Reviewed,
UniProtKB/Swiss-Prot P70496 (PLD1_RAT)
Last modified
January 19, 2010.
Version 85.
History...
Clusters with 100%,
90%,
50% identity |
Documents (1) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Phospholipase D1 Short name=PLD 1 Short name=rPLD1 EC=3.1.4.4 Alternative name(s): Choline phosphatase 1 Phosphatidylcholine-hydrolyzing phospholipase D1 | ||
| Gene names |
| ||
| Organism | Rattus norvegicus (Rat) | ||
| Taxonomic identifier | 10116 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus |
Protein attributes
| Sequence length | 1074 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Implicated as a critical step in numerous cellular pathways, including signal transduction, membrane trafficking, and the regulation of mitosis. May be involved in the regulation of perinuclear intravesicular membrane traffic By similarity. |
| Catalytic activity | A phosphatidylcholine + H2O = choline + a phosphatidate. |
| Enzyme regulation | Stimulated by phosphatidylinositol 4,5-bisphosphate and phosphatidylinositol 3,4,5-trisphosphate, activated by the phosphokinase C-alpha, by the ADP-ribosylation factor-1 (ARF-1), and to a lesser extent by GTP-binding proteins: RHO A, RAC-1 and CDC42 By similarity. |
| Subunit structure | Interacts with PIP5K1A By similarity. |
| Subcellular location | Cytoplasm › perinuclear region By similarity. Endoplasmic reticulum membrane; Lipid-anchor By similarity. Golgi apparatus membrane; Lipid-anchor By similarity. Late endosome membrane; Lipid-anchor By similarity. Note: Membrane-associated. |
| Post-translational modification | Phosphorylated on serine and threonine residues. Ref.7 It is uncertain whether palmitoylation is on Cys-240 and/or Cys-241. Palmitoylation is required prior to phosphorylation. |
| Sequence similarities | Belongs to the phospholipase D family. Contains 1 PH domain. Contains 2 PLD phosphodiesterase domains. Contains 1 PX (phox homology) domain. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform PLD1A (identifier: P70496-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform PLD1B (identifier: P70496-2) The sequence of this isoform differs from the canonical sequence as follows: 585-623: SYFNHYRSHQNLIHGIKPHLKLFRPSSESEQGLTRHSAD → N | ||||||
| Isoform PLD1C (identifier: P70496-3) The sequence of this isoform differs from the canonical sequence as follows: 586-590: YFNHY → ESRLR 591-1074: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1074 | 1074 | Phospholipase D1 | PRO_0000218804 | |||||
Regions | |||||||||
| Domain | 81 – 212 | 132 | PX | ||||||
| Domain | 219 – 328 | 110 | PH | ||||||
| Domain | 459 – 486 | 28 | PLD phosphodiesterase 1 | ||||||
| Domain | 891 – 918 | 28 | PLD phosphodiesterase 2 | ||||||
| Region | 463 – 928 | 466 | Catalytic | ||||||
Amino acid modifications | |||||||||
| Modified residue | 629 | 1 | Phosphoserine By similarity | ||||||
| Lipidation | 240 | 1 | S-palmitoyl cysteine Probable | ||||||
| Lipidation | 241 | 1 | S-palmitoyl cysteine Probable | ||||||
Natural variations | |||||||||
| Alternative sequence | 585 – 623 | 39 | SYFNH…RHSAD → N in isoform PLD1B. | VSP_005024 | |||||
