Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P70453

- PDE7A_MOUSE

UniProt

P70453 - PDE7A_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A

Gene

Pde7a

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli

Functioni

Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes. May have a role in muscle signal transduction (By similarity).By similarity

Catalytic activityi

Adenosine 3',5'-cyclic phosphate + H2O = adenosine 5'-phosphate.

Cofactori

a divalent metal cationBy similarityNote: Binds 2 divalent metal cations per subunit. Site 1 may preferentially bind zinc ions, while site 2 has a preference for magnesium and/or manganese ions.By similarity

Enzyme regulationi

Insensitive to all selective PDE inhibitors.

Pathwayi

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei186 – 1861Proton donorBy similarity
Metal bindingi190 – 1901Divalent metal cation 1By similarity
Metal bindingi226 – 2261Divalent metal cation 1By similarity
Metal bindingi227 – 2271Divalent metal cation 1By similarity
Metal bindingi227 – 2271Divalent metal cation 2By similarity
Metal bindingi336 – 3361Divalent metal cation 1By similarity

GO - Molecular functioni

  1. 3',5'-cyclic-AMP phosphodiesterase activity Source: MGI
  2. metal ion binding Source: UniProtKB-KW

GO - Biological processi

  1. cAMP catabolic process Source: UniProtKB-UniPathway
  2. signal transduction Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Ligandi

cAMP, Metal-binding

Enzyme and pathway databases

ReactomeiREACT_242871. G alpha (s) signalling events.
UniPathwayiUPA00762; UER00747.

Names & Taxonomyi

Protein namesi
Recommended name:
High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A (EC:3.1.4.53)
Alternative name(s):
P2A
Gene namesi
Name:Pde7a
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 3

Organism-specific databases

MGIiMGI:1202402. Pde7a.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 456456High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7APRO_0000198834Add
BLAST

Proteomic databases

MaxQBiP70453.
PRIDEiP70453.

PTM databases

PhosphoSiteiP70453.

Expressioni

Tissue specificityi

Widely expressed with highest levels in the skeletal muscle.

Gene expression databases

BgeeiP70453.
CleanExiMM_PDE7A.
ExpressionAtlasiP70453. baseline and differential.
GenevestigatoriP70453.

Interactioni

Subunit structurei

Interacts with CBFA2T3.By similarity

Protein-protein interaction databases

BioGridi202081. 1 interaction.
IntActiP70453. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliP70453.
SMRiP70453. Positions 113-430.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni161 – 425265CatalyticBy similarityAdd
BLAST

Domaini

Composed of a C-terminal catalytic domain containing two putative divalent metal sites and an N-terminal regulatory domain.

Sequence similaritiesi

Phylogenomic databases

eggNOGiNOG300643.
GeneTreeiENSGT00760000118889.
HOGENOMiHOG000220881.
HOVERGENiHBG053543.
InParanoidiP70453.
KOiK18436.
OMAiLCDRQTE.
OrthoDBiEOG7M98G3.
TreeFamiTF314638.

Family and domain databases

Gene3Di1.10.1300.10. 1 hit.
InterProiIPR003607. HD/PDEase_dom.
IPR023088. PDEase.
IPR002073. PDEase_catalytic_dom.
IPR023174. PDEase_CS.
[Graphical view]
PfamiPF00233. PDEase_I. 1 hit.
[Graphical view]
PRINTSiPR00387. PDIESTERASE1.
SMARTiSM00471. HDc. 1 hit.
[Graphical view]
PROSITEiPS00126. PDEASE_I. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Note: Additional isoforms seem to exist.

Isoform 1 (identifier: P70453-1) [UniParc]FASTAAdd to Basket

Also known as: PDE7A2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGITLIWCLA LVLIKWITSK RRGAISYDSS DQTALYIRML GDVRVRSRAG
60 70 80 90 100
FETERRGSHP YIDFRIFHSQ SDIEASVSAR NIRRLLSFQR YLRSSRVFRG
110 120 130 140 150
ATVCSSLDIL DEDYNGQAKC MLEKVGNWNF DIFLFDRLTN GNSLVSLTFH
160 170 180 190 200
LFSLHGLIEY FHLDMVKLRR FLVMIQEDYH SQNPYHNAVH AADVTQAMHC
210 220 230 240 250
YLKEPKLASS VTPWDILLSL IAAATHDLDH PGVNQPFLIK TNHYLATLYK
260 270 280 290 300
NSSVLENHHW RSAVGLLRES GLFSHLPLES RQEMEAQIGA LILATDISRQ
310 320 330 340 350
NEYLSLFRSH LDKGDLHLDD GRHRHLVLQM ALKCADICNP CRNWELSKQW
360 370 380 390 400
SEKVTEEFFH QGDIEKKYHL GVSPLCDRQT ESIANIQIGF MTYLVEPLFT
410 420 430 440 450
EWARFSDTRL SQTMLGHVGL NKASWKGLQR QQPSSEDANA AFELNSQLLT

