Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P70377

- FGF13_MOUSE

UniProt

P70377 - FGF13_MOUSE

Protein

Fibroblast growth factor 13

Gene

Fgf13

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 100 (01 Oct 2014)
      Sequence version 2 (03 Oct 2012)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Microtubule-binding protein which directly binds tubulin and is involved in both polymerization and stabilization of microtubules. Through its action on microtubules, may participate to the refinement of axons by negatively regulating axonal and leading processes branching. Plays a crucial role in neuron polarization and migration in the cerebral cortex and the hippocampus.
    Isoform 1 seems not to be involved in neuroblast polarization and migration but regulates axon branching.
    May regulate voltage-gated sodium channels transport and function.
    May also play a role in MAPK signaling.

    GO - Molecular functioni

    1. beta-tubulin binding Source: UniProtKB
    2. ion channel binding Source: UniProtKB
    3. microtubule binding Source: UniProtKB
    4. protein kinase activator activity Source: Ensembl
    5. sodium channel regulator activity Source: UniProtKB

    GO - Biological processi

    1. cerebral cortex cell migration Source: UniProtKB
    2. establishment of neuroblast polarity Source: UniProtKB
    3. hippocampus development Source: UniProtKB
    4. learning Source: UniProtKB
    5. MAPK cascade Source: Ensembl
    6. memory Source: UniProtKB
    7. microtubule polymerization Source: UniProtKB
    8. negative regulation of collateral sprouting Source: UniProtKB
    9. negative regulation of microtubule depolymerization Source: UniProtKB
    10. neuron migration Source: UniProtKB
    11. protein localization to plasma membrane Source: UniProtKB

    Keywords - Biological processi

    Neurogenesis

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Fibroblast growth factor 13
    Short name:
    FGF-13
    Alternative name(s):
    Fibroblast growth factor homologous factor 2
    Short name:
    FHF-2
    Gene namesi
    Name:Fgf13
    Synonyms:Fhf2
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome X

    Organism-specific databases

    MGIiMGI:109178. Fgf13.

    Subcellular locationi

    Cell projectionfilopodium. Cell projectiongrowth cone. Cell projectiondendrite. Nucleus. Cytoplasm
    Note: Not secreted. Localizes to the lateral membrane and intercalated disks of myocytes.

    GO - Cellular componenti

    1. axon Source: UniProtKB
    2. cytoplasm Source: UniProtKB
    3. dendrite Source: UniProtKB
    4. extracellular region Source: InterPro
    5. filopodium Source: UniProtKB
    6. growth cone Source: UniProtKB
    7. intercalated disc Source: UniProtKB
    8. microtubule Source: UniProtKB
    9. neuron projection Source: UniProtKB
    10. nucleus Source: UniProtKB
    11. plasma membrane Source: UniProtKB

    Keywords - Cellular componenti

    Cell projection, Cytoplasm, Microtubule, Nucleus

    Pathology & Biotechi

    Disruption phenotypei

    Conditional knockout mice lacking fgf13 in the cerebral cortex or mice lacking fgf13 in most tissues display similar phenotypes of impaired spatial acquisition and memory. The cued memory and the capacity of novel object recognition are altered. They also display anxiety-related and reduced depression-like behaviors. This is associated with a disorganization of cortical structure and neural circuits. The laminar formation of the neocortex is delayed and the hippocampal development is also affected.1 Publication

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 245245Fibroblast growth factor 13PRO_0000147608Add
    BLAST

    Post-translational modificationi

    May be phosphorylated.By similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    PaxDbiP70377.
    PRIDEiP70377.

    PTM databases

    PhosphoSiteiP70377.

    Expressioni

    Tissue specificityi

    Detected in brain, eye and heart. In brain, the different isoforms display different patterns of expression. Expressed in brain and heart (at protein level). Isoform 3 is highly expressed in cardiac myocytes while isoform 1 is the most abundant in brain.3 Publications

    Developmental stagei

    Expressed in the subplate of the embryonic cortex and the axonal tracts in the intermediate zone, and in axonal tracts of projection neurons, specifically in the corticothalamic tract and the corpus callosum (at protein level). Isoform 2 is transiently expressed in the neocortex and hippocampus from E17 to P7 (at protein level). In embryonic brain, present in all divisions of the central and peripheral nervous system and it is at least 5 times more abundant than other FHFs. Detected in the subplate, ganglionic eminences, and proliferative zones of the cortical wall at E14. Detected in the cortical plate of the cerebral cortex, hippocampus, and striatum from E17 to P14. Expression is markedly reduced in adult brain where it is most abundant in hippocampus. Also detected in developing kidney.1 Publication

    Gene expression databases

    ArrayExpressiP70377.
    CleanExiMM_FGF13.
    GenevestigatoriP70377.

