Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A

Gene

Pde7a

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes. May have a role in muscle signal transduction (By similarity).By similarity

Catalytic activityi

Adenosine 3',5'-cyclic phosphate + H2O = adenosine 5'-phosphate.

Cofactori

a divalent metal cationBy similarityNote: Binds 2 divalent metal cations per subunit. Site 1 may preferentially bind zinc ions, while site 2 has a preference for magnesium and/or manganese ions.By similarity

Enzyme regulationi

Insensitive to all selective PDE inhibitors.

Pathwayi

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei186 – 1861Proton donorBy similarity
Metal bindingi190 – 1901Divalent metal cation 1By similarity
Metal bindingi226 – 2261Divalent metal cation 1By similarity
Metal bindingi227 – 2271Divalent metal cation 1By similarity
Metal bindingi227 – 2271Divalent metal cation 2By similarity
Metal bindingi336 – 3361Divalent metal cation 1By similarity

GO - Molecular functioni

  1. 3',5'-cyclic-AMP phosphodiesterase activity Source: MGI
  2. metal ion binding Source: UniProtKB-KW

GO - Biological processi

  1. cAMP catabolic process Source: UniProtKB-UniPathway
  2. signal transduction Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Ligandi

cAMP, Metal-binding

Enzyme and pathway databases

BRENDAi3.1.4.53. 3474.
ReactomeiREACT_313192. G alpha (s) signalling events.
UniPathwayiUPA00762; UER00747.

Names & Taxonomyi

Protein namesi
Recommended name:
High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A (EC:3.1.4.53)
Alternative name(s):
P2A
Gene namesi
Name:Pde7a
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589 Componenti: Chromosome 3

Organism-specific databases

MGIiMGI:1202402. Pde7a.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 456456High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7APRO_0000198834Add
BLAST

Proteomic databases

MaxQBiP70453.
PRIDEiP70453.

PTM databases

PhosphoSiteiP70453.

Expressioni

Tissue specificityi

Widely expressed with highest levels in the skeletal muscle.

Gene expression databases

BgeeiP70453.
CleanExiMM_PDE7A.
ExpressionAtlasiP70453. baseline and differential.
GenevestigatoriP70453.

Interactioni

Subunit structurei

Interacts with CBFA2T3.By similarity

Protein-protein interaction databases

BioGridi202081. 1 interaction.
IntActiP70453. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliP70453.
SMRiP70453. Positions 113-430.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni161 – 425265CatalyticBy similarityAdd
BLAST

Domaini

Composed of a C-terminal catalytic domain containing two putative divalent metal sites and an N-terminal regulatory domain.

Sequence similaritiesi

Phylogenomic databases

eggNOGiNOG300643.
GeneTreeiENSGT00760000118889.
HOGENOMiHOG000220881.
HOVERGENiHBG053543.
InParanoidiP70453.
KOiK18436.
OMAiLCDRQTE.
OrthoDBiEOG7M98G3.
TreeFamiTF314638.

Family and domain databases

Gene3Di1.10.1300.10. 1 hit.
InterProiIPR003607. HD/PDEase_dom.
IPR023088. PDEase.
IPR002073. PDEase_catalytic_dom.
IPR023174. PDEase_CS.
[Graphical view]
PfamiPF00233. PDEase_I. 1 hit.
[Graphical view]
PRINTSiPR00387. PDIESTERASE1.
SMARTiSM00471. HDc. 1 hit.
[Graphical view]
PROSITEiPS00126. PDEASE_I. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.

Isoform 1 (identifier: P70453-1) [UniParc]FASTAAdd to basket

Also known as: PDE7A2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGITLIWCLA LVLIKWITSK RRGAISYDSS DQTALYIRML GDVRVRSRAG
60 70 80 90 100
FETERRGSHP YIDFRIFHSQ SDIEASVSAR NIRRLLSFQR YLRSSRVFRG
110 120 130 140 150
ATVCSSLDIL DEDYNGQAKC MLEKVGNWNF DIFLFDRLTN GNSLVSLTFH
160 170 180 190 200
LFSLHGLIEY FHLDMVKLRR FLVMIQEDYH SQNPYHNAVH AADVTQAMHC
210 220 230 240 250
YLKEPKLASS VTPWDILLSL IAAATHDLDH PGVNQPFLIK TNHYLATLYK
260 270 280 290 300
NSSVLENHHW RSAVGLLRES GLFSHLPLES RQEMEAQIGA LILATDISRQ
310 320 330 340 350
NEYLSLFRSH LDKGDLHLDD GRHRHLVLQM ALKCADICNP CRNWELSKQW
360 370 380 390 400
SEKVTEEFFH QGDIEKKYHL GVSPLCDRQT ESIANIQIGF MTYLVEPLFT
410 420 430 440 450
EWARFSDTRL SQTMLGHVGL NKASWKGLQR QQPSSEDANA AFELNSQLLT

