Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Fibroblast growth factor 13

Gene

Fgf13

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Microtubule-binding protein which directly binds tubulin and is involved in both polymerization and stabilization of microtubules. Through its action on microtubules, may participate to the refinement of axons by negatively regulating axonal and leading processes branching. Plays a crucial role in neuron polarization and migration in the cerebral cortex and the hippocampus.
Isoform 1 seems not to be involved in neuroblast polarization and migration but regulates axon branching.
May regulate voltage-gated sodium channels transport and function.
May also play a role in MAPK signaling.

GO - Molecular functioni

  • beta-tubulin binding Source: UniProtKB
  • growth factor activity Source: InterPro
  • ion channel binding Source: UniProtKB
  • microtubule binding Source: UniProtKB
  • protein kinase activator activity Source: MGI
  • sodium channel regulator activity Source: UniProtKB

GO - Biological processi

  • cerebral cortex cell migration Source: UniProtKB
  • establishment of neuroblast polarity Source: UniProtKB
  • hippocampus development Source: UniProtKB
  • learning Source: UniProtKB
  • MAPK cascade Source: MGI
  • memory Source: UniProtKB
  • microtubule polymerization Source: UniProtKB
  • negative regulation of collateral sprouting Source: UniProtKB
  • negative regulation of microtubule depolymerization Source: UniProtKB
  • neuron migration Source: UniProtKB
  • protein localization to plasma membrane Source: UniProtKB
  • regulation of cardiac muscle cell action potential involved in regulation of contraction Source: BHF-UCL
  • response to odorant Source: Ensembl
  • sodium ion transport Source: BHF-UCL

Keywordsi

Biological processNeurogenesis

Enzyme and pathway databases

ReactomeiR-MMU-5576892 Phase 0 - rapid depolarisation

Names & Taxonomyi

Protein namesi
Recommended name:
Fibroblast growth factor 13
Short name:
FGF-13
Alternative name(s):
Fibroblast growth factor homologous factor 2
Short name:
FHF-2
Gene namesi
Name:Fgf13
Synonyms:Fhf2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome X

Organism-specific databases

MGIiMGI:109178 Fgf13

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cytoplasm, Microtubule, Nucleus

Pathology & Biotechi

Disruption phenotypei

Conditional knockout mice lacking fgf13 in the cerebral cortex or mice lacking fgf13 in most tissues display similar phenotypes of impaired spatial acquisition and memory. The cued memory and the capacity of novel object recognition are altered. They also display anxiety-related and reduced depression-like behaviors. This is associated with a disorganization of cortical structure and neural circuits. The laminar formation of the neocortex is delayed and the hippocampal development is also affected.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001476081 – 245Fibroblast growth factor 13Add BLAST245

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei208PhosphoserineCombined sources1

Post-translational modificationi

May be phosphorylated.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiP70377
PeptideAtlasiP70377
PRIDEiP70377
TopDownProteomicsiP70377-2 [P70377-2]

PTM databases

iPTMnetiP70377
PhosphoSitePlusiP70377

Expressioni

Tissue specificityi

Detected in brain, eye and heart. In brain, the different isoforms display different patterns of expression. Expressed in brain and heart (at protein level). Isoform 3 is highly expressed in cardiac myocytes while isoform 1 is the most abundant in brain.3 Publications

Developmental stagei

Expressed in the subplate of the embryonic cortex and the axonal tracts in the intermediate zone, and in axonal tracts of projection neurons, specifically in the corticothalamic tract and the corpus callosum (at protein level). Isoform 2 is transiently expressed in the neocortex and hippocampus from E17 to P7 (at protein level). In embryonic brain, present in all divisions of the central and peripheral nervous system and it is at least 5 times more abundant than other FHFs. Detected in the subplate, ganglionic eminences, and proliferative zones of the cortical wall at E14. Detected in the cortical plate of the cerebral cortex, hippocampus, and striatum from E17 to P14. Expression is markedly reduced in adult brain where it is most abundant in hippocampus. Also detected in developing kidney.1 Publication

Gene expression databases

BgeeiENSMUSG00000031137
CleanExiMM_FGF13
ExpressionAtlasiP70377 baseline and differential
GenevisibleiP70377 MM

Interactioni

Subunit structurei

Interacts with SCN8A; may regulate SCN8A activity (By similarity). Interacts with SCN1A; may regulate SCN1A activity (By similarity). Interacts with SCN5A; the interaction is direct and may regulate SNC5A density at membranes and function. Interacts with MAPK8IP2; may regulate the MAPK8IP2 scaffolding activity.By similarity2 Publications

GO - Molecular functioni

  • beta-tubulin binding Source: UniProtKB
  • growth factor activity Source: InterPro
  • ion channel binding Source: UniProtKB
  • microtubule binding Source: UniProtKB

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000033473

Structurei

3D structure databases

ProteinModelPortaliP70377
SMRiP70377
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 62Mediates targeting to the nucleusAdd BLAST62
Regioni67 – 201Mediates interaction with sodium channelsBy similarityAdd BLAST135
Regioni157 – 164Tubulin-binding domain necessary and sufficient for tubulin-binding8

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG3885 Eukaryota
ENOG4111IPH LUCA
GeneTreeiENSGT00760000118859
HOGENOMiHOG000290676
HOVERGENiHBG007580
InParanoidiP70377
KOiK22413
OMAiGVQSKLY
OrthoDBiEOG091G0NAY
TreeFamiTF317805

