P70377 (FGF13_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 87.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Fibroblast growth factor 13 Short name=FGF-13 Alternative name(s): Fibroblast growth factor homologous factor 2 Short name=FHF-2 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 245 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Microtubule-binding protein which directly binds tubulin and is involved in both polymerization and stabilization of microtubules. Through its action on microtubules, may participate to the refinement of axons by negatively regulating axonal and leading processes branching. Plays a crucial role in neuron polarization and migration in the cerebral cortex and the hippocampus. Ref.8 Ref.9 Ref.10 Ref.11 Isoform 1 seems not to be involved in neuroblast polarization and migration but regulates axon branching. Ref.8 Ref.9 Ref.10 Ref.11 May regulate voltage-gated sodium channels transport and function. Ref.8 Ref.9 Ref.10 Ref.11 May also play a role in MAPK signaling. Ref.8 Ref.9 Ref.10 Ref.11 |
| Subunit structure | Interacts with SCN8A; may regulate SCN8A activity By similarity. Interacts with SCN1A; may regulate SCN1A activity By similarity. Interacts with SCN5A; the interaction is direct and may regulate SNC5A density at membranes and function. Interacts with MAPK8IP2; may regulate the MAPK8IP2 scaffolding activity. Ref.8 Ref.10 |
| Subcellular location | Cell projection › filopodium. Cell projection › growth cone. Cell projection › dendrite. Nucleus Ref.7 Ref.10 Ref.11. Cytoplasm Ref.7 Ref.10 Ref.11. Note: Not secreted. Localizes to the lateral membrane and intercalated disks of myocytes. Ref.7 Ref.10 Ref.11 |
| Tissue specificity | Detected in brain, eye and heart. In brain, the different isoforms display different patterns of expression. Expressed in brain and heart (at protein level). Isoform 3 is highly expressed in cardiac myocytes while isoform 1 is the most abundant in brain. Ref.2 Ref.7 Ref.10 |
| Developmental stage | Expressed in the subplate of the embryonic cortex and the axonal tracts in the intermediate zone, and in axonal tracts of projection neurons, specifically in the corticothalamic tract and the corpus callosum (at protein level). Isoform 2 is transiently expressed in the neocortex and hippocampus from E17 to P7 (at protein level). In embryonic brain, present in all divisions of the central and peripheral nervous system and it is at least 5 times more abundant than other FHFs. Detected in the subplate, ganglionic eminences, and proliferative zones of the cortical wall at E14. Detected in the cortical plate of the cerebral cortex, hippocampus, and striatum from E17 to P14. Expression is markedly reduced in adult brain where it is most abundant in hippocampus. Also detected in developing kidney. Ref.2 |
| Post-translational modification | May be phosphorylated By similarity. |
| Disruption phenotype | Conditional knockout mice lacking fgf13 in the cerebral cortex or mice lacking fgf13 in most tissues display similar phenotypes of impaired spatial acquisition and memory. The cued memory and the capacity of novel object recognition are altered. They also display anxiety-related and reduced depression-like behaviors. This is associated with a disorganization of cortical structure and neural circuits. The laminar formation of the neocortex is delayed and the hippocampal development is also affected. Ref.11 |
| Sequence similarities | Belongs to the heparin-binding growth factors family. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: P70377-1) Also known as: FGF13A; mFHF-2(1S); FGF13-S; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P70377-2) Also known as: FGF13B; mFHF-2(1U); FGF13-U; The sequence of this isoform differs from the canonical sequence as follows: 1-62: MAAAIASSLIRQKRQAREREKSNACKCVSSPSKGKTSCDKNKLNVFSRVKLFGSKKRRRRRP → MALLRKSYS | ||||||
| Isoform 3 (identifier: P70377-3) Also known as: FGF13-VY; mFHF-2(1Y+1V); The sequence of this isoform differs from the canonical sequence as follows: 1-63: MAAAIASSLI...SKKRRRRRPE → MSGKVTKPKE...HHKENTEPEE |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 245 | 245 | Fibroblast growth factor 13 | PRO_0000147608 | |||||
Regions | |||||||||
| Region | 1 – 62 | 62 | Mediates targeting to the nucleus | ||||||
| Region | 67 – 201 | 135 | Mediates interaction with sodium channels By similarity | ||||||
| Region | 157 – 164 | 8 | Tubulin-binding domain necessary and sufficient for tubulin-binding | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 63 | 63 | MAAAI…RRRPE → MSGKVTKPKEEKDASKVLDD APPGTQEYIMLRQDSIQSAE LKKKESPFRAKCHEIFCCPP KQVHHKENTEPEE in isoform 3. | VSP_044130 | |||||
| Alternative sequence | 1 – 62 | 62 | MAAAI…RRRRP → MALLRKSYS in isoform 2. | VSP_044131 | |||||
Experimental info | |||||||||
| Sequence conflict | 2 | 1 | A → T in AAB18918. Ref.1 | ||||||
| Sequence conflict | 2 | 1 | Missing in AAB71606. Ref.2 | ||||||
