Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Phospholipase D1

Gene

Pld1

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Implicated as a critical step in numerous cellular pathways, including signal transduction, membrane trafficking, and the regulation of mitosis. May be involved in the regulation of perinuclear intravesicular membrane traffic (By similarity).By similarity

Catalytic activityi

A phosphatidylcholine + H2O = choline + a phosphatidate.

Enzyme regulationi

Stimulated by phosphatidylinositol 4,5-bisphosphate and phosphatidylinositol 3,4,5-trisphosphate, activated by the phosphokinase C-alpha, by the ADP-ribosylation factor-1 (ARF-1), and to a lesser extent by GTP-binding proteins: RHO A, RAC-1 and CDC42.By similarity

GO - Molecular functioni

GO - Biological processi

  • inositol lipid-mediated signaling Source: InterPro
  • phosphatidic acid biosynthetic process Source: MGI
  • phospholipid biosynthetic process Source: MGI
  • phospholipid catabolic process Source: RGD
  • positive regulation of cell migration Source: RGD
  • regulation of phagocytosis Source: InterPro
  • response to peptide hormone Source: RGD
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Biological processi

Lipid degradation, Lipid metabolism

Enzyme and pathway databases

BRENDAi3.1.4.4. 5301.

Names & Taxonomyi

Protein namesi
Recommended name:
Phospholipase D1 (EC:3.1.4.4)
Short name:
PLD 1
Short name:
rPLD1
Alternative name(s):
Choline phosphatase 1
Phosphatidylcholine-hydrolyzing phospholipase D1
Gene namesi
Name:Pld1
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi3349. Pld1.

Subcellular locationi

GO - Cellular componenti

  • endoplasmic reticulum membrane Source: UniProtKB-SubCell
  • Golgi cisterna Source: RGD
  • Golgi membrane Source: UniProtKB-SubCell
  • intracellular membrane-bounded organelle Source: RGD
  • lamellipodium Source: RGD
  • late endosome membrane Source: UniProtKB-SubCell
  • perinuclear region of cytoplasm Source: UniProtKB-SubCell
  • vesicle Source: RGD
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Endoplasmic reticulum, Endosome, Golgi apparatus, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi240 – 2401C → A: Abolishes palmitoylation and weakens membrane association; when associated with A-241. 1 Publication
Mutagenesisi241 – 2411C → A: Abolishes palmitoylation and weakens membrane association; when associated with A-240. 1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10741074Phospholipase D1PRO_0000218804Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Lipidationi240 – 2401S-palmitoyl cysteine1 Publication
Lipidationi241 – 2411S-palmitoyl cysteine1 Publication
Modified residuei499 – 4991PhosphoserineCombined sources
Modified residuei629 – 6291PhosphoserineCombined sources

Post-translational modificationi

Phosphorylated on serine and threonine residues.1 Publication
It is uncertain whether palmitoylation is on Cys-240 and/or Cys-241. Palmitoylation is required prior to phosphorylation.1 Publication

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

PaxDbiP70496.
PRIDEiP70496.

PTM databases

iPTMnetiP70496.
PhosphoSiteiP70496.
SwissPalmiP70496.

Interactioni

Subunit structurei

Interacts with PIP5K1B.By similarity

Protein-protein interaction databases

IntActiP70496. 1 interaction.
MINTiMINT-1534671.
STRINGi10116.ENSRNOP00000034466.

Structurei

3D structure databases

ProteinModelPortaliP70496.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini81 – 212132PXPROSITE-ProRule annotationAdd
BLAST
Domaini219 – 328110PHPROSITE-ProRule annotationAdd
BLAST
Domaini459 – 48628PLD phosphodiesterase 1PROSITE-ProRule annotationAdd
BLAST
Domaini891 – 91828PLD phosphodiesterase 2PROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni463 – 928466CatalyticAdd
BLAST

