Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P70377

- FGF13_MOUSE

UniProt

P70377 - FGF13_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Fibroblast growth factor 13

Gene

Fgf13

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Microtubule-binding protein which directly binds tubulin and is involved in both polymerization and stabilization of microtubules. Through its action on microtubules, may participate to the refinement of axons by negatively regulating axonal and leading processes branching. Plays a crucial role in neuron polarization and migration in the cerebral cortex and the hippocampus.
Isoform 1 seems not to be involved in neuroblast polarization and migration but regulates axon branching.
May regulate voltage-gated sodium channels transport and function.
May also play a role in MAPK signaling.

GO - Molecular functioni

  1. beta-tubulin binding Source: UniProtKB
  2. ion channel binding Source: UniProtKB
  3. microtubule binding Source: UniProtKB
  4. protein kinase activator activity Source: Ensembl
  5. sodium channel regulator activity Source: UniProtKB

GO - Biological processi

  1. cerebral cortex cell migration Source: UniProtKB
  2. establishment of neuroblast polarity Source: UniProtKB
  3. hippocampus development Source: UniProtKB
  4. learning Source: UniProtKB
  5. MAPK cascade Source: Ensembl
  6. memory Source: UniProtKB
  7. microtubule polymerization Source: UniProtKB
  8. negative regulation of collateral sprouting Source: UniProtKB
  9. negative regulation of microtubule depolymerization Source: UniProtKB
  10. neuron migration Source: UniProtKB
  11. protein localization to plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Neurogenesis

Names & Taxonomyi

Protein namesi
Recommended name:
Fibroblast growth factor 13
Short name:
FGF-13
Alternative name(s):
Fibroblast growth factor homologous factor 2
Short name:
FHF-2
Gene namesi
Name:Fgf13
Synonyms:Fhf2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome X

Organism-specific databases

MGIiMGI:109178. Fgf13.

Subcellular locationi

Cell projectionfilopodium. Cell projectiongrowth cone. Cell projectiondendrite. Nucleus. Cytoplasm
Note: Not secreted. Localizes to the lateral membrane and intercalated disks of myocytes.

GO - Cellular componenti

  1. axon Source: UniProtKB
  2. cytoplasm Source: UniProtKB
  3. dendrite Source: UniProtKB
  4. extracellular region Source: InterPro
  5. filopodium Source: UniProtKB
  6. growth cone Source: UniProtKB
  7. intercalated disc Source: UniProtKB
  8. microtubule Source: UniProtKB
  9. neuron projection Source: UniProtKB
  10. nucleus Source: UniProtKB
  11. plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cytoplasm, Microtubule, Nucleus

Pathology & Biotechi

Disruption phenotypei

Conditional knockout mice lacking fgf13 in the cerebral cortex or mice lacking fgf13 in most tissues display similar phenotypes of impaired spatial acquisition and memory. The cued memory and the capacity of novel object recognition are altered. They also display anxiety-related and reduced depression-like behaviors. This is associated with a disorganization of cortical structure and neural circuits. The laminar formation of the neocortex is delayed and the hippocampal development is also affected.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 245245Fibroblast growth factor 13PRO_0000147608Add
BLAST

Post-translational modificationi

May be phosphorylated.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiP70377.
PRIDEiP70377.

PTM databases

PhosphoSiteiP70377.

Expressioni

Tissue specificityi

Detected in brain, eye and heart. In brain, the different isoforms display different patterns of expression. Expressed in brain and heart (at protein level). Isoform 3 is highly expressed in cardiac myocytes while isoform 1 is the most abundant in brain.3 Publications

Developmental stagei

Expressed in the subplate of the embryonic cortex and the axonal tracts in the intermediate zone, and in axonal tracts of projection neurons, specifically in the corticothalamic tract and the corpus callosum (at protein level). Isoform 2 is transiently expressed in the neocortex and hippocampus from E17 to P7 (at protein level). In embryonic brain, present in all divisions of the central and peripheral nervous system and it is at least 5 times more abundant than other FHFs. Detected in the subplate, ganglionic eminences, and proliferative zones of the cortical wall at E14. Detected in the cortical plate of the cerebral cortex, hippocampus, and striatum from E17 to P14. Expression is markedly reduced in adult brain where it is most abundant in hippocampus. Also detected in developing kidney.1 Publication

Gene expression databases

CleanExiMM_FGF13.
ExpressionAtlasiP70377. baseline and differential.
GenevestigatoriP70377.

