Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Leucine-rich repeat-containing protein 7

Gene

Lrrc7

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Required for normal synaptic spine architecture and function. Necessary for DISC1 and GRM5 localization to postsynaptic density complexes and for both N-methyl D-aspartate receptor-dependent and metabotropic glutamate receptor-dependent long term depression (By similarity).By similarity

GO - Molecular functioni

  • protein C-terminus binding Source: RGD

GO - Biological processi

  • positive regulation of neuron projection development Source: RGD
  • response to organic cyclic compound Source: RGD
  • signal transduction Source: GO_Central

Names & Taxonomyi

Protein namesi
Recommended name:
Leucine-rich repeat-containing protein 7
Alternative name(s):
Densin-180
Short name:
Densin
Protein LAP1
Gene namesi
Name:Lrrc7
Synonyms:Lap1
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi708527 Lrrc7

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasm, Membrane, Postsynaptic cell membrane, Synapse

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi1288S → D: Decrease in the level of phosphorylation. Strong decrease in the level of phosphorylation; when associated with D-1392. 1 Publication1
Mutagenesisi1392S → D: Strong decrease in the level of phosphorylation; when associated with D-1288. 1 Publication1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001883001 – 1490Leucine-rich repeat-containing protein 7Add BLAST1490

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei439PhosphoserineCombined sources1
Modified residuei441PhosphoserineCombined sources1
Modified residuei443PhosphoserineCombined sources1
Modified residuei831PhosphothreonineBy similarity1
Modified residuei850PhosphoserineCombined sources1
Modified residuei865PhosphothreonineCombined sources1
Modified residuei869PhosphoserineBy similarity1
Modified residuei947PhosphoserineCombined sources1
Modified residuei949PhosphoserineCombined sources1
Modified residuei1118PhosphoserineBy similarity1
Modified residuei1149Omega-N-methylarginineBy similarity1
Modified residuei1233PhosphoserineBy similarity1
Modified residuei1288Phosphoserine1 Publication1
Modified residuei1392PhosphoserineCombined sources1 Publication1
Isoform 4 (identifier: P70587-4)
Modified residuei1288Phosphoserine1 Publication1

Post-translational modificationi

O-glycosylated and phosphorylated.1 Publication

Keywords - PTMi

Glycoprotein, Methylation, Phosphoprotein

Proteomic databases

PaxDbiP70587
PRIDEiP70587

PTM databases

iPTMnetiP70587
PhosphoSitePlusiP70587
SwissPalmiP70587

Expressioni

Tissue specificityi

Brain-specific. Highly concentrated at synapses.1 Publication

Developmental stagei

Expression of isoform 2 is predominant at E18, but decreased during postnatal development paralleling increased expression of isoform 4 and isoform 5.1 Publication

Interactioni

Subunit structurei

Interacts with CAMKII and CTNND2/Catenin delta-2. Forms a complex with N-cadherin through CTNND2 (By similarity). Isoform 5 appears not to bind CAMKII. Interacts with CNKSR2 and DLG4.By similarity2 Publications

Binary interactionsi

Show more details

GO - Molecular functioni

  • protein C-terminus binding Source: RGD

Protein-protein interaction databases

BioGridi250730, 6 interactors
CORUMiP70587
IntActiP70587, 9 interactors
MINTiP70587
STRINGi10116.ENSRNOP00000016453

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati23 – 44LRR 1Add BLAST22
Repeati47 – 68LRR 2Add BLAST22
Repeati70 – 91LRR 3Add BLAST22
Repeati93 – 114LRR 4Add BLAST22
Repeati116 – 137LRR 5Add BLAST22
Repeati139 – 161LRR 6Add BLAST23
Repeati162 – 183LRR 7Add BLAST22
Repeati185 – 206LRR 8Add BLAST22
Repeati208 – 229LRR 9Add BLAST22
Repeati231 – 253LRR 10Add BLAST23
Repeati254 – 275LRR 11Add BLAST22
Repeati277 – 298LRR 12Add BLAST22
Repeati300 – 321LRR 13Add BLAST22
Repeati323 – 344LRR 14Add BLAST22
Repeati346 – 367LRR 15Add BLAST22
Repeati369 – 391LRR 16Add BLAST23
Repeati392 – 413LRR 17Add BLAST22
Domaini1398 – 1488PDZPROSITE-ProRule annotationAdd BLAST91