Sequence similaritiesi

Belongs to the phospholipase D family.Curated
Contains 1 PH domain.PROSITE-ProRule annotation
Contains 2 PLD phosphodiesterase domains.PROSITE-ProRule annotation
Contains 1 PX (phox homology) domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG1329. Eukaryota.
COG1502. LUCA.
HOGENOMiHOG000246972.
HOVERGENiHBG006650.
InParanoidiP70496.
KOiK01115.
PhylomeDBiP70496.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
3.30.1520.10. 1 hit.
InterProiIPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR001683. Phox.
IPR025202. PLD-like_dom.
IPR001736. PLipase_D/transphosphatidylase.
IPR016555. PLipase_D1/D2.
IPR015679. PLipase_D_fam.
[Graphical view]
PANTHERiPTHR18896. PTHR18896. 2 hits.
PfamiPF00169. PH. 1 hit.
PF00614. PLDc. 1 hit.
PF13091. PLDc_2. 1 hit.
PF00787. PX. 1 hit.
[Graphical view]
PIRSFiPIRSF009376. Phospholipase_D_euk. 1 hit.
SMARTiSM00233. PH. 1 hit.
SM00155. PLDc. 2 hits.
SM00312. PX. 1 hit.
[Graphical view]
SUPFAMiSSF50729. SSF50729. 1 hit.
SSF64268. SSF64268. 1 hit.
PROSITEiPS50003. PH_DOMAIN. 1 hit.
PS50035. PLD. 2 hits.
PS50195. PX. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform PLD1A (identifier: P70496-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSLRSEARVN TSTLQKIAAD MSNLIENLDT RELHFEGEEV EYDASPGDPT
60 70 80 90 100
AQEACIPFSS IYNTQGFKEP NIQIYLSGCP VKAQVLEVER FTSTSRMPSV
110 120 130 140 150
NLYTIELTHG EFTWQVKRKF KHFQEFHREL LKYKAFIRIP IPTKRHTFRR
160 170 180 190 200
QNVKEEPREM PSLPRSSENA IQEEQFFGRR KQLEDYLTKI LKMPMYRNYH
210 220 230 240 250
ATTEFLDVSQ LSFIHDLGPK GLEGMIMKRS GGHRIPGVNC CGHGRACYRW
260 270 280 290 300
SKRWLIVKDS FLLYMKPDSG AIAFVLLVDK EFRIKVGKKE TETKYGLRID
310 320 330 340 350
NLSRTLILKC NSYRHARWWG GAIEEFIQKH GTDFLKDHRF GSYAAVHENI
360 370 380 390 400
LAKWYVNAKG YFEDIANAME GATEEIFITD WWLSPEIFLK RPVVEGNRWR
410 420 430 440 450
LDCILKRKAQ QGVRIFIMLY KEVELALGIN SEYTKRTLMR LHPNIKVMRH
460 470 480 490 500
PDHVSSSVYL WAHHEKLVII DQSVAFVGGI DLAYGRWDDN EHRLTDVGSV
510 520 530 540 550
KRVTSGQSLG SLTAASVESM ESLSLKDKHQ SHKNEPVLKS VNDTDMKLKG
560 570 580 590 600
IGKSRKFSKF SLYRQLHRRN LHNSDSISSV DSASSYFNHY RSHQNLIHGI
610 620 630 640 650
KPHLKLFRPS SESEQGLTRH SADTGSIRSV QTGVGELHGE TRFWHGKDYC
660 670 680 690 700
NFVFKDWVQL DKPFADFIDR YSTPRMPWHD IGSVVHGKAA RDVARHFIQR
710 720 730 740 750
WNFTKIMKPK YRSLSYPFLL PKSQATAHEL RYQVPGAVHA KAQLLRSAAD
760 770 780 790 800
WSAGIKHHEE SIHAAYTHVI ENSKHYIYIE NQFFISCADD KVVFNKVGNA
810 820 830 840 850
IAQRILKAHR EGQRYRVYIV IPLLPGFEGD ISTGGGNALQ AIMHFNYRTM
860 870 880 890 900
CRGESSILEQ LKPELGNKWI NYISFCGLRT HAELEGNLVT ELIYVHSKLL
910 920 930 940 950
IADDNTVIIG SANINDRSML GKRDSEMAVI VQDTETVPSV MDGKEYQAGR
960 970 980 990 1000
FAQGLRLECF RLVLGYLSDP SEDIQDPVSD KFFKEIWVST AARNATIYDK
1010 1020 1030 1040 1050
VFRCLPNDEV HNLIQLRDFI NKPILAKEDR LRAEEELRKI RGFLVQFPFY
1060 1070
FLSEENLLPS VGTKEAIVPM EVWT
Length:1,074
Mass (Da):123,814
Last modified:October 18, 2001 - v3
Checksum:i286943A447A881DB
GO
Isoform PLD1B (identifier: P70496-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     585-623: SYFNHYRSHQNLIHGIKPHLKLFRPSSESEQGLTRHSAD → N

Show »
Length:1,036
Mass (Da):119,357
Checksum:i350956C43A38E506
GO
Isoform PLD1C (identifier: P70496-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     586-590: YFNHY → ESRLR
     591-1074: Missing.

