MAGUIN-1."
      Ohtakara K., Nishizawa M., Izawa I., Hata Y., Matsushima S., Taki W., Inada H., Takai Y., Inagaki M.
      Genes Cells 7:1149-1160(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH CNKSR2 AND DLG4.

    Entry informationi

    Entry nameiLRRC7_RAT
    AccessioniPrimary (citable) accession number: P70587
    Secondary accession number(s): Q9JI42
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 19, 2004
    Last sequence update: April 18, 2012
    Last modified: October 1, 2014
    This is version 107 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3