    Interactioni

    Subunit structurei

    Interacts with SCN8A; may regulate SCN8A activity By similarity. Interacts with SCN1A; may regulate SCN1A activity By similarity. Interacts with SCN5A; the interaction is direct and may regulate SNC5A density at membranes and function. Interacts with MAPK8IP2; may regulate the MAPK8IP2 scaffolding activity.By similarity2 Publications

    Protein-protein interaction databases

    STRINGi10090.ENSMUSP00000033473.

    Structurei

    3D structure databases

    ProteinModelPortaliP70377.
    SMRiP70377. Positions 64-212.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni1 – 6262Mediates targeting to the nucleusAdd
    BLAST
    Regioni67 – 201135Mediates interaction with sodium channelsBy similarityAdd
    BLAST
    Regioni157 – 1648Tubulin-binding domain necessary and sufficient for tubulin-binding

    Sequence similaritiesi

    Phylogenomic databases

    eggNOGiNOG308177.
    GeneTreeiENSGT00730000110666.
    HOGENOMiHOG000290676.
    HOVERGENiHBG007580.
    InParanoidiP70377.
    KOiK04358.
    OMAiKSNACRC.
    OrthoDBiEOG7J447D.
    TreeFamiTF317805.

    Family and domain databases

    InterProiIPR008996. Cytokine_IL1-like.
    IPR028279. FGF13.
    IPR002209. Fibroblast_GF_fam.
    IPR028142. IL-1_fam/FGF_fam.
    [Graphical view]
    PANTHERiPTHR11486. PTHR11486. 1 hit.
    PTHR11486:SF77. PTHR11486:SF77. 1 hit.
    PfamiPF00167. FGF. 1 hit.
    [Graphical view]
    PRINTSiPR00263. HBGFFGF.
    PR00262. IL1HBGF.
    SMARTiSM00442. FGF. 1 hit.
    [Graphical view]
    SUPFAMiSSF50353. SSF50353. 1 hit.
    PROSITEiPS00247. HBGF_FGF. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Note: Additional isoforms seem to exist.

    Isoform 1 (identifier: P70377-1) [UniParc]FASTAAdd to Basket

    Also known as: FGF13A, mFHF-2(1S), FGF13-S

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAAAIASSLI RQKRQARERE KSNACKCVSS PSKGKTSCDK NKLNVFSRVK    50
    LFGSKKRRRR RPEPQLKGIV TKLYSRQGYH LQLQADGTID GTKDEDSTYT 100
    LFNLIPVGLR VVAIQGVQTK LYLAMNSEGY LYTSEHFTPE CKFKESVFEN 150
    YYVTYSSMIY RQQQSGRGWY LGLNKEGEIM KGNHVKKNKP AAHFLPKPLK 200
    VAMYKEPSLH DLTEFSRSGS GTPTKSRSVS GVLNGGKSMS HNEST 245
    Length:245
    Mass (Da):27,588
    Last modified:October 3, 2012 - v2
    Checksum:i5B96D41AC3A3DF78
    GO
    Isoform 2 (identifier: P70377-2) [UniParc]FASTAAdd to Basket

    Also known as: FGF13B, mFHF-2(1U), FGF13-U

    The sequence of this isoform differs from the canonical sequence as follows:
         1-62: MAAAIASSLIRQKRQAREREKSNACKCVSSPSKGKTSCDKNKLNVFSRVKLFGSKKRRRRRP → MALLRKSYS

    Show »
    Length:192
    Mass (Da):21,605
    Checksum:i7736A3671677B263
    GO
    Isoform 3 (identifier: P70377-3) [UniParc]FASTAAdd to Basket

    Also known as: FGF13-VY, mFHF-2(1Y+1V)

    The sequence of this isoform differs from the canonical sequence as follows:
         1-63: MAAAIASSLI...SKKRRRRRPE → MSGKVTKPKE...HHKENTEPEE

