Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P70453

- PDE7A_MOUSE

UniProt

P70453 - PDE7A_MOUSE

Protein

High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A

Gene

Pde7a

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 117 (01 Oct 2014)
      Sequence version 2 (27 Jul 2011)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes. May have a role in muscle signal transduction By similarity.By similarity

    Catalytic activityi

    Adenosine 3',5'-cyclic phosphate + H2O = adenosine 5'-phosphate.

    Cofactori

    Binds 2 divalent metal cations per subunit. Site 1 may preferentially bind zinc ions, while site 2 has a preference for magnesium and/or manganese ions By similarity.By similarity

    Enzyme regulationi

    Insensitive to all selective PDE inhibitors.

    Pathwayi

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei186 – 1861Proton donorBy similarity
    Metal bindingi190 – 1901Divalent metal cation 1By similarity
    Metal bindingi226 – 2261Divalent metal cation 1By similarity
    Metal bindingi227 – 2271Divalent metal cation 1By similarity
    Metal bindingi227 – 2271Divalent metal cation 2By similarity
    Metal bindingi336 – 3361Divalent metal cation 1By similarity

    GO - Molecular functioni

    1. 3',5'-cyclic-AMP phosphodiesterase activity Source: MGI
    2. metal ion binding Source: UniProtKB-KW

    GO - Biological processi

    1. cAMP catabolic process Source: UniProtKB-UniPathway
    2. signal transduction Source: InterPro

    Keywords - Molecular functioni

    Hydrolase

    Keywords - Ligandi

    cAMP, Metal-binding

    Enzyme and pathway databases

    UniPathwayiUPA00762; UER00747.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A (EC:3.1.4.53)
    Alternative name(s):
    P2A
    Gene namesi
    Name:Pde7a
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 3

    Organism-specific databases

    MGIiMGI:1202402. Pde7a.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 456456High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7APRO_0000198834Add
    BLAST

    Proteomic databases

    PRIDEiP70453.

    PTM databases

    PhosphoSiteiP70453.

    Expressioni

    Tissue specificityi

    Widely expressed with highest levels in the skeletal muscle.

    Gene expression databases

    ArrayExpressiP70453.
    BgeeiP70453.
    CleanExiMM_PDE7A.
    GenevestigatoriP70453.

    Interactioni

    Subunit structurei

    Interacts with CBFA2T3.By similarity

    Protein-protein interaction databases

    BioGridi202081. 1 interaction.
    IntActiP70453. 1 interaction.

    Structurei

    3D structure databases

    ProteinModelPortaliP70453.
    SMRiP70453. Positions 113-430.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni161 – 425265CatalyticBy similarityAdd
    BLAST

    Domaini

    Composed of a C-terminal catalytic domain containing two putative divalent metal sites and an N-terminal regulatory domain.

    Sequence similaritiesi

    Phylogenomic databases

    eggNOGiNOG300643.
    GeneTreeiENSGT00730000110321.
    HOGENOMiHOG000220881.
    HOVERGENiHBG053543.
    KOiK01120.
    OMAiLCDRQTE.
    OrthoDBiEOG7M98G3.
    TreeFamiTF314638.

    Family and domain databases

    Gene3Di1.10.1300.10. 1 hit.
    InterProiIPR003607. HD/PDEase_dom.
    IPR023088. PDEase.
    IPR002073. PDEase_catalytic_dom.
    IPR023174. PDEase_CS.
    [Graphical view]
    PfamiPF00233. PDEase_I. 1 hit.
    [Graphical view]
    PRINTSiPR00387. PDIESTERASE1.
    SMARTiSM00471. HDc. 1 hit.
    [Graphical view]
    PROSITEiPS00126. PDEASE_I. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Note: Additional isoforms seem to exist.

    Isoform 1 (identifier: P70453-1) [UniParc]FASTAAdd to Basket

    Also known as: PDE7A2

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGITLIWCLA LVLIKWITSK RRGAISYDSS DQTALYIRML GDVRVRSRAG    50
    FETERRGSHP YIDFRIFHSQ SDIEASVSAR NIRRLLSFQR YLRSSRVFRG 100
    ATVCSSLDIL DEDYNGQAKC MLEKVGNWNF DIFLFDRLTN GNSLVSLTFH 150
    LFSLHGLIEY FHLDMVKLRR FLVMIQEDYH SQNPYHNAVH AADVTQAMHC 200
    YLKEPKLASS VTPWDILLSL IAAATHDLDH PGVNQPFLIK TNHYLATLYK 250
    NSSVLENHHW RSAVGLLRES GLFSHLPLES RQEMEAQIGA LILATDISRQ 300
    NEYLSLFRSH LDKGDLHLDD GRHRHLVLQM ALKCADICNP CRNWELSKQW 350
    SEKVTEEFFH QGDIEKKYHL GVSPLCDRQT ESIANIQIGF MTYLVEPLFT 400
    EWARFSDTRL SQTMLGHVGL NKASWKGLQR QQPSSEDANA AFELNSQLLT 450
    QENRLS 456
    Length:456
    Mass (Da):52,486
    Last modified:July 27, 2011 - v2
    Checksum:i0B84B62094BD9F6E
    GO
    Isoform 2 (identifier: P70453-2) [UniParc]FASTAAdd to Basket

