P70365 (NCOA1_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 129.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Nuclear receptor coactivator 1 Short name=NCoA-1 EC=2.3.1.48 Alternative name(s): Nuclear receptor coactivator protein 1 Short name=mNRC-1 Steroid receptor coactivator 1 Short name=SRC-1 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 1447 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Nuclear receptor coactivator that directly binds nuclear receptors and stimulates the transcriptional activities in a hormone-dependent fashion. Involved in the coactivation of different nuclear receptors, such as for steroids (PGR, GR and ER), retinoids (RXRs), thyroid hormone (TRs) and prostanoids (PPARs). Also involved in coactivation mediated by STAT3, STAT5A, STAT5B and STAT6 transcription factors. Displays histone acetyltransferase activity toward H3 and H4; the relevance of such activity remains however unclear. Plays a central role in creating multisubunit coactivator complexes that act via remodeling of chromatin, and possibly acts by participating in both chromatin remodeling and recruitment of general transcription factors. Required with NCOA2 to control energy balance between white and brown adipose tissues. Required for mediating steroid hormone response. Isoform 2 has a higher thyroid hormone-dependent transactivation activity than isoform 1 and isoform 3. Ref.1 Ref.8 Ref.10 |
| Catalytic activity | Acetyl-CoA + [histone] = CoA + acetyl-[histone]. |
| Subunit structure | Interacts with NCOA6 and NCOA2. Interacts with the FDL motif of STAT5A and STAT5B. Interacts with the LXXLL motif of STAT6. Interacts with STAT3 following IL-6 stimulation. Interacts with the basal transcription factor GTF2B. Interacts with COPS5, NR3C1, PCAF and TTLL5/STAMP. Interacts with the histone acetyltransferases EP300 and CREBBP, and the methyltransferase CARM1. Interacts with PSMB9. Interacts with UBE2L3; they functionally interact to regulate progesterone receptor transcriptional activity. Interacts with PRMT2 and DDX5. Interacts with ASXL1 By similarity. Ref.1 Ref.3 Ref.9 |
| Subcellular location | |
| Tissue specificity | |
| Domain | The C-terminal (1113-1447) part mediates the histone acetyltransferase (HAT) activity By similarity. Contains 7 Leu-Xaa-Xaa-Leu-Leu (LXXLL) motifs. LXXLL motifs 3, 4 and 5 are essential for the association with nuclear receptors. LXXLL motif 7, which is not present in isoform 2, increases the affinity for steroid receptors in vitro. |
| Post-translational modification | Sumoylated; sumoylation increases its interaction with PGR and prolongs its retention in the nucleus. It does not prevent its ubiquitination and does not exert a clear effect on the stability of the protein By similarity. Ubiquitinated; leading to proteasome-mediated degradation. Ubiquitination and sumoylation take place at different sites By similarity. |
| Disruption phenotype | Mice show partial hormone resistance: target organs such as uterus, prostate, testis and mammary gland exhibiting decreased growth and development in response to steroid hormones. Moreover, such mice are prone to obesity due to reduced energy expenditure. Ref.8 |
| Sequence similarities | Belongs to the SRC/p160 nuclear receptor coactivator family. Contains 1 bHLH (basic helix-loop-helix) domain. Contains 1 PAS (PER-ARNT-SIM) domain. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P70365-1) Also known as: SRC-1A; SRC1a; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P70365-2) Also known as: SRC-1E; SRC1e; The sequence of this isoform differs from the canonical sequence as follows: 1392-1447: QVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTSGPQTPQAQQKSLLQQLLTE → DKKTEEFFSVVTTD | ||||||
