Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A

Gene

Pde7a

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes. May have a role in muscle signal transduction (By similarity).By similarity

Catalytic activityi

Adenosine 3',5'-cyclic phosphate + H2O = adenosine 5'-phosphate.

Cofactori

a divalent metal cationBy similarityNote: Binds 2 divalent metal cations per subunit. Site 1 may preferentially bind zinc ions, while site 2 has a preference for magnesium and/or manganese ions.By similarity

Enzyme regulationi

Insensitive to all selective PDE inhibitors.

Pathwayi: 3',5'-cyclic AMP degradation

This protein is involved in step 1 of the subpathway that synthesizes AMP from 3',5'-cyclic AMP.
Proteins known to be involved in this subpathway in this organism are:
  1. cAMP-specific 3',5'-cyclic phosphodiesterase 4A (Pde4a), High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8B (Pde8b), cAMP-specific 3',5'-cyclic phosphodiesterase 4C (Pde4c), High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8A (Pde8a), High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A (Pde7a), cAMP-specific 3',5'-cyclic phosphodiesterase 4D (Pde4d), cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A (Pde10a), cAMP-specific 3',5'-cyclic phosphodiesterase 7B (Pde7b)
This subpathway is part of the pathway 3',5'-cyclic AMP degradation, which is itself part of Purine metabolism.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes AMP from 3',5'-cyclic AMP, the pathway 3',5'-cyclic AMP degradation and in Purine metabolism.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei186Proton donorBy similarity1
Metal bindingi190Divalent metal cation 1By similarity1
Metal bindingi226Divalent metal cation 1By similarity1
Metal bindingi227Divalent metal cation 1By similarity1
Metal bindingi227Divalent metal cation 2By similarity1
Metal bindingi336Divalent metal cation 1By similarity1

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Ligandi

cAMP, Metal-binding

Enzyme and pathway databases

BRENDAi3.1.4.53. 3474.
ReactomeiR-MMU-418555. G alpha (s) signalling events.
UniPathwayiUPA00762; UER00747.

Names & Taxonomyi

Protein namesi
Recommended name:
High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A (EC:3.1.4.53)
Alternative name(s):
P2A
Gene namesi
Name:Pde7a
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 3

Organism-specific databases

MGIiMGI:1202402. Pde7a.

Pathology & Biotechi

Chemistry databases

ChEMBLiCHEMBL2040702.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001988341 – 456High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7AAdd BLAST456

Proteomic databases

EPDiP70453.
MaxQBiP70453.
PaxDbiP70453.
PRIDEiP70453.

PTM databases

iPTMnetiP70453.
PhosphoSitePlusiP70453.

Expressioni

Tissue specificityi

Widely expressed with highest levels in the skeletal muscle.

Gene expression databases

BgeeiENSMUSG00000069094.
CleanExiMM_PDE7A.
ExpressionAtlasiP70453. baseline and differential.
GenevisibleiP70453. MM.

Interactioni

Subunit structurei

Interacts with CBFA2T3.By similarity

Protein-protein interaction databases

BioGridi202081. 1 interactor.
IntActiP70453. 1 interactor.
STRINGi10090.ENSMUSP00000096800.

Chemistry databases

BindingDBiP70453.

Structurei

3D structure databases

ProteinModelPortaliP70453.
SMRiP70453.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni161 – 425CatalyticBy similarityAdd BLAST265

Domaini

Composed of a C-terminal catalytic domain containing two putative divalent metal sites and an N-terminal regulatory domain.

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG3689. Eukaryota.
ENOG410XRI7. LUCA.
GeneTreeiENSGT00760000118889.
HOGENOMiHOG000220881.
HOVERGENiHBG053543.
InParanoidiP70453.
KOiK18436.
OMAiLCDRQTE.
TreeFamiTF314638.

Family and domain databases

Gene3Di1.10.1300.10. 1 hit.
InterProiIPR003607. HD/PDEase_dom.
IPR023088. PDEase.
IPR002073. PDEase_catalytic_dom.
IPR023174. PDEase_CS.
[Graphical view]
PfamiPF00233. PDEase_I. 1 hit.
[Graphical view]
PRINTSiPR00387. PDIESTERASE1.
SMARTiSM00471. HDc. 1 hit.
[Graphical view]
PROSITEiPS00126. PDEASE_I. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: P70453-1) [UniParc]FASTAAdd to basket
Also known as: PDE7A2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGITLIWCLA LVLIKWITSK RRGAISYDSS DQTALYIRML GDVRVRSRAG
60 70 80 90 100
FETERRGSHP YIDFRIFHSQ SDIEASVSAR NIRRLLSFQR YLRSSRVFRG
110 120 130 140 150
ATVCSSLDIL DEDYNGQAKC MLEKVGNWNF DIFLFDRLTN GNSLVSLTFH
160 170 180 190 200
LFSLHGLIEY FHLDMVKLRR FLVMIQEDYH SQNPYHNAVH AADVTQAMHC
210 220 230 240 250
YLKEPKLASS VTPWDILLSL IAAATHDLDH PGVNQPFLIK TNHYLATLYK
260 270 280 290 300
NSSVLENHHW RSAVGLLRES GLFSHLPLES RQEMEAQIGA LILATDISRQ
310 320 330 340 350
NEYLSLFRSH LDKGDLHLDD GRHRHLVLQM ALKCADICNP CRNWELSKQW
360 370 380 390 400
SEKVTEEFFH QGDIEKKYHL GVSPLCDRQT ESIANIQIGF MTYLVEPLFT
410 420 430 440 450
EWARFSDTRL SQTMLGHVGL NKASWKGLQR QQPSSEDANA AFELNSQLLT