Sequence similaritiesi

Belongs to the LAP (LRR and PDZ) protein family.Curated

Keywords - Domaini

Leucine-rich repeat, Repeat

Phylogenomic databases

eggNOGiENOG410KCZ0 Eukaryota
COG4886 LUCA
HOGENOMiHOG000060229
HOVERGENiHBG052305
InParanoidiP70587

Family and domain databases

Gene3Di3.80.10.10, 4 hits
InterProiView protein in InterPro
IPR001611 Leu-rich_rpt
IPR003591 Leu-rich_rpt_typical-subtyp
IPR032675 LRR_dom_sf
IPR001478 PDZ
IPR036034 PDZ_sf
PfamiView protein in Pfam
PF13855 LRR_8, 4 hits
PF00595 PDZ, 1 hit
SMARTiView protein in SMART
SM00369 LRR_TYP, 11 hits
SM00228 PDZ, 1 hit
SUPFAMiSSF50156 SSF50156, 1 hit
PROSITEiView protein in PROSITE
PS51450 LRR, 15 hits
PS50106 PDZ, 1 hit

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P70587-1) [UniParc]FASTAAdd to basket
Also known as: Variant A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTTKRKLIGR LVPCRCFRGE EEIISVLDYS HCSLQQVPKE VFNFERTLEE
60 70 80 90 100
LYLDANQIEE LPKQLFNCQA LRKLSIPDND LSSLPTSIAS LVNLKELDIS
110 120 130 140 150
KNGVQEFPEN IKCCKCLTII EASVNPISKL PDGFTQLLNL TQLYLNDAFL
160 170 180 190 200
EFLPANFGRL VKLRILELRE NHLKTLPKSM HKLAQLERLD LGNNEFSELP
210 220 230 240 250
EVLDQIQNLR ELWMDNNALQ VLPGSIGKLK MLVYLDMSKN RIETVDMDIS
260 270 280 290 300
GCEALEDLLL SSNMLQQLPD SIGLLKKLTT LKVDDNQLTM LPNTIGNLSL
310 320 330 340 350
LEEFDCSCNE LESLPPTIGY LHSLRTLAVD ENFLPELPRE IGSCKNVTVM
360 370 380 390 400
SLRSNKLEFL PEEIGQMQRL RVLNLSDNRL KNLPFSFTKL KELAALWLSD
410 420 430 440 450
NQSKALIPLQ TEAHPETKQR VLTNYMFPQQ PRGDEDFQSD SDSFNPTLWE
460 470 480 490 500
EQRQQRMTVA FEFEDKKEDD ESAGKVKALS CQAPWDRGQR GITLQPARLS
510 520 530 540 550
GDCCTPWARC DQQIQDMPVP QSDPQLAWGC ISGLQQERSM CAPLPVAAQS
560 570 580 590 600
TTLPSLSGRQ VEINLKRYPT PYPEDLKNMV KSVQNLVGKP SHGVRVENAN
610 620 630 640 650
PTANTEQTVK EKFEHKWPVA PKEITVEDSF VHPANEMRIG ELHPSLAETP
660 670 680 690 700
LYPPKLVLLG KDKKESTDES EVDKTHCLNN SVSSGTYSDY SPSQASSASS
710 720 730 740 750
NTRVKVGSLQ PTTKDAVHNS LWGNRIAPPF PQPLDAKPLL TQREAVPPGN
760 770 780 790 800
LPQRPDRLPM SDAFPDNWTD GSHYDNTGFV SEEATGENAN NNPLLSSKAR
810 820 830 840 850
SVPAHGRRPL IRQERIVGVP LELEQSTHRH TPETEVPPSN PWQNWTRTPS
860 870 880 890 900
PFEDRTAFPS KLETTPTTSP LPERKDHMKE PTETPGPFSP GVPWEYHDPT
910 920 930 940 950
PNRSLGNVFS QIHCRPDSSK GVIAISKSTE RLSPLMKDIK SNKFKKSQSI
960 970 980 990 1000
DEIDVGTYKV YNIPLENYAS GSDHLGSHER PDKFLGPEHG MSSMSRSQSV
1010 1020 1030 1040 1050
PMLDDEMLMY GSSKGPPQQK ASMTKKVYQF DQSFNPQGAV EVKAEKRIPP
1060 1070 1080 1090 1100
PFAHNSEYVQ QPGKNIAKDL VSPRAYRGYP PMEQMFSFSQ PSVNEDAMVN
1110 1120 1130 1140 1150
AQFASQGPRA GFLRRADSLA SSTEMAMFRR VSEPHELPPG DRYGRAAYRG
1160 1170 1180 1190 1200
GLEGQSSVSM TDPQFLKRNG RYEDEHPSYQ EVKAQAGSFP AKNLTQRRPL
1210 1220 1230 1240 1250
SARSYSTESY GASQTRPVSA RPTMAALLEK IPSDYNLGNY GDKTSDNSDI
1260 1270 1280 1290 1300
KTRPTPVKGE ESCGKMPADW RQQLLRHIEA RRLDRTPSQQ SNILDNGQED
1310 1320 1330 1340 1350
VSPSGQWNPY PLGRRDVPPD TITKKAGSHI QTLMGSQSLQ HRSREQQPYE
1360 1370 1380 1390 1400
GNINKVTIQQ FQSPLPIQIP SSQATRGPQP GRCLIQTKGQ RSMDGYPEQF
1410 1420 1430 1440 1450
CVRIEKNPGL GFSISGGISG QGNPFKPSDK GIFVTRVQPD GPASNLLQPG
1460 1470 1480 1490
DKILQANGHS FVHMEHEKAV LLLKSFQNTV DLVIQRELTV
Length:1,490
Mass (Da):166,879
Last modified:April 18, 2012 - v2
Checksum:i30DC3E92EB44F2A5
GO
Isoform 2 (identifier: P70587-2) [UniParc]FASTAAdd to basket
Also known as: Variant D