    Show »
    Length:255
    Mass (Da):28,760
    Checksum:iE0EAE1C9DFFBE0EA
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti2 – 21A → T in AAB18918. (PubMed:8790420)Curated
    Sequence conflicti2 – 21Missing in AAB71606. (PubMed:9232594)Curated
    Sequence conflicti199 – 1991L → Q in AAB71606. (PubMed:9232594)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 6363MAAAI…RRRPE → MSGKVTKPKEEKDASKVLDD APPGTQEYIMLRQDSIQSAE LKKKESPFRAKCHEIFCCPP KQVHHKENTEPEE in isoform 3. 1 PublicationVSP_044130Add
    BLAST
    Alternative sequencei1 – 6262MAAAI…RRRRP → MALLRKSYS in isoform 2. 1 PublicationVSP_044131Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U66202 mRNA. Translation: AAB18918.1.
    AF020737 mRNA. Translation: AAB71606.1.
    AK141848 mRNA. Translation: BAE24857.1.
    AL669891, AL672247, AL713968 Genomic DNA. Translation: CAM19176.1.
    AL713968, AL672247 Genomic DNA. Translation: CAM22824.1.
    AL713968, AL672247 Genomic DNA. Translation: CAM22825.1.
    AL713968, AL669891, AL672247 Genomic DNA. Translation: CAM22827.1.
    AL672247, AL713968 Genomic DNA. Translation: CAM27417.1.
    AL672247, AL713968 Genomic DNA. Translation: CAM27418.1.
    AL672247, AL669891, AL713968 Genomic DNA. Translation: CAM27420.1.
    CH466583 Genomic DNA. Translation: EDL42180.1.
    CH466583 Genomic DNA. Translation: EDL42182.1.
    BC018238 mRNA. Translation: AAH18238.1.
    AF199608 mRNA. Translation: AAF31395.1.
    CCDSiCCDS30157.1. [P70377-1]
    CCDS72383.1. [P70377-2]
    RefSeqiNP_001277344.1. NM_001290415.1. [P70377-2]
    NP_034330.2. NM_010200.3. [P70377-1]
    UniGeneiMm.7995.

    Genome annotation databases

    EnsembliENSMUST00000033473; ENSMUSP00000033473; ENSMUSG00000031137. [P70377-1]
    ENSMUST00000119306; ENSMUSP00000113206; ENSMUSG00000031137. [P70377-2]
    GeneIDi14168.
    KEGGimmu:14168.
    UCSCiuc009tht.2. mouse.
    uc009thu.2. mouse.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U66202 mRNA. Translation: AAB18918.1 .
    AF020737 mRNA. Translation: AAB71606.1 .
    AK141848 mRNA. Translation: BAE24857.1 .
    AL669891 , AL672247 , AL713968 Genomic DNA. Translation: CAM19176.1 .
    AL713968 , AL672247 Genomic DNA. Translation: CAM22824.1 .
    AL713968 , AL672247 Genomic DNA. Translation: CAM22825.1 .
    AL713968 , AL669891 , AL672247 Genomic DNA. Translation: CAM22827.1 .
    AL672247 , AL713968 Genomic DNA. Translation: CAM27417.1 .
    AL672247 , AL713968 Genomic DNA. Translation: CAM27418.1 .
    AL672247 , AL669891 , AL713968 Genomic DNA. Translation: CAM27420.1 .
    CH466583 Genomic DNA. Translation: EDL42180.1 .
    CH466583 Genomic DNA. Translation: EDL42182.1 .
    BC018238 mRNA. Translation: AAH18238.1 .
    AF199608 mRNA. Translation: AAF31395.1 .
    CCDSi CCDS30157.1. [P70377-1 ]
    CCDS72383.1. [P70377-2 ]
    RefSeqi NP_001277344.1. NM_001290415.1. [P70377-2 ]
    NP_034330.2. NM_010200.3. [P70377-1 ]
    UniGenei Mm.7995.

    3D structure databases

    ProteinModelPortali P70377.
    SMRi P70377. Positions 64-212.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 10090.ENSMUSP00000033473.

    PTM databases

    PhosphoSitei P70377.

    Proteomic databases

    PaxDbi P70377.
    PRIDEi P70377.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000033473 ; ENSMUSP00000033473 ; ENSMUSG00000031137 . [P70377-1 ]
    ENSMUST00000119306 ; ENSMUSP00000113206 ; ENSMUSG00000031137 . [P70377-2 ]
    GeneIDi 14168.
    KEGGi mmu:14168.
    UCSCi uc009tht.2. mouse.
    uc009thu.2. mouse.