Interactioni

Subunit structurei

Interacts with SCN8A; may regulate SCN8A activity (By similarity). Interacts with SCN1A; may regulate SCN1A activity (By similarity). Interacts with SCN5A; the interaction is direct and may regulate SNC5A density at membranes and function. Interacts with MAPK8IP2; may regulate the MAPK8IP2 scaffolding activity.By similarity2 Publications

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000033473.

Structurei

3D structure databases

ProteinModelPortaliP70377.
SMRiP70377. Positions 64-212.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 6262Mediates targeting to the nucleusAdd
BLAST
Regioni67 – 201135Mediates interaction with sodium channelsBy similarityAdd
BLAST
Regioni157 – 1648Tubulin-binding domain necessary and sufficient for tubulin-binding

Sequence similaritiesi

Phylogenomic databases

eggNOGiNOG308177.
GeneTreeiENSGT00760000118859.
HOGENOMiHOG000290676.
HOVERGENiHBG007580.
InParanoidiP70377.
KOiK04358.
OMAiKSNACRC.
OrthoDBiEOG7J447D.
TreeFamiTF317805.

Family and domain databases

InterProiIPR008996. Cytokine_IL1-like.
IPR028279. FGF13.
IPR002209. Fibroblast_GF_fam.
IPR028142. IL-1_fam/FGF_fam.
[Graphical view]
PANTHERiPTHR11486. PTHR11486. 1 hit.
PTHR11486:SF77. PTHR11486:SF77. 1 hit.
PRINTSiPR00263. HBGFFGF.
PR00262. IL1HBGF.
SMARTiSM00442. FGF. 1 hit.
[Graphical view]
SUPFAMiSSF50353. SSF50353. 1 hit.
PROSITEiPS00247. HBGF_FGF. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Note: Additional isoforms seem to exist.

Isoform 1 (identifier: P70377-1) [UniParc]FASTAAdd to Basket

Also known as: FGF13A, mFHF-2(1S), FGF13-S

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAAIASSLI RQKRQARERE KSNACKCVSS PSKGKTSCDK NKLNVFSRVK
60 70 80 90 100
LFGSKKRRRR RPEPQLKGIV TKLYSRQGYH LQLQADGTID GTKDEDSTYT
110 120 130 140 150
LFNLIPVGLR VVAIQGVQTK LYLAMNSEGY LYTSEHFTPE CKFKESVFEN
160 170 180 190 200
YYVTYSSMIY RQQQSGRGWY LGLNKEGEIM KGNHVKKNKP AAHFLPKPLK
210 220 230 240
VAMYKEPSLH DLTEFSRSGS GTPTKSRSVS GVLNGGKSMS HNEST
Length:245
Mass (Da):27,588
Last modified:October 3, 2012 - v2
Checksum:i5B96D41AC3A3DF78
GO
Isoform 2 (identifier: P70377-2) [UniParc]FASTAAdd to Basket

Also known as: FGF13B, mFHF-2(1U), FGF13-U

The sequence of this isoform differs from the canonical sequence as follows:
     1-62: MAAAIASSLIRQKRQAREREKSNACKCVSSPSKGKTSCDKNKLNVFSRVKLFGSKKRRRRRP → MALLRKSYS

Show »
Length:192
Mass (Da):21,605
Checksum:i7736A3671677B263
GO
Isoform 3 (identifier: P70377-3) [UniParc]FASTAAdd to Basket

Also known as: FGF13-VY, mFHF-2(1Y+1V)

The sequence of this isoform differs from the canonical sequence as follows:
     1-63: MAAAIASSLI...SKKRRRRRPE → MSGKVTKPKE...HHKENTEPEE