QENRLS
Length:456
Mass (Da):52,486
Last modified:July 27, 2011 - v2
Checksum:i0B84B62094BD9F6E
GO
Isoform 2 (identifier: P70453-2) [UniParc]FASTAAdd to Basket

Also known as: PDE7A1

The sequence of this isoform differs from the canonical sequence as follows:
     1-20: MGITLIWCLALVLIKWITSK → MEVCYQLPVLPLDRPVPQHVLSRRGAISFSSSSALFGCPHPRQLSQ

Show »
Length:482
Mass (Da):55,289
Checksum:iE8470DD85BFF7714
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti407 – 4071D → A in AAB08479. (PubMed:8943082)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 2020MGITL…WITSK → MEVCYQLPVLPLDRPVPQHV LSRRGAISFSSSSALFGCPH PRQLSQ in isoform 2. 1 PublicationVSP_004594Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U68171 mRNA. Translation: AAB08479.1.
AY007702 mRNA. Translation: AAG16295.1.
AK168957 mRNA. Translation: BAE40763.1.
CCDSiCCDS38398.1. [P70453-1]
CCDS50871.1. [P70453-2]
RefSeqiNP_001116231.1. NM_001122759.2. [P70453-2]
NP_032828.2. NM_008802.3. [P70453-1]
UniGeneiMm.355614.

Genome annotation databases

EnsembliENSMUST00000091314; ENSMUSP00000088863; ENSMUSG00000069094. [P70453-1]
ENSMUST00000099195; ENSMUSP00000096800; ENSMUSG00000069094. [P70453-2]
GeneIDi18583.
KEGGimmu:18583.
UCSCiuc008ort.2. mouse. [P70453-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U68171 mRNA. Translation: AAB08479.1 .
AY007702 mRNA. Translation: AAG16295.1 .
AK168957 mRNA. Translation: BAE40763.1 .
CCDSi CCDS38398.1. [P70453-1 ]
CCDS50871.1. [P70453-2 ]
RefSeqi NP_001116231.1. NM_001122759.2. [P70453-2 ]
NP_032828.2. NM_008802.3. [P70453-1 ]
UniGenei Mm.355614.

3D structure databases

ProteinModelPortali P70453.
SMRi P70453. Positions 113-430.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 202081. 1 interaction.
IntActi P70453. 1 interaction.

Chemistry

BindingDBi P70453.
ChEMBLi CHEMBL2040702.

PTM databases

PhosphoSitei P70453.

Proteomic databases

MaxQBi P70453.
PRIDEi P70453.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000091314 ; ENSMUSP00000088863 ; ENSMUSG00000069094 . [P70453-1 ]
ENSMUST00000099195 ; ENSMUSP00000096800 ; ENSMUSG00000069094 . [P70453-2 ]
GeneIDi 18583.
KEGGi mmu:18583.
UCSCi uc008ort.2. mouse. [P70453-1 ]

Organism-specific databases

CTDi 5150.
MGIi MGI:1202402. Pde7a.

Phylogenomic databases

eggNOGi NOG300643.
GeneTreei ENSGT00760000118889.
HOGENOMi HOG000220881.
HOVERGENi HBG053543.
InParanoidi P70453.
KOi K18436.
OMAi LCDRQTE.
OrthoDBi EOG7M98G3.
TreeFami TF314638.

Enzyme and pathway databases

UniPathwayi UPA00762 ; UER00747 .
Reactomei REACT_242871. G alpha (s) signalling events.

Miscellaneous databases

ChiTaRSi Pde7a. mouse.
NextBioi 294452.
PROi P70453.
SOURCEi Search...

Gene expression databases

Bgeei P70453.
CleanExi MM_PDE7A.
ExpressionAtlasi P70453. baseline and differential.
Genevestigatori P70453.

Family and domain databases

Gene3Di 1.10.1300.10. 1 hit.
InterProi IPR003607. HD/PDEase_dom.
IPR023088. PDEase.
IPR002073. PDEase_catalytic_dom.
IPR023174. PDEase_CS.
[Graphical view ]
Pfami PF00233. PDEase_I. 1 hit.
[Graphical view ]
PRINTSi PR00387. PDIESTERASE1.
SMARTi SM00471. HDc. 1 hit.
[Graphical view ]
PROSITEi PS00126. PDEASE_I. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification and tissue-specific expression of PDE7 phosphodiesterase splice variants."
    Bloom T.J., Beavo J.A.
    Proc. Natl. Acad. Sci. U.S.A. 93:14188-14192(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Skeletal muscle.
  2. "Cloning, characterization, and tissue distribution of mouse phosphodiesterase 7A1."
    Wang P., Wu P., Egan R.W., Billah M.M.
    Biochem. Biophys. Res. Commun. 276:1271-1277(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Tissue: Brain and Testis.
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
    Strain: C57BL/6J.
    Tissue: Amnion.

Entry informationi

Entry nameiPDE7A_MOUSE
AccessioniPrimary (citable) accession number: P70453
Secondary accession number(s): Q3TFY5, Q9ERB3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: July 27, 2011
Last modified: November 26, 2014
This is version 119 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3