Show »
Length:590
Mass (Da):68,318
Checksum:iFBD1FD4D7FAF9D18
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti4 – 41R → K in BAA24576 (PubMed:9445394).Curated
Sequence conflicti22 – 221S → R (PubMed:9361006).Curated
Sequence conflicti22 – 221S → R (Ref. 6) Curated
Sequence conflicti283 – 2831R → K in BAA24076 (PubMed:9533024).Curated
Sequence conflicti283 – 2831R → K in BAA24077 (PubMed:9533024).Curated
Sequence conflicti542 – 5421N → D (PubMed:9533024).Curated
Sequence conflicti542 – 5421N → D (PubMed:8753790).Curated
Sequence conflicti542 – 5421N → D (PubMed:9445394).Curated
Sequence conflicti600 – 6001I → L in BAA24576 (PubMed:9445394).Curated
Sequence conflicti709 – 7091P → A in BAA24076 (PubMed:9533024).Curated
Sequence conflicti709 – 7091P → A in BAA24077 (PubMed:9533024).Curated
Sequence conflicti735 – 7362PG → EV in BAA24076 (PubMed:9533024).Curated
Sequence conflicti735 – 7362PG → EV in BAA24077 (PubMed:9533024).Curated
Sequence conflicti739 – 7402HA → QP in BAA24076 (PubMed:9533024).Curated
Sequence conflicti739 – 7402HA → QP in BAA24077 (PubMed:9533024).Curated
Sequence conflicti773 – 7731S → T (PubMed:9533024).Curated
Sequence conflicti775 – 7751H → R (PubMed:9533024).Curated
Sequence conflicti786 – 7861S → T in BAA24076 (PubMed:9533024).Curated
Sequence conflicti786 – 7861S → T in BAA24077 (PubMed:9533024).Curated
Sequence conflicti800 – 8001A → C in BAA24076 (PubMed:9533024).Curated
Sequence conflicti800 – 8001A → C in BAA24077 (PubMed:9533024).Curated
Sequence conflicti809 – 8091H → T in BAA24076 (PubMed:9533024).Curated
Sequence conflicti809 – 8091H → T in BAA24077 (PubMed:9533024).Curated
Sequence conflicti830 – 8301D → N in BAA24076 (PubMed:9533024).Curated
Sequence conflicti830 – 8301D → N in BAA24077 (PubMed:9533024).Curated
Sequence conflicti934 – 9352TE → RQ in AAB86910 (PubMed:9361006).Curated
Sequence conflicti951 – 9544FAQG → SLSTV (PubMed:9533024).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei585 – 62339SYFNH…RHSAD → N in isoform PLD1B. 4 PublicationsVSP_005024Add
BLAST
Alternative sequencei586 – 5905YFNHY → ESRLR in isoform PLD1C. 1 PublicationVSP_005025
Alternative sequencei591 – 1074484Missing in isoform PLD1C. 1 PublicationVSP_005026Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB003170 mRNA. Translation: BAA24076.1.
AB003171 mRNA. Translation: BAA24077.1.
U69550 mRNA. Translation: AAB86910.1.
AB000778 mRNA. Translation: BAA24576.1.
AB000779 mRNA. Translation: BAA24577.1.
U88986 mRNA. Translation: AAB91329.1.
AF017251 mRNA. Translation: AAD01609.1.
PIRiT13725.
T13732.
T13943.
T46635.
RefSeqiNP_112254.1. NM_030992.1.
UniGeneiRn.11130.

Genome annotation databases

GeneIDi25096.
KEGGirno:25096.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB003170 mRNA. Translation: BAA24076.1.
AB003171 mRNA. Translation: BAA24077.1.
U69550 mRNA. Translation: AAB86910.1.
AB000778 mRNA. Translation: BAA24576.1.
AB000779 mRNA. Translation: BAA24577.1.
U88986 mRNA. Translation: AAB91329.1.
AF017251 mRNA. Translation: AAD01609.1.
PIRiT13725.
T13732.
T13943.
T46635.
RefSeqiNP_112254.1. NM_030992.1.
UniGeneiRn.11130.