| Sequence conflict | 199 | 1 | L → Q in AAB71606. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Fibroblast growth factor (FGF) homologous factors: new members of the FGF family implicated in nervous system development." Smallwood P.M., Munoz-Sanjuan I., Tong P., Macke J.P., Hendry S.H., Gilbert D.J., Copeland N.G., Jenkins N.A., Nathans J. Proc. Natl. Acad. Sci. U.S.A. 93:9850-9857(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Eye. |
| [2] | "Murine FGF-12 and FGF-13: expression in embryonic nervous system, connective tissue and heart." Hartung H., Feldman B., Lovec H., Coulier F., Birnbaum D., Goldfarb M. Mech. Dev. 64:31-39(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE. |
| [3] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: C57BL/6J. Tissue: Spinal ganglion. |
| [4] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [5] | Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C. Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Eye. |
| [7] | "Isoform diversity among fibroblast growth factor homologous factors is generated by alternative promoter usage and differential splicing." Munoz-Sanjuan I., Smallwood P.M., Nathans J. J. Biol. Chem. 275:2589-2597(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-98 (ISOFORM 3), ALTERNATIVE SPLICING, TISSUE SPECIFICITY, SUBCELLULAR LOCATION. |
| [8] | "Fibroblast growth factor homologous factors are intracellular signaling proteins." Schoorlemmer J., Goldfarb M. Curr. Biol. 11:793-797(2001) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN MAPK SIGNALING, INTERACTION WITH MAPK8IP2. |
| [9] | "Fibroblast growth factor homologous factors and the islet brain-2 scaffold protein regulate activation of a stress-activated protein kinase." Schoorlemmer J., Goldfarb M. J. Biol. Chem. 277:49111-49119(2002) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN MAPK SIGNALING. |
| [10] | "Fibroblast growth factor homologous factor 13 regulates Na+ channels and conduction velocity in murine hearts." Wang C., Hennessey J.A., Kirkton R.D., Wang C., Graham V., Puranam R.S., Rosenberg P.B., Bursac N., Pitt G.S. Circ. Res. 109:775-782(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN SODIUM CHANNEL REGULATION, TISSUE SPECIFICITY, INTERACTION WITH SCN5A, SUBCELLULAR LOCATION. |
| [11] | "Fibroblast growth factor 13 is a microtubule-stabilizing protein regulating neuronal polarization and migration." Wu Q.F., Yang L., Li S., Wang Q., Yuan X.B., Gao X., Bao L., Zhang X. Cell 149:1549-1564(2012) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN NEURON POLARIZATION, FUNCTION IN NEURON MIGRATION, DISRUPTION PHENOTYPE, SUBCELLULAR LOCATION, TUBULIN-BINDING. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U66202 mRNA. Translation: AAB18918.1. AF020737 mRNA. Translation: AAB71606.1. AK141848 mRNA. Translation: BAE24857.1. AL669891, AL672247, AL713968 Genomic DNA. Translation: CAM19176.1. AL713968, AL672247 Genomic DNA. Translation: CAM22824.1. AL713968, AL672247 Genomic DNA. Translation: CAM22825.1. AL713968, AL669891, AL672247 Genomic DNA. Translation: CAM22827.1. AL672247, AL713968 Genomic DNA. Translation: CAM27417.1. AL672247, AL713968 Genomic DNA. Translation: CAM27418.1. AL672247, AL669891, AL713968 Genomic DNA. Translation: CAM27420.1. CH466583 Genomic DNA. Translation: EDL42180.1. CH466583 Genomic DNA. Translation: EDL42182.1. BC018238 mRNA. Translation: AAH18238.1. AF199608 mRNA. Translation: AAF31395.1. |
| IPI | IPI00108285. IPI00311361. IPI00405439. IPI00606472. |
| RefSeq | NP_034330.2. NM_010200.2. |
| UniGene | Mm.7995. |
3D structure databases | |
| ProteinModelPortal | P70377. |
| SMR | P70377. Positions 64-212. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 10090.ENSMUSP00000033473. |
PTM databases | |
| PhosphoSite | P70377. |
Proteomic databases | |
| PaxDb | P70377. |
| PRIDE | P70377. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000033473; ENSMUSP00000033473; ENSMUSG00000031137. ENSMUST00000119306; ENSMUSP00000113206; ENSMUSG00000031137. |
| GeneID | 14168. |
| KEGG | mmu:14168. |
| UCSC | uc009tht.2. mouse. uc009thu.2. mouse. |
Organism-specific databases | |
| CTD | 2258. |
| MGI | MGI:109178. Fgf13. |
Phylogenomic databases | |
| eggNOG | NOG308177. |
| GeneTree | ENSGT00700000104040. |
| HOGENOM | HOG000290676. |
| HOVERGEN | HBG007580. |
| InParanoid | P70377. |
| KO | K04358. |
| OrthoDB | EOG4VQ9Q2. |
Gene expression databases | |
| CleanEx | MM_FGF13. |
| Genevestigator | P70377. |
| GermOnline | ENSMUSG00000031137. Mus musculus. |
Family and domain databases | |
| InterPro | IPR008996. Cytokine_IL1-like. IPR002209. GF_heparin-bd. IPR002348. IL1_HBGF. [Graphical view] |
| PANTHER | PTHR11486. PTHR11486. 1 hit. |
| Pfam | PF00167. FGF. 1 hit. [Graphical view] |
| PRINTS | PR00263. HBGFFGF. PR00262. IL1HBGF. |
| SMART | SM00442. FGF. 1 hit. [Graphical view] |
| SUPFAM | SSF50353. Cytok_IL1_like. 1 hit. |
| PROSITE | PS00247. HBGF_FGF. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | FGF13. mouse. |
| NextBio | 285320. |
| SOURCE | Search... |
Entry information
| Entry name | FGF13_MOUSE | ||||||||
| Accession | Primary (citable) accession number: P70377 Secondary accession number(s): B1AU21 Q9JLA5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