QENRLS
Length:456
Mass (Da):52,486
Last modified:July 27, 2011 - v2
Checksum:i0B84B62094BD9F6E
GO
Isoform 2 (identifier: P70453-2) [UniParc]FASTAAdd to basket
Also known as: PDE7A1

The sequence of this isoform differs from the canonical sequence as follows:
     1-20: MGITLIWCLALVLIKWITSK → MEVCYQLPVLPLDRPVPQHVLSRRGAISFSSSSALFGCPHPRQLSQ

Show »
Length:482
Mass (Da):55,289
Checksum:iE8470DD85BFF7714
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti407D → A in AAB08479 (PubMed:8943082).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0045941 – 20MGITL…WITSK → MEVCYQLPVLPLDRPVPQHV LSRRGAISFSSSSALFGCPH PRQLSQ in isoform 2. 1 PublicationAdd BLAST20

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U68171 mRNA. Translation: AAB08479.1.
AY007702 mRNA. Translation: AAG16295.1.
AK168957 mRNA. Translation: BAE40763.1.
CCDSiCCDS38398.1. [P70453-1]
CCDS50871.1. [P70453-2]
RefSeqiNP_001116231.1. NM_001122759.2. [P70453-2]
NP_032828.2. NM_008802.3. [P70453-1]
UniGeneiMm.355614.

Genome annotation databases

EnsembliENSMUST00000091314; ENSMUSP00000088863; ENSMUSG00000069094. [P70453-1]
ENSMUST00000099195; ENSMUSP00000096800; ENSMUSG00000069094. [P70453-2]
GeneIDi18583.
KEGGimmu:18583.
UCSCiuc008ort.3. mouse. [P70453-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U68171 mRNA. Translation: AAB08479.1.
AY007702 mRNA. Translation: AAG16295.1.
AK168957 mRNA. Translation: BAE40763.1.
CCDSiCCDS38398.1. [P70453-1]
CCDS50871.1. [P70453-2]
RefSeqiNP_001116231.1. NM_001122759.2. [P70453-2]
NP_032828.2. NM_008802.3. [P70453-1]
UniGeneiMm.355614.

3D structure databases

ProteinModelPortaliP70453.
SMRiP70453.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi202081. 1 interactor.
IntActiP70453. 1 interactor.
STRINGi10090.ENSMUSP00000096800.

Chemistry databases

BindingDBiP70453.
ChEMBLiCHEMBL2040702.

PTM databases

iPTMnetiP70453.
PhosphoSitePlusiP70453.

Proteomic databases

EPDiP70453.
MaxQBiP70453.
PaxDbiP70453.
PRIDEiP70453.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000091314; ENSMUSP00000088863; ENSMUSG00000069094. [P70453-1]
ENSMUST00000099195; ENSMUSP00000096800; ENSMUSG00000069094. [P70453-2]
GeneIDi18583.
KEGGimmu:18583.
UCSCiuc008ort.3. mouse. [P70453-1]

Organism-specific databases

CTDi5150.
MGIiMGI:1202402. Pde7a.

Phylogenomic databases

eggNOGiKOG3689. Eukaryota.
ENOG410XRI7. LUCA.
GeneTreeiENSGT00760000118889.
HOGENOMiHOG000220881.
HOVERGENiHBG053543.
InParanoidiP70453.
KOiK18436.
OMAiLCDRQTE.
TreeFamiTF314638.

Enzyme and pathway databases

UniPathwayiUPA00762; UER00747.
BRENDAi3.1.4.53. 3474.
ReactomeiR-MMU-418555. G alpha (s) signalling events.

Miscellaneous databases

ChiTaRSiPde7a. mouse.
PROiP70453.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000069094.
CleanExiMM_PDE7A.
ExpressionAtlasiP70453. baseline and differential.
GenevisibleiP70453. MM.

Family and domain databases

Gene3Di1.10.1300.10. 1 hit.
InterProiIPR003607. HD/PDEase_dom.
IPR023088. PDEase.
IPR002073. PDEase_catalytic_dom.
IPR023174. PDEase_CS.
[Graphical view]
PfamiPF00233. PDEase_I. 1 hit.
[Graphical view]
PRINTSiPR00387. PDIESTERASE1.
SMARTiSM00471. HDc. 1 hit.
[Graphical view]
PROSITEiPS00126. PDEASE_I. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPDE7A_MOUSE
AccessioniPrimary (citable) accession number: P70453
Secondary accession number(s): Q3TFY5, Q9ERB3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: July 27, 2011
Last modified: November 2, 2016
This is version 134 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.