The sequence of this isoform differs from the canonical sequence as follows:
     1285-1285: R → RNAAYKHNTVNLGMLPYGGISAMHAGRSMTLNLQTKSKFDLQDLPLQK

Note: This is the only isoform to have a potential transmembrane domain.
Show »
Length:1,537
Mass (Da):172,035
Checksum:i1710B4823C93F5FD
GO
Isoform 3 (identifier: P70587-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1218-1241: Missing.

Note: No experimental confirmation available.
Show »
Length:1,466
Mass (Da):164,316
Checksum:i80CF7AB619551849
GO
Isoform 4 (identifier: P70587-4) [UniParc]FASTAAdd to basket
Also known as: Variant B

The sequence of this isoform differs from the canonical sequence as follows:
     1286-1325: Missing.

Note: No experimental confirmation available.1 Publication
Show »
Length:1,450
Mass (Da):162,460
Checksum:i32B3A3C4CD5860D0
GO
Isoform 5 (identifier: P70587-5) [UniParc]FASTAAdd to basket
Also known as: Variant C

The sequence of this isoform differs from the canonical sequence as follows:
     1326-1399: Missing.

Note: No experimental confirmation available.
Show »
Length:1,416
Mass (Da):158,650
Checksum:i5CD541D2CCABD0C3
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti722W → R AA sequence (PubMed:8824323).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0107981218 – 1241Missing in isoform 3. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_0107991285R → RNAAYKHNTVNLGMLPYGGI SAMHAGRSMTLNLQTKSKFD LQDLPLQK in isoform 2. 1 Publication1
Alternative sequenceiVSP_0108001286 – 1325Missing in isoform 4. 1 PublicationAdd BLAST40
Alternative sequenceiVSP_0108011326 – 1399Missing in isoform 5. 1 PublicationAdd BLAST74

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U66707 mRNA Translation: AAC52881.1
AF266164 mRNA Translation: AAF76466.1
PIRiT31434
RefSeqiNP_476483.1, NM_057142.1
UniGeneiRn.89629

Genome annotation databases

GeneIDi117284
KEGGirno:117284

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiLRRC7_RAT
AccessioniPrimary (citable) accession number: P70587
Secondary accession number(s): Q9JI42
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2004
Last sequence update: April 18, 2012
Last modified: March 28, 2018
This is version 129 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health