    Also known as: PDE7A1

    The sequence of this isoform differs from the canonical sequence as follows:
         1-20: MGITLIWCLALVLIKWITSK → MEVCYQLPVLPLDRPVPQHVLSRRGAISFSSSSALFGCPHPRQLSQ

    Show »
    Length:482
    Mass (Da):55,289
    Checksum:iE8470DD85BFF7714
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti407 – 4071D → A in AAB08479. (PubMed:8943082)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 2020MGITL…WITSK → MEVCYQLPVLPLDRPVPQHV LSRRGAISFSSSSALFGCPH PRQLSQ in isoform 2. 1 PublicationVSP_004594Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U68171 mRNA. Translation: AAB08479.1.
    AY007702 mRNA. Translation: AAG16295.1.
    AK168957 mRNA. Translation: BAE40763.1.
    CCDSiCCDS38398.1. [P70453-1]
    CCDS50871.1. [P70453-2]
    RefSeqiNP_001116231.1. NM_001122759.2. [P70453-2]
    NP_032828.2. NM_008802.3. [P70453-1]
    UniGeneiMm.355614.

    Genome annotation databases

    EnsembliENSMUST00000091314; ENSMUSP00000088863; ENSMUSG00000069094. [P70453-1]
    ENSMUST00000099195; ENSMUSP00000096800; ENSMUSG00000069094. [P70453-2]
    GeneIDi18583.
    KEGGimmu:18583.
    UCSCiuc008ort.2. mouse. [P70453-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U68171 mRNA. Translation: AAB08479.1 .
    AY007702 mRNA. Translation: AAG16295.1 .
    AK168957 mRNA. Translation: BAE40763.1 .
    CCDSi CCDS38398.1. [P70453-1 ]
    CCDS50871.1. [P70453-2 ]
    RefSeqi NP_001116231.1. NM_001122759.2. [P70453-2 ]
    NP_032828.2. NM_008802.3. [P70453-1 ]
    UniGenei Mm.355614.

    3D structure databases

    ProteinModelPortali P70453.
    SMRi P70453. Positions 113-430.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 202081. 1 interaction.
    IntActi P70453. 1 interaction.

    Chemistry

    ChEMBLi CHEMBL2040702.

    PTM databases

    PhosphoSitei P70453.

    Proteomic databases

    PRIDEi P70453.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000091314 ; ENSMUSP00000088863 ; ENSMUSG00000069094 . [P70453-1 ]
    ENSMUST00000099195 ; ENSMUSP00000096800 ; ENSMUSG00000069094 . [P70453-2 ]
    GeneIDi 18583.
    KEGGi mmu:18583.
    UCSCi uc008ort.2. mouse. [P70453-1 ]

    Organism-specific databases

    CTDi 5150.
    MGIi MGI:1202402. Pde7a.

    Phylogenomic databases

    eggNOGi NOG300643.
    GeneTreei ENSGT00730000110321.
    HOGENOMi HOG000220881.
    HOVERGENi HBG053543.
    KOi K01120.
    OMAi LCDRQTE.
    OrthoDBi EOG7M98G3.
    TreeFami TF314638.

    Enzyme and pathway databases

    UniPathwayi UPA00762 ; UER00747 .

    Miscellaneous databases

    NextBioi 294452.
    PROi P70453.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P70453.
    Bgeei P70453.
    CleanExi MM_PDE7A.
    Genevestigatori P70453.

    Family and domain databases

    Gene3Di 1.10.1300.10. 1 hit.
    InterProi IPR003607. HD/PDEase_dom.
    IPR023088. PDEase.
    IPR002073. PDEase_catalytic_dom.
    IPR023174. PDEase_CS.
    [Graphical view ]
    Pfami PF00233. PDEase_I. 1 hit.
    [Graphical view ]
    PRINTSi PR00387. PDIESTERASE1.
    SMARTi SM00471. HDc. 1 hit.
    [Graphical view ]
    PROSITEi PS00126. PDEASE_I. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Identification and tissue-specific expression of PDE7 phosphodiesterase splice variants."
      Bloom T.J., Beavo J.A.
      Proc. Natl. Acad. Sci. U.S.A. 93:14188-14192(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Skeletal muscle.
    2. "Cloning, characterization, and tissue distribution of mouse phosphodiesterase 7A1."
      Wang P., Wu P., Egan R.W., Billah M.M.
      Biochem. Biophys. Res. Commun. 276:1271-1277(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
      Tissue: Brain and Testis.
    3. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
      Strain: C57BL/6J.
      Tissue: Amnion.

    Entry informationi

    Entry nameiPDE7A_MOUSE
    AccessioniPrimary (citable) accession number: P70453
    Secondary accession number(s): Q3TFY5, Q9ERB3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 15, 1998
    Last sequence update: July 27, 2011
    Last modified: October 1, 2014
    This is version 117 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3