    Organism-specific databases

    CTDi 2258.
    MGIi MGI:109178. Fgf13.

    Phylogenomic databases

    eggNOGi NOG308177.
    GeneTreei ENSGT00730000110666.
    HOGENOMi HOG000290676.
    HOVERGENi HBG007580.
    InParanoidi P70377.
    KOi K04358.
    OMAi KSNACRC.
    OrthoDBi EOG7J447D.
    TreeFami TF317805.

    Miscellaneous databases

    ChiTaRSi FGF13. mouse.
    NextBioi 285320.
    PROi P70377.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi P70377.
    CleanExi MM_FGF13.
    Genevestigatori P70377.

    Family and domain databases

    InterProi IPR008996. Cytokine_IL1-like.
    IPR028279. FGF13.
    IPR002209. Fibroblast_GF_fam.
    IPR028142. IL-1_fam/FGF_fam.
    [Graphical view ]
    PANTHERi PTHR11486. PTHR11486. 1 hit.
    PTHR11486:SF77. PTHR11486:SF77. 1 hit.
    Pfami PF00167. FGF. 1 hit.
    [Graphical view ]
    PRINTSi PR00263. HBGFFGF.
    PR00262. IL1HBGF.
    SMARTi SM00442. FGF. 1 hit.
    [Graphical view ]
    SUPFAMi SSF50353. SSF50353. 1 hit.
    PROSITEi PS00247. HBGF_FGF. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Fibroblast growth factor (FGF) homologous factors: new members of the FGF family implicated in nervous system development."
      Smallwood P.M., Munoz-Sanjuan I., Tong P., Macke J.P., Hendry S.H., Gilbert D.J., Copeland N.G., Jenkins N.A., Nathans J.
      Proc. Natl. Acad. Sci. U.S.A. 93:9850-9857(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Eye.
    2. "Murine FGF-12 and FGF-13: expression in embryonic nervous system, connective tissue and heart."
      Hartung H., Feldman B., Lovec H., Coulier F., Birnbaum D., Goldfarb M.
      Mech. Dev. 64:31-39(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
    3. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Strain: C57BL/6J.
      Tissue: Spinal ganglion.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    5. Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
      Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Eye.
    7. "Isoform diversity among fibroblast growth factor homologous factors is generated by alternative promoter usage and differential splicing."
      Munoz-Sanjuan I., Smallwood P.M., Nathans J.
      J. Biol. Chem. 275:2589-2597(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-98 (ISOFORM 3), ALTERNATIVE SPLICING, TISSUE SPECIFICITY, SUBCELLULAR LOCATION.
    8. "Fibroblast growth factor homologous factors are intracellular signaling proteins."
      Schoorlemmer J., Goldfarb M.
      Curr. Biol. 11:793-797(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION IN MAPK SIGNALING, INTERACTION WITH MAPK8IP2.
    9. "Fibroblast growth factor homologous factors and the islet brain-2 scaffold protein regulate activation of a stress-activated protein kinase."
      Schoorlemmer J., Goldfarb M.
      J. Biol. Chem. 277:49111-49119(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION IN MAPK SIGNALING.
    10. "Fibroblast growth factor homologous factor 13 regulates Na+ channels and conduction velocity in murine hearts."
      Wang C., Hennessey J.A., Kirkton R.D., Wang C., Graham V., Puranam R.S., Rosenberg P.B., Bursac N., Pitt G.S.
      Circ. Res. 109:775-782(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION IN SODIUM CHANNEL REGULATION, TISSUE SPECIFICITY, INTERACTION WITH SCN5A, SUBCELLULAR LOCATION.
    11. "Fibroblast growth factor 13 is a microtubule-stabilizing protein regulating neuronal polarization and migration."
      Wu Q.F., Yang L., Li S., Wang Q., Yuan X.B., Gao X., Bao L., Zhang X.
      Cell 149:1549-1564(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION IN NEURON POLARIZATION, FUNCTION IN NEURON MIGRATION, DISRUPTION PHENOTYPE, SUBCELLULAR LOCATION, TUBULIN-BINDING.

    Entry informationi

    Entry nameiFGF13_MOUSE
    AccessioniPrimary (citable) accession number: P70377
    Secondary accession number(s): B1AU21
    , O35338, Q3UR31, Q8VCY9, Q9JLA5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 1, 1997
    Last sequence update: October 3, 2012
    Last modified: October 1, 2014
    This is version 100 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3