Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Phospholipase D1

Gene

Pld1

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Implicated as a critical step in numerous cellular pathways, including signal transduction, membrane trafficking, and the regulation of mitosis. May be involved in the regulation of perinuclear intravesicular membrane traffic (By similarity).By similarity

Catalytic activityi

A phosphatidylcholine + H2O = choline + a phosphatidate.

Enzyme regulationi

Stimulated by phosphatidylinositol 4,5-bisphosphate and phosphatidylinositol 3,4,5-trisphosphate, activated by the phosphokinase C-alpha, by the ADP-ribosylation factor-1 (ARF-1), and to a lesser extent by GTP-binding proteins: RHO A, RAC-1 and CDC42.By similarity

GO - Molecular functioni

GO - Biological processi

  • defense response to Gram-positive bacterium Source: RGD
  • inositol lipid-mediated signaling Source: InterPro
  • phosphatidic acid biosynthetic process Source: MGI
  • phospholipid biosynthetic process Source: MGI
  • phospholipid catabolic process Source: RGD
  • positive regulation of cell migration Source: RGD
  • regulation of microvillus assembly Source: RGD
  • response to peptide hormone Source: RGD

Keywordsi

Molecular functionHydrolase
Biological processLipid degradation, Lipid metabolism

Enzyme and pathway databases

BRENDAi3.1.4.4 5301

Names & Taxonomyi

Protein namesi
Recommended name:
Phospholipase D1 (EC:3.1.4.4)
Short name:
PLD 1
Short name:
rPLD1
Alternative name(s):
Choline phosphatase 1
Phosphatidylcholine-hydrolyzing phospholipase D1
Gene namesi
Name:Pld1
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi3349 Pld1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Endoplasmic reticulum, Endosome, Golgi apparatus, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi240C → A: Abolishes palmitoylation and weakens membrane association; when associated with A-241. 1 Publication1
Mutagenesisi241C → A: Abolishes palmitoylation and weakens membrane association; when associated with A-240. 1 Publication1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002188041 – 1074Phospholipase D1Add BLAST1074

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Lipidationi240S-palmitoyl cysteine1 Publication1
Lipidationi241S-palmitoyl cysteine1 Publication1
Modified residuei499PhosphoserineCombined sources1
Modified residuei561PhosphoserineBy similarity1
Modified residuei629PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylated on serine and threonine residues.1 Publication
It is uncertain whether palmitoylation is on Cys-240 and/or Cys-241. Palmitoylation is required prior to phosphorylation.1 Publication

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

PaxDbiP70496
PeptideAtlasiP70496
PRIDEiP70496

PTM databases

iPTMnetiP70496
PhosphoSitePlusiP70496
SwissPalmiP70496

Interactioni

Subunit structurei

Interacts with PIP5K1B.By similarity

Protein-protein interaction databases

IntActiP70496, 1 interactor
MINTiP70496
STRINGi10116.ENSRNOP00000034466

Structurei

3D structure databases

ProteinModelPortaliP70496
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini81 – 212PXPROSITE-ProRule annotationAdd BLAST132
Domaini219 – 328PHPROSITE-ProRule annotationAdd BLAST110
Domaini459 – 486PLD phosphodiesterase 1PROSITE-ProRule annotationAdd BLAST28
Domaini891 – 918PLD phosphodiesterase 2PROSITE-ProRule annotationAdd BLAST28

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni463 – 928CatalyticAdd BLAST466

Sequence similaritiesi

Belongs to the phospholipase D family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG1329 Eukaryota
COG1502 LUCA
HOGENOMiHOG000246972
HOVERGENiHBG006650
InParanoidiP70496
KOiK01115
PhylomeDBiP70496