| Alternative sequence | 586 – 590 | 5 | YFNHY → ESRLR in isoform PLD1C. | VSP_005025 | |||||
| Alternative sequence | 591 – 1074 | 484 | Missing in isoform PLD1C. | VSP_005026 | |||||
Experimental info | |||||||||
| Mutagenesis | 240 | 1 | C → A: Abolishes palmitoylation and weakens membrane association; when associated with A-241. Ref.7 | ||||||
| Mutagenesis | 241 | 1 | C → A: Abolishes palmitoylation and weakens membrane association; when associated with A-240. Ref.7 | ||||||
| Sequence conflict | 4 | 1 | R → K in BAA24576. Ref.4 | ||||||
| Sequence conflict | 22 | 1 | S → R Ref.3 | ||||||
| Sequence conflict | 22 | 1 | S → R Ref.6 | ||||||
| Sequence conflict | 283 | 1 | R → K in BAA24076. Ref.1 | ||||||
| Sequence conflict | 283 | 1 | R → K in BAA24077. Ref.1 | ||||||
| Sequence conflict | 542 | 1 | N → D Ref.1 | ||||||
| Sequence conflict | 542 | 1 | N → D Ref.2 | ||||||
| Sequence conflict | 542 | 1 | N → D Ref.4 | ||||||
| Sequence conflict | 600 | 1 | I → L in BAA24576. Ref.4 | ||||||
| Sequence conflict | 709 | 1 | P → A in BAA24076. Ref.1 | ||||||
| Sequence conflict | 709 | 1 | P → A in BAA24077. Ref.1 | ||||||
| Sequence conflict | 735 – 736 | 2 | PG → EV in BAA24076. Ref.1 | ||||||
| Sequence conflict | 735 – 736 | 2 | PG → EV in BAA24077. Ref.1 | ||||||
| Sequence conflict | 739 – 740 | 2 | HA → QP in BAA24076. Ref.1 | ||||||
| Sequence conflict | 739 – 740 | 2 | HA → QP in BAA24077. Ref.1 | ||||||
| Sequence conflict | 773 | 1 | S → T Ref.1 | ||||||
| Sequence conflict | 775 | 1 | H → R Ref.1 | ||||||
| Sequence conflict | 786 | 1 | S → T in BAA24076. Ref.1 | ||||||
| Sequence conflict | 786 | 1 | S → T in BAA24077. Ref.1 | ||||||
| Sequence conflict | 800 | 1 | A → C in BAA24076. Ref.1 | ||||||
| Sequence conflict | 800 | 1 | A → C in BAA24077. Ref.1 | ||||||
| Sequence conflict | 809 | 1 | H → T in BAA24076. Ref.1 | ||||||
| Sequence conflict | 809 | 1 | H → T in BAA24077. Ref.1 | ||||||
| Sequence conflict | 830 | 1 | D → N in BAA24076. Ref.1 | ||||||
| Sequence conflict | 830 | 1 | D → N in BAA24077. Ref.1 | ||||||
| Sequence conflict | 934 – 935 | 2 | TE → RQ in AAB86910. Ref.3 | ||||||
| Sequence conflict | 951 – 954 | 4 | FAQG → SLSTV Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| [1] | "Molecular cloning and chromosome mapping of rat phospholipase D genes, Pld1a, Pld1b and Pld2." Nakashima S., Matsuda Y., Akao Y., Yoshimura S., Sakai H., Hayakawa K., Andoh M., Nozawa Y. Cytogenet. Cell Genet. 79:109-113(1997) [PubMed: 9533024] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS PLD1A AND PLD1B). |
| [2] | "Differential mRNA expression of phospholipase D (PLD) isozymes during cAMP-induced differentiation in C6 glioma cells." Yoshimura S., Nakashima S., Ohguchi K., Sakai H., Shinoda J., Sakai N., Nozawa Y. Biochem. Biophys. Res. Commun. 225:494-499(1996) [PubMed: 8753790] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 467-673 (ISOFORMS PLD1A AND PLD1B). Tissue: Glial cell. |
| [3] | "Cloning and characterization of phospholipase D from rat brain." Park S.K., Provost J.J., Bae C.D., Ho W.T., Exton J.H. J. Biol. Chem. 272:29263-29271(1997) [PubMed: 9361006] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PLD1B). |