QENRLS
Length:456
Mass (Da):52,486
Last modified:July 27, 2011 - v2
Checksum:i0B84B62094BD9F6E
GO
Isoform 2 (identifier: P70453-2) [UniParc]FASTAAdd to basket

Also known as: PDE7A1

The sequence of this isoform differs from the canonical sequence as follows:
     1-20: MGITLIWCLALVLIKWITSK → MEVCYQLPVLPLDRPVPQHVLSRRGAISFSSSSALFGCPHPRQLSQ

Show »
Length:482
Mass (Da):55,289
Checksum:iE8470DD85BFF7714
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti407 – 4071D → A in AAB08479 (PubMed:8943082).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 2020MGITL…WITSK → MEVCYQLPVLPLDRPVPQHV LSRRGAISFSSSSALFGCPH PRQLSQ in isoform 2. 1 PublicationVSP_004594Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U68171 mRNA. Translation: AAB08479.1.
AY007702 mRNA. Translation: AAG16295.1.
AK168957 mRNA. Translation: BAE40763.1.
CCDSiCCDS38398.1. [P70453-1]
CCDS50871.1. [P70453-2]
RefSeqiNP_001116231.1. NM_001122759.2. [P70453-2]
NP_032828.2. NM_008802.3. [P70453-1]
UniGeneiMm.355614.

Genome annotation databases

EnsembliENSMUST00000091314; ENSMUSP00000088863; ENSMUSG00000069094. [P70453-1]
ENSMUST00000099195; ENSMUSP00000096800; ENSMUSG00000069094. [P70453-2]
GeneIDi18583.
KEGGimmu:18583.
UCSCiuc008ort.2. mouse. [P70453-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U68171 mRNA. Translation: AAB08479.1.
AY007702 mRNA. Translation: AAG16295.1.
AK168957 mRNA. Translation: BAE40763.1.
CCDSiCCDS38398.1. [P70453-1]
CCDS50871.1. [P70453-2]
RefSeqiNP_001116231.1. NM_001122759.2. [P70453-2]
NP_032828.2. NM_008802.3. [P70453-1]
UniGeneiMm.355614.

3D structure databases

ProteinModelPortaliP70453.
SMRiP70453. Positions 113-430.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi202081. 1 interaction.
IntActiP70453. 1 interaction.

Chemistry

BindingDBiP70453.
ChEMBLiCHEMBL2040702.

PTM databases

PhosphoSiteiP70453.

Proteomic databases

MaxQBiP70453.
PRIDEiP70453.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000091314; ENSMUSP00000088863; ENSMUSG00000069094. [P70453-1]
ENSMUST00000099195; ENSMUSP00000096800; ENSMUSG00000069094. [P70453-2]
GeneIDi18583.
KEGGimmu:18583.
UCSCiuc008ort.2. mouse. [P70453-1]

Organism-specific databases

CTDi5150.
MGIiMGI:1202402. Pde7a.

Phylogenomic databases

eggNOGiNOG300643.
GeneTreeiENSGT00760000118889.
HOGENOMiHOG000220881.
HOVERGENiHBG053543.
InParanoidiP70453.
KOiK18436.
OMAiLCDRQTE.
OrthoDBiEOG7M98G3.
TreeFamiTF314638.

Enzyme and pathway databases

UniPathwayiUPA00762; UER00747.
BRENDAi3.1.4.53. 3474.
ReactomeiREACT_313192. G alpha (s) signalling events.

Miscellaneous databases

ChiTaRSiPde7a. mouse.
NextBioi294452.
PROiP70453.
SOURCEiSearch...

Gene expression databases

BgeeiP70453.
CleanExiMM_PDE7A.
ExpressionAtlasiP70453. baseline and differential.
GenevestigatoriP70453.

Family and domain databases

Gene3Di1.10.1300.10. 1 hit.
InterProiIPR003607. HD/PDEase_dom.
IPR023088. PDEase.
IPR002073. PDEase_catalytic_dom.
IPR023174. PDEase_CS.
[Graphical view]
PfamiPF00233. PDEase_I. 1 hit.
[Graphical view]
PRINTSiPR00387. PDIESTERASE1.
SMARTiSM00471. HDc. 1 hit.
[Graphical view]
PROSITEiPS00126. PDEASE_I. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Identification and tissue-specific expression of PDE7 phosphodiesterase splice variants."
    Bloom T.J., Beavo J.A.
    Proc. Natl. Acad. Sci. U.S.A. 93:14188-14192(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Skeletal muscle.
  2. "Cloning, characterization, and tissue distribution of mouse phosphodiesterase 7A1."
    Wang P., Wu P., Egan R.W., Billah M.M.
    Biochem. Biophys. Res. Commun. 276:1271-1277(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Tissue: Brain and Testis.
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
    Strain: C57BL/6J.
    Tissue: Amnion.

Entry informationi

Entry nameiPDE7A_MOUSE
AccessioniPrimary (citable) accession number: P70453
Secondary accession number(s): Q3TFY5, Q9ERB3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: July 27, 2011
Last modified: April 1, 2015
This is version 121 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.