Family and domain databases

Gene3Di2.30.29.30, 1 hit
3.30.1520.10, 1 hit
InterProiView protein in InterPro
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR001683 Phox
IPR025202 PLD-like_dom
IPR001736 PLipase_D/transphosphatidylase
IPR016555 PLipase_D_euk
IPR015679 PLipase_D_fam
IPR036871 PX_dom_sf
PANTHERiPTHR18896 PTHR18896, 1 hit
PfamiView protein in Pfam
PF00169 PH, 1 hit
PF00614 PLDc, 1 hit
PF13091 PLDc_2, 1 hit
PF00787 PX, 1 hit
PIRSFiPIRSF009376 Phospholipase_D_euk, 1 hit
SMARTiView protein in SMART
SM00233 PH, 1 hit
SM00155 PLDc, 2 hits
SM00312 PX, 1 hit
SUPFAMiSSF64268 SSF64268, 1 hit
PROSITEiView protein in PROSITE
PS50003 PH_DOMAIN, 1 hit
PS50035 PLD, 2 hits
PS50195 PX, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform PLD1A (identifier: P70496-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSLRSEARVN TSTLQKIAAD MSNLIENLDT RELHFEGEEV EYDASPGDPT
60 70 80 90 100
AQEACIPFSS IYNTQGFKEP NIQIYLSGCP VKAQVLEVER FTSTSRMPSV
110 120 130 140 150
NLYTIELTHG EFTWQVKRKF KHFQEFHREL LKYKAFIRIP IPTKRHTFRR
160 170 180 190 200
QNVKEEPREM PSLPRSSENA IQEEQFFGRR KQLEDYLTKI LKMPMYRNYH
210 220 230 240 250
ATTEFLDVSQ LSFIHDLGPK GLEGMIMKRS GGHRIPGVNC CGHGRACYRW
260 270 280 290 300
SKRWLIVKDS FLLYMKPDSG AIAFVLLVDK EFRIKVGKKE TETKYGLRID
310 320 330 340 350
NLSRTLILKC NSYRHARWWG GAIEEFIQKH GTDFLKDHRF GSYAAVHENI
360 370 380 390 400
LAKWYVNAKG YFEDIANAME GATEEIFITD WWLSPEIFLK RPVVEGNRWR
410 420 430 440 450
LDCILKRKAQ QGVRIFIMLY KEVELALGIN SEYTKRTLMR LHPNIKVMRH
460 470 480 490 500
PDHVSSSVYL WAHHEKLVII DQSVAFVGGI DLAYGRWDDN EHRLTDVGSV
510 520 530 540 550
KRVTSGQSLG SLTAASVESM ESLSLKDKHQ SHKNEPVLKS VNDTDMKLKG
560 570 580 590 600
IGKSRKFSKF SLYRQLHRRN LHNSDSISSV DSASSYFNHY RSHQNLIHGI
610 620 630 640 650
KPHLKLFRPS SESEQGLTRH SADTGSIRSV QTGVGELHGE TRFWHGKDYC
660 670 680 690 700
NFVFKDWVQL DKPFADFIDR YSTPRMPWHD IGSVVHGKAA RDVARHFIQR
710 720 730 740 750
WNFTKIMKPK YRSLSYPFLL PKSQATAHEL RYQVPGAVHA KAQLLRSAAD
760 770 780 790 800
WSAGIKHHEE SIHAAYTHVI ENSKHYIYIE NQFFISCADD KVVFNKVGNA
810 820 830 840 850
IAQRILKAHR EGQRYRVYIV IPLLPGFEGD ISTGGGNALQ AIMHFNYRTM
860 870 880 890 900
CRGESSILEQ LKPELGNKWI NYISFCGLRT HAELEGNLVT ELIYVHSKLL
910 920 930 940 950
IADDNTVIIG SANINDRSML GKRDSEMAVI VQDTETVPSV MDGKEYQAGR
960 970 980 990 1000
FAQGLRLECF RLVLGYLSDP SEDIQDPVSD KFFKEIWVST AARNATIYDK
1010 1020 1030 1040 1050
VFRCLPNDEV HNLIQLRDFI NKPILAKEDR LRAEEELRKI RGFLVQFPFY
1060 1070
FLSEENLLPS VGTKEAIVPM EVWT
Length:1,074
Mass (Da):123,814
Last modified:October 18, 2001 - v3
Checksum:i286943A447A881DB
GO
Isoform PLD1B (identifier: P70496-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     585-623: SYFNHYRSHQNLIHGIKPHLKLFRPSSESEQGLTRHSAD → N

Show »
Length:1,036
Mass (Da):119,357
Checksum:i350956C43A38E506
GO
Isoform PLD1C (identifier: P70496-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     586-590: YFNHY → ESRLR
     591-1074: Missing.