Family and domain databases

CDDicd00058 FGF, 1 hit
InterProiView protein in InterPro
IPR028279 FGF13
IPR002209 Fibroblast_GF_fam
IPR008996 IL1/FGF
PANTHERiPTHR11486 PTHR11486, 1 hit
PTHR11486:SF77 PTHR11486:SF77, 1 hit
PfamiView protein in Pfam
PF00167 FGF, 1 hit
PRINTSiPR00263 HBGFFGF
SMARTiView protein in SMART
SM00442 FGF, 1 hit
SUPFAMiSSF50353 SSF50353, 1 hit
PROSITEiView protein in PROSITE
PS00247 HBGF_FGF, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: P70377-1) [UniParc]FASTAAdd to basket
Also known as: FGF13A, mFHF-2(1S), FGF13-S

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAAIASSLI RQKRQARERE KSNACKCVSS PSKGKTSCDK NKLNVFSRVK
60 70 80 90 100
LFGSKKRRRR RPEPQLKGIV TKLYSRQGYH LQLQADGTID GTKDEDSTYT
110 120 130 140 150
LFNLIPVGLR VVAIQGVQTK LYLAMNSEGY LYTSEHFTPE CKFKESVFEN
160 170 180 190 200
YYVTYSSMIY RQQQSGRGWY LGLNKEGEIM KGNHVKKNKP AAHFLPKPLK
210 220 230 240
VAMYKEPSLH DLTEFSRSGS GTPTKSRSVS GVLNGGKSMS HNEST
Length:245
Mass (Da):27,588
Last modified:October 3, 2012 - v2
Checksum:i5B96D41AC3A3DF78
GO
Isoform 2 (identifier: P70377-2) [UniParc]FASTAAdd to basket
Also known as: FGF13B, mFHF-2(1U), FGF13-U

The sequence of this isoform differs from the canonical sequence as follows:
     1-62: MAAAIASSLIRQKRQAREREKSNACKCVSSPSKGKTSCDKNKLNVFSRVKLFGSKKRRRRRP → MALLRKSYS

Show »
Length:192
Mass (Da):21,605
Checksum:i7736A3671677B263
GO
Isoform 3 (identifier: P70377-3) [UniParc]FASTAAdd to basket
Also known as: FGF13-VY, mFHF-2(1Y+1V)

The sequence of this isoform differs from the canonical sequence as follows:
     1-63: MAAAIASSLI...SKKRRRRRPE → MSGKVTKPKE...HHKENTEPEE

Show »
Length:255
Mass (Da):28,760
Checksum:iE0EAE1C9DFFBE0EA
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti2A → T in AAB18918 (PubMed:8790420).Curated1
Sequence conflicti2Missing in AAB71606 (PubMed:9232594).Curated1
Sequence conflicti199L → Q in AAB71606 (PubMed:9232594).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0441301 – 63MAAAI…RRRPE → MSGKVTKPKEEKDASKVLDD APPGTQEYIMLRQDSIQSAE LKKKESPFRAKCHEIFCCPP KQVHHKENTEPEE in isoform 3. 1 PublicationAdd BLAST63
Alternative sequenceiVSP_0441311 – 62MAAAI…RRRRP → MALLRKSYS in isoform 2. 1 PublicationAdd BLAST62

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U66202 mRNA Translation: AAB18918.1
AF020737 mRNA Translation: AAB71606.1
AK141848 mRNA Translation: BAE24857.1
AL669891, AL672247, AL713968 Genomic DNA Translation: CAM19176.1
AL713968, AL672247 Genomic DNA Translation: CAM22824.1
AL713968, AL672247 Genomic DNA Translation: CAM22825.1
AL713968, AL669891, AL672247 Genomic DNA Translation: CAM22827.1
AL672247, AL713968 Genomic DNA Translation: CAM27417.1
AL672247, AL713968 Genomic DNA Translation: CAM27418.1
AL672247, AL669891, AL713968 Genomic DNA Translation: CAM27420.1
CH466583 Genomic DNA Translation: EDL42180.1
CH466583 Genomic DNA Translation: EDL42182.1
BC018238 mRNA Translation: AAH18238.1
AF199608 mRNA Translation: AAF31395.1
CCDSiCCDS30157.1 [P70377-1]
CCDS72383.1 [P70377-2]
RefSeqiNP_001277344.1, NM_001290415.1 [P70377-2]
NP_034330.2, NM_010200.3 [P70377-1]
UniGeneiMm.7995

Genome annotation databases

EnsembliENSMUST00000033473; ENSMUSP00000033473; ENSMUSG00000031137 [P70377-1]
ENSMUST00000119306; ENSMUSP00000113206; ENSMUSG00000031137 [P70377-2]
GeneIDi14168
KEGGimmu:14168
UCSCiuc009tht.3 mouse [P70377-1]
uc009thu.3 mouse [P70377-2]
uc009thv.2 mouse [P70377-3]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiFGF13_MOUSE
AccessioniPrimary (citable) accession number: P70377
Secondary accession number(s): B1AU21
, O35338, Q3UR31, Q8VCY9, Q9JLA5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: October 3, 2012
Last modified: March 28, 2018
This is version 125 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health