Show »
Length:255
Mass (Da):28,760
Checksum:iE0EAE1C9DFFBE0EA
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti2 – 21A → T in AAB18918. (PubMed:8790420)Curated
Sequence conflicti2 – 21Missing in AAB71606. (PubMed:9232594)Curated
Sequence conflicti199 – 1991L → Q in AAB71606. (PubMed:9232594)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6363MAAAI…RRRPE → MSGKVTKPKEEKDASKVLDD APPGTQEYIMLRQDSIQSAE LKKKESPFRAKCHEIFCCPP KQVHHKENTEPEE in isoform 3. 1 PublicationVSP_044130Add
BLAST
Alternative sequencei1 – 6262MAAAI…RRRRP → MALLRKSYS in isoform 2. 1 PublicationVSP_044131Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U66202 mRNA. Translation: AAB18918.1.
AF020737 mRNA. Translation: AAB71606.1.
AK141848 mRNA. Translation: BAE24857.1.
AL669891, AL672247, AL713968 Genomic DNA. Translation: CAM19176.1.
AL713968, AL672247 Genomic DNA. Translation: CAM22824.1.
AL713968, AL672247 Genomic DNA. Translation: CAM22825.1.
AL713968, AL669891, AL672247 Genomic DNA. Translation: CAM22827.1.
AL672247, AL713968 Genomic DNA. Translation: CAM27417.1.
AL672247, AL713968 Genomic DNA. Translation: CAM27418.1.
AL672247, AL669891, AL713968 Genomic DNA. Translation: CAM27420.1.
CH466583 Genomic DNA. Translation: EDL42180.1.
CH466583 Genomic DNA. Translation: EDL42182.1.
BC018238 mRNA. Translation: AAH18238.1.
AF199608 mRNA. Translation: AAF31395.1.
CCDSiCCDS30157.1. [P70377-1]
CCDS72383.1. [P70377-2]
RefSeqiNP_001277344.1. NM_001290415.1. [P70377-2]
NP_034330.2. NM_010200.3. [P70377-1]
UniGeneiMm.7995.

Genome annotation databases

EnsembliENSMUST00000033473; ENSMUSP00000033473; ENSMUSG00000031137. [P70377-1]
ENSMUST00000119306; ENSMUSP00000113206; ENSMUSG00000031137. [P70377-2]
GeneIDi14168.
KEGGimmu:14168.
UCSCiuc009tht.2. mouse.
uc009thu.2. mouse.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U66202 mRNA. Translation: AAB18918.1 .
AF020737 mRNA. Translation: AAB71606.1 .
AK141848 mRNA. Translation: BAE24857.1 .
AL669891 , AL672247 , AL713968 Genomic DNA. Translation: CAM19176.1 .
AL713968 , AL672247 Genomic DNA. Translation: CAM22824.1 .
AL713968 , AL672247 Genomic DNA. Translation: CAM22825.1 .
AL713968 , AL669891 , AL672247 Genomic DNA. Translation: CAM22827.1 .
AL672247 , AL713968 Genomic DNA. Translation: CAM27417.1 .
AL672247 , AL713968 Genomic DNA. Translation: CAM27418.1 .
AL672247 , AL669891 , AL713968 Genomic DNA. Translation: CAM27420.1 .
CH466583 Genomic DNA. Translation: EDL42180.1 .
CH466583 Genomic DNA. Translation: EDL42182.1 .
BC018238 mRNA. Translation: AAH18238.1 .
AF199608 mRNA. Translation: AAF31395.1 .
CCDSi CCDS30157.1. [P70377-1 ]
CCDS72383.1. [P70377-2 ]
RefSeqi NP_001277344.1. NM_001290415.1. [P70377-2 ]
NP_034330.2. NM_010200.3. [P70377-1 ]
UniGenei Mm.7995.

3D structure databases

ProteinModelPortali P70377.
SMRi P70377. Positions 64-212.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 10090.ENSMUSP00000033473.

PTM databases

PhosphoSitei P70377.

Proteomic databases

PaxDbi P70377.
PRIDEi P70377.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000033473 ; ENSMUSP00000033473 ; ENSMUSG00000031137 . [P70377-1 ]
ENSMUST00000119306 ; ENSMUSP00000113206 ; ENSMUSG00000031137 . [P70377-2 ]
GeneIDi 14168.
KEGGi mmu:14168.
UCSCi uc009tht.2. mouse.
uc009thu.2. mouse.

Organism-specific databases

CTDi 2258.
MGIi MGI:109178. Fgf13.