3D structure databases

ProteinModelPortaliP70496.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiP70496. 1 interaction.
MINTiMINT-1534671.
STRINGi10116.ENSRNOP00000034466.

PTM databases

iPTMnetiP70496.
PhosphoSiteiP70496.
SwissPalmiP70496.

Proteomic databases

PaxDbiP70496.
PRIDEiP70496.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi25096.
KEGGirno:25096.

Organism-specific databases

CTDi5337.
RGDi3349. Pld1.

Phylogenomic databases

eggNOGiKOG1329. Eukaryota.
COG1502. LUCA.
HOGENOMiHOG000246972.
HOVERGENiHBG006650.
InParanoidiP70496.
KOiK01115.
PhylomeDBiP70496.

Enzyme and pathway databases

BRENDAi3.1.4.4. 5301.

Miscellaneous databases

PROiP70496.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
3.30.1520.10. 1 hit.
InterProiIPR011993. PH_dom-like.
IPR001849. PH_domain.
IPR001683. Phox.
IPR025202. PLD-like_dom.
IPR001736. PLipase_D/transphosphatidylase.
IPR016555. PLipase_D1/D2.
IPR015679. PLipase_D_fam.
[Graphical view]
PANTHERiPTHR18896. PTHR18896. 2 hits.
PfamiPF00169. PH. 1 hit.
PF00614. PLDc. 1 hit.
PF13091. PLDc_2. 1 hit.
PF00787. PX. 1 hit.
[Graphical view]
PIRSFiPIRSF009376. Phospholipase_D_euk. 1 hit.
SMARTiSM00233. PH. 1 hit.
SM00155. PLDc. 2 hits.
SM00312. PX. 1 hit.
[Graphical view]
SUPFAMiSSF50729. SSF50729. 1 hit.
SSF64268. SSF64268. 1 hit.
PROSITEiPS50003. PH_DOMAIN. 1 hit.
PS50035. PLD. 2 hits.
PS50195. PX. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning and chromosome mapping of rat phospholipase D genes, Pld1a, Pld1b and Pld2."
    Nakashima S., Matsuda Y., Akao Y., Yoshimura S., Sakai H., Hayakawa K., Andoh M., Nozawa Y.
    Cytogenet. Cell Genet. 79:109-113(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS PLD1A AND PLD1B).
  2. "Differential mRNA expression of phospholipase D (PLD) isozymes during cAMP-induced differentiation in C6 glioma cells."
    Yoshimura S., Nakashima S., Ohguchi K., Sakai H., Shinoda J., Sakai N., Nozawa Y.
    Biochem. Biophys. Res. Commun. 225:494-499(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 467-673 (ISOFORMS PLD1A AND PLD1B).
    Tissue: Glial cell.
  3. "Cloning and characterization of phospholipase D from rat brain."
    Park S.K., Provost J.J., Bae C.D., Ho W.T., Exton J.H.
    J. Biol. Chem. 272:29263-29271(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PLD1B).
  4. "Cloning, differential regulation and tissue distribution of alternatively spliced isoforms of ADP-ribosylation-factor-dependent phospholipase D from rat liver."
    Katayama K., Kodaki T., Nagamachi Y., Yamashita S.
    Biochem. J. 329:647-652(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS PLD1A AND PLD1B).
  5. "Molecular cloning of a cDNA homologous to a phospholipase D1 segment."
    Lassegue B., Alexander R.W., Griendling K.
    Submitted (FEB-1997) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-511.
  6. "Phospholipase D not having transphosphatidylation reaction."
    Park S.K., Exton J.H.
    Submitted (AUG-1997) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM PLD1C).
    Tissue: Lung.
  7. "Requirements and effects of palmitoylation of rat PLD1."
    Xie Z., Ho W.T., Exton J.H.
    J. Biol. Chem. 276:9383-9391(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: PALMITOYLATION AT CYS-240 AND CYS-241, MUTAGENESIS OF CYS-240 AND CYS-241, PHOSPHORYLATION.
  8. "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues."
    Lundby A., Secher A., Lage K., Nordsborg N.B., Dmytriyev A., Lundby C., Olsen J.V.
    Nat. Commun. 3:876-876(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-499 AND SER-629, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiPLD1_RAT
AccessioniPrimary (citable) accession number: P70496
Secondary accession number(s): O08959
, O35856, O54765, P70497, Q9QWJ6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: October 18, 2001
Last modified: June 8, 2016
This is version 131 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.