Show »
Length:590
Mass (Da):68,318
Checksum:iFBD1FD4D7FAF9D18
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti4R → K in BAA24576 (PubMed:9445394).Curated1
Sequence conflicti22S → R (PubMed:9361006).Curated1
Sequence conflicti22S → R (Ref. 6) Curated1
Sequence conflicti283R → K in BAA24076 (PubMed:9533024).Curated1
Sequence conflicti283R → K in BAA24077 (PubMed:9533024).Curated1
Sequence conflicti542N → D (PubMed:9533024).Curated1
Sequence conflicti542N → D (PubMed:8753790).Curated1
Sequence conflicti542N → D (PubMed:9445394).Curated1
Sequence conflicti600I → L in BAA24576 (PubMed:9445394).Curated1
Sequence conflicti709P → A in BAA24076 (PubMed:9533024).Curated1
Sequence conflicti709P → A in BAA24077 (PubMed:9533024).Curated1
Sequence conflicti735 – 736PG → EV in BAA24076 (PubMed:9533024).Curated2
Sequence conflicti735 – 736PG → EV in BAA24077 (PubMed:9533024).Curated2
Sequence conflicti739 – 740HA → QP in BAA24076 (PubMed:9533024).Curated2
Sequence conflicti739 – 740HA → QP in BAA24077 (PubMed:9533024).Curated2
Sequence conflicti773S → T (PubMed:9533024).Curated1
Sequence conflicti775H → R (PubMed:9533024).Curated1
Sequence conflicti786S → T in BAA24076 (PubMed:9533024).Curated1
Sequence conflicti786S → T in BAA24077 (PubMed:9533024).Curated1
Sequence conflicti800A → C in BAA24076 (PubMed:9533024).Curated1
Sequence conflicti800A → C in BAA24077 (PubMed:9533024).Curated1
Sequence conflicti809H → T in BAA24076 (PubMed:9533024).Curated1
Sequence conflicti809H → T in BAA24077 (PubMed:9533024).Curated1
Sequence conflicti830D → N in BAA24076 (PubMed:9533024).Curated1
Sequence conflicti830D → N in BAA24077 (PubMed:9533024).Curated1
Sequence conflicti934 – 935TE → RQ in AAB86910 (PubMed:9361006).Curated2
Sequence conflicti951 – 954FAQG → SLSTV (PubMed:9533024).Curated4

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_005024585 – 623SYFNH…RHSAD → N in isoform PLD1B. 4 PublicationsAdd BLAST39
Alternative sequenceiVSP_005025586 – 590YFNHY → ESRLR in isoform PLD1C. 1 Publication5
Alternative sequenceiVSP_005026591 – 1074Missing in isoform PLD1C. 1 PublicationAdd BLAST484

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB003170 mRNA Translation: BAA24076.1
AB003171 mRNA Translation: BAA24077.1
U69550 mRNA Translation: AAB86910.1
AB000778 mRNA Translation: BAA24576.1
AB000779 mRNA Translation: BAA24577.1
U88986 mRNA Translation: AAB91329.1
AF017251 mRNA Translation: AAD01609.1
PIRiT13725
T13732
T13943
T46635
RefSeqiNP_112254.1, NM_030992.1
UniGeneiRn.11130

Genome annotation databases

GeneIDi25096
KEGGirno:25096

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiPLD1_RAT
AccessioniPrimary (citable) accession number: P70496
Secondary accession number(s): O08959
, O35856, O54765, P70497, Q9QWJ6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: October 18, 2001
Last modified: March 28, 2018
This is version 144 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health