P70453 (PDE7A_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 105.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A EC=3.1.4.17 Alternative name(s): P2A | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 456 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes. May have a role in muscle signal transduction By similarity. |
| Catalytic activity | Adenosine 3',5'-cyclic phosphate + H2O = adenosine 5'-phosphate. |
| Cofactor | Binds 2 divalent metal cations per subunit. Site 1 may preferentially bind zinc ions, while site 2 has a preference for magnesium and/or manganese ions By similarity. |
| Enzyme regulation | Insensitive to all selective PDE inhibitors. |
| Pathway | Purine metabolism; 3',5'-cyclic AMP degradation; AMP from 3',5'-cyclic AMP: step 1/1. |
| Subunit structure | Interacts with CBFA2T3 By similarity. |
| Tissue specificity | Widely expressed with highest levels in the skeletal muscle. |
| Domain | Composed of a C-terminal catalytic domain containing two putative divalent metal sites and an N-terminal regulatory domain. |
| Sequence similarities | Belongs to the cyclic nucleotide phosphodiesterase family. PDE7 subfamily. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Ligand | Metal-binding cAMP |
| Molecular function | Hydrolase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cAMP catabolic process Inferred from electronic annotation. Source: UniProtKB-UniPathway signal transductionInferred from electronic annotation. Source: InterPro |
| Molecular_function | 3',5'-cyclic-AMP phosphodiesterase activity Inferred from sequence orthology Ref.1. Source: MGI metal ion bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: P70453-1) Also known as: PDE7A2; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P70453-2) Also known as: PDE7A1; The sequence of this isoform differs from the canonical sequence as follows: 1-20: MGITLIWCLALVLIKWITSK → MEVCYQLPVLPLDRPVPQHVLSRRGAISFSSSSALFGCPHPRQLSQ |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 456 | 456 | High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A | PRO_0000198834 | |||||
Regions | |||||||||
| Region | 161 – 425 | 265 | Catalytic By similarity | ||||||
Sites | |||||||||
| Active site | 186 | 1 | Proton donor By similarity | ||||||
| Metal binding | 190 | 1 | Divalent metal cation 1 By similarity | ||||||
| Metal binding | 226 | 1 | Divalent metal cation 1 By similarity | ||||||
| Metal binding | 227 | 1 | Divalent metal cation 1 By similarity | ||||||
| Metal binding | 227 | 1 | Divalent metal cation 2 By similarity | ||||||
| Metal binding | 336 | 1 | Divalent metal cation 1 By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 20 | 20 | MGITL…WITSK → MEVCYQLPVLPLDRPVPQHV LSRRGAISFSSSSALFGCPH PRQLSQ in isoform 2. | VSP_004594 | |||||
Experimental info | |||||||||
| Sequence conflict | 407 | 1 | D → A in AAB08479. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U68171 mRNA. Translation: AAB08479.1. AY007702 mRNA. Translation: AAG16295.1. AK168957 mRNA. Translation: BAE40763.1. |
| IPI | IPI00230552. IPI00762046. |
| RefSeq | NP_001116231.1. NM_001122759.1. NP_032828.2. NM_008802.2. |
| UniGene | Mm.355614. |
3D structure databases | |
| ProteinModelPortal | P70453. |
| SMR | P70453. Positions 113-430. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P70453. 1 interaction. |
PTM databases | |
| PhosphoSite | P70453. |
Proteomic databases | |
| PRIDE | P70453. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000091314; ENSMUSP00000088863; ENSMUSG00000069094. ENSMUST00000099195; ENSMUSP00000096800; ENSMUSG00000069094. |
| GeneID | 18583. |
| KEGG | mmu:18583. |
| UCSC | uc008ort.2. mouse. |
Organism-specific databases | |
| CTD | 5150. |
| MGI | MGI:1202402. Pde7a. |
Phylogenomic databases | |
| eggNOG | NOG300643. |
| GeneTree | ENSGT00690000101749. |
| HOGENOM | HOG000220881. |
| HOVERGEN | HBG053543. |
| KO | K01120. |
| OMA | SHMPLES. |
Enzyme and pathway databases | |
| UniPathway | UPA00762; UER00747. |
Gene expression databases | |
| ArrayExpress | P70453. |
| Bgee | P70453. |
| CleanEx | MM_PDE7A. |
| Genevestigator | P70453. |
| GermOnline | ENSMUSG00000069094. Mus musculus. |
Family and domain databases | |
| Gene3D | 1.10.1300.10. 1 hit. |
| InterPro | IPR003607. HD/PDEase_dom. IPR023088. PDEase. IPR002073. PDEase_catalytic_dom. IPR023174. PDEase_CS. [Graphical view] |
| Pfam | PF00233. PDEase_I. 1 hit. [Graphical view] |
| PRINTS | PR00387. PDIESTERASE1. |
| SMART | SM00471. HDc. 1 hit. [Graphical view] |
| PROSITE | PS00126. PDEASE_I. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 294452. |
| SOURCE | Search... |
Entry information
| Entry name | PDE7A_MOUSE | ||||||||
| Accession | Primary (citable) accession number: P70453 Secondary accession number(s): Q3TFY5, Q9ERB3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with