Phylogenomic databases

eggNOGi NOG308177.
GeneTreei ENSGT00760000118859.
HOGENOMi HOG000290676.
HOVERGENi HBG007580.
InParanoidi P70377.
KOi K04358.
OMAi KSNACRC.
OrthoDBi EOG7J447D.
TreeFami TF317805.

Miscellaneous databases

ChiTaRSi FGF13. mouse.
NextBioi 285320.
PROi P70377.
SOURCEi Search...

Gene expression databases

CleanExi MM_FGF13.
ExpressionAtlasi P70377. baseline and differential.
Genevestigatori P70377.

Family and domain databases

InterProi IPR008996. Cytokine_IL1-like.
IPR028279. FGF13.
IPR002209. Fibroblast_GF_fam.
IPR028142. IL-1_fam/FGF_fam.
[Graphical view ]
PANTHERi PTHR11486. PTHR11486. 1 hit.
PTHR11486:SF77. PTHR11486:SF77. 1 hit.
PRINTSi PR00263. HBGFFGF.
PR00262. IL1HBGF.
SMARTi SM00442. FGF. 1 hit.
[Graphical view ]
SUPFAMi SSF50353. SSF50353. 1 hit.
PROSITEi PS00247. HBGF_FGF. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Fibroblast growth factor (FGF) homologous factors: new members of the FGF family implicated in nervous system development."
    Smallwood P.M., Munoz-Sanjuan I., Tong P., Macke J.P., Hendry S.H., Gilbert D.J., Copeland N.G., Jenkins N.A., Nathans J.
    Proc. Natl. Acad. Sci. U.S.A. 93:9850-9857(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Eye.
  2. "Murine FGF-12 and FGF-13: expression in embryonic nervous system, connective tissue and heart."
    Hartung H., Feldman B., Lovec H., Coulier F., Birnbaum D., Goldfarb M.
    Mech. Dev. 64:31-39(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: C57BL/6J.
    Tissue: Spinal ganglion.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  5. Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
    Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Eye.
  7. "Isoform diversity among fibroblast growth factor homologous factors is generated by alternative promoter usage and differential splicing."
    Munoz-Sanjuan I., Smallwood P.M., Nathans J.
    J. Biol. Chem. 275:2589-2597(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-98 (ISOFORM 3), ALTERNATIVE SPLICING, TISSUE SPECIFICITY, SUBCELLULAR LOCATION.
  8. "Fibroblast growth factor homologous factors are intracellular signaling proteins."
    Schoorlemmer J., Goldfarb M.
    Curr. Biol. 11:793-797(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN MAPK SIGNALING, INTERACTION WITH MAPK8IP2.
  9. "Fibroblast growth factor homologous factors and the islet brain-2 scaffold protein regulate activation of a stress-activated protein kinase."
    Schoorlemmer J., Goldfarb M.
    J. Biol. Chem. 277:49111-49119(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN MAPK SIGNALING.
  10. "Fibroblast growth factor homologous factor 13 regulates Na+ channels and conduction velocity in murine hearts."
    Wang C., Hennessey J.A., Kirkton R.D., Wang C., Graham V., Puranam R.S., Rosenberg P.B., Bursac N., Pitt G.S.
    Circ. Res. 109:775-782(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN SODIUM CHANNEL REGULATION, TISSUE SPECIFICITY, INTERACTION WITH SCN5A, SUBCELLULAR LOCATION.
  11. "Fibroblast growth factor 13 is a microtubule-stabilizing protein regulating neuronal polarization and migration."
    Wu Q.F., Yang L., Li S., Wang Q., Yuan X.B., Gao X., Bao L., Zhang X.
    Cell 149:1549-1564(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN NEURON POLARIZATION, FUNCTION IN NEURON MIGRATION, DISRUPTION PHENOTYPE, SUBCELLULAR LOCATION, TUBULIN-BINDING.

Entry informationi

Entry nameiFGF13_MOUSE
AccessioniPrimary (citable) accession number: P70377
Secondary accession number(s): B1AU21
, O35338, Q3UR31, Q8VCY9, Q9JLA5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: October 3, 2012
Last modified: October 29, 2014
This is version 101 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3