| [4] | "Cloning, differential regulation and tissue distribution of alternatively spliced isoforms of ADP-ribosylation-factor-dependent phospholipase D from rat liver." Katayama K., Kodaki T., Nagamachi Y., Yamashita S. Biochem. J. 329:647-652(1998) [PubMed: 9445394] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS PLD1A AND PLD1B). |
| [5] | "Molecular cloning of a cDNA homologous to a phospholipase D1 segment." Lassegue B., Alexander R.W., Griendling K. Submitted (FEB-1997) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-511. |
| [6] | "Phospholipase D not having transphosphatidylation reaction." Park S.K., Exton J.H. Submitted (AUG-1997) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PLD1C). Tissue: Lung. |
| [7] | "Requirements and effects of palmitoylation of rat PLD1." Xie Z., Ho W.T., Exton J.H. J. Biol. Chem. 276:9383-9391(2001) [PubMed: 11121416] [Abstract] Cited for: PALMITOYLATION AT CYS-240 AND CYS-241, MUTAGENESIS OF CYS-240 AND CYS-241, PHOSPHORYLATION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB003170 mRNA. Translation: BAA24076.1. AB003171 mRNA. Translation: BAA24077.1. U69550 mRNA. Translation: AAB86910.1. AB000778 mRNA. Translation: BAA24576.1. AB000779 mRNA. Translation: BAA24577.1. U88986 mRNA. Translation: AAB91329.1. AF017251 mRNA. Translation: AAD01609.1. |
| IPI | IPI00188898. IPI00231169. IPI00231170. |
| PIR | T13725. T13732. T13943. T46635. |
| RefSeq | NP_112254.1. |
| UniGene | Rn.11130 |
3D structure databases | |
| SMR | P70496. Positions 97-211, 759-940. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | P70496. |
PTM databases | |
| PhosphoSite | P70496. |
Genome annotation databases | |
| Ensembl | ENSRNOT00000039296; ENSRNOP00000034466; ENSRNOG00000028156; Rattus norvegicus. [Genome view] |
| GeneID | 25096. |
| KEGG | rno:25096. |
| UCSC | NM_030992. rat. |
Organism-specific databases | |
| CTD | 25096. |
| RGD | 3349. Pld1. |
Phylogenomic databases | |
| eggNOG | roNOG09371. |
| HOVERGEN | P70496. |
| InParanoid | P70496. |
Enzyme and pathway databases | |
| BRENDA | 3.1.4.4. 248. |
Gene expression databases | |
| ArrayExpress | P70496. |
| Genevestigator | P70496. |
| GermOnline | ENSRNOG00000028156. Rattus norvegicus. |
Family and domain databases | |
| InterPro | IPR011993. PH_type. IPR015679. Phospholipase_D. IPR001849. Pleckstrin_homology. IPR001736. PLipase_D/transphosphatidylase. IPR016555. PLipase_D_euk. IPR001683. PX. [Graphical view] |
| Gene3D | G3DSA:2.30.29.30. PH_type. 1 hit. G3DSA:3.30.1520.10. PX. 1 hit. |
| PANTHER | PTHR18896. Phospholipase_D. 1 hit. |
| Pfam | PF00169. PH. 1 hit. PF00614. PLDc. 1 hit. PF00787. PX. 1 hit. [Graphical view] |
| PIRSF | PIRSF009376. Phospholipase_D_euk. 1 hit. |
| SMART | SM00233. PH. 1 hit. SM00155. PLDc. 2 hits. SM00312. PX. 1 hit. [Graphical view] |
| PROSITE | PS50003. PH_DOMAIN. 1 hit. PS50035. PLD. 2 hits. PS50195. PX. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 605397. |
Entry information
| Entry name | PLD1_RAT | ||||||||
| Accession | Primary (citable) accession number: P70496 Secondary accession number(s): O08959 Q9QWJ6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||

Clusters with