| Isoform 3 (identifier: P70365-3) The sequence of this isoform differs from the canonical sequence as follows: 1392-1447: QVQQVQVFAD...KSLLQQLLTE → VSKKDNPSAELADSITLDTWRTSHGIC | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: P70365-4) The sequence of this isoform differs from the canonical sequence as follows: 1300-1376: NVFSQAVQSQ...LRHTGLYCNQ → KWKRKHSEHESNDGPDANELSADARDEYCVL 1377-1447: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1447 | 1447 | Nuclear receptor coactivator 1 | PRO_0000094401 | ||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||
| Domain | 23 – 80 | 58 | bHLH | |||||||||||||||||||||||||||
| Domain | 109 – 180 | 72 | PAS | |||||||||||||||||||||||||||
| Region | 361 – 568 | 208 | Interaction with STAT3 | |||||||||||||||||||||||||||
| Region | 787 – 994 | 208 | Interaction with CREBBP | |||||||||||||||||||||||||||
| Motif | 46 – 50 | 5 | LXXLL motif 1 | |||||||||||||||||||||||||||
| Motif | 112 – 116 | 5 | LXXLL motif 2 | |||||||||||||||||||||||||||
| Motif | 637 – 641 | 5 | LXXLL motif 3 | |||||||||||||||||||||||||||
| Motif | 694 – 698 | 5 | LXXLL motif 4 | |||||||||||||||||||||||||||
| Motif | 755 – 759 | 5 | LXXLL motif 5 | |||||||||||||||||||||||||||
| Motif | 919 – 923 | 5 | LXXLL motif 6 | |||||||||||||||||||||||||||
| Motif | 1441 – 1445 | 5 | LXXLL motif 7 | |||||||||||||||||||||||||||
| Compositional bias | 389 – 686 | 298 | Ser-rich | |||||||||||||||||||||||||||
| Compositional bias | 1059 – 1144 | 86 | Gln-rich | |||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||
| Modified residue | 22 | 1 | Phosphoserine Ref.11 | |||||||||||||||||||||||||||
| Modified residue | 372 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||
| Modified residue | 395 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||
| Modified residue | 518 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||
| Modified residue | 570 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||
| Modified residue | 1039 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||
| Modified residue | 1185 | 1 | Phosphothreonine By similarity | |||||||||||||||||||||||||||
| Modified residue | 1191 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||
| Cross-link | 738 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) By similarity | ||||||||||||||||||||||||||||
| Cross-link | 780 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) By similarity | ||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||
| Alternative sequence | 1300 – 1376 | 77 | NVFSQ…LYCNQ → KWKRKHSEHESNDGPDANEL SADARDEYCVL in isoform 4. | VSP_027855 | ||||||||||||||||||||||||||
| Alternative sequence | 1377 – 1447 | 71 | Missing in isoform 4. | VSP_027856 | ||||||||||||||||||||||||||
| Alternative sequence | 1392 – 1447 | 56 | QVQQV…QLLTE → DKKTEEFFSVVTTD in isoform 2. | VSP_011740 | ||||||||||||||||||||||||||
| Alternative sequence | 1392 – 1447 | 56 | QVQQV…QLLTE → VSKKDNPSAELADSITLDTW RTSHGIC in isoform 3. | VSP_011741 | ||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||
| Mutagenesis | 695 – 698 | 4 | HRLL → AAAA: Abolishes the interactions with estrogen and retinoid-acids receptors. Ref.7 | |||||||||||||||||||||||||||
| Mutagenesis | 756 – 759 | 4 | RYLL → AAAA: Abolishes the interactions with estrogen and retinoid-acids receptors. Ref.7 | |||||||||||||||||||||||||||
| Sequence conflict | 45 | 1 | E → G in AAB01228. Ref.1 | |||||||||||||||||||||||||||
| Sequence conflict | 223 | 1 | C → R in AAB06177. Ref.2 | |||||||||||||||||||||||||||
| Sequence conflict | 234 | 1 | E → G in AAB06177. Ref.2 | |||||||||||||||||||||||||||
| Sequence conflict | 237 | 1 | E → K in AAH80866. Ref.5 | |||||||||||||||||||||||||||
| Sequence conflict | 465 – 466 | 2 | SS → TT in AAB01228. Ref.1 | |||||||||||||||||||||||||||
| Sequence conflict | 699 | 1 | Q → P in AAB06177. Ref.2 | |||||||||||||||||||||||||||
| Sequence conflict | 1115 | 1 | L → M in BAC29244. Ref.4 | |||||||||||||||||||||||||||
| Sequence conflict | 1130 | 1 | R → K in AAB01228. Ref.1 | |||||||||||||||||||||||||||
| Sequence conflict | 1137 – 1138 | 2 | RA → KP in AAB01228. Ref.1 | |||||||||||||||||||||||||||
| Sequence conflict | 1142 | 1 | R → K in AAB01228. Ref.1 | |||||||||||||||||||||||||||
| Sequence conflict | 1162 | 1 | T → D in AAB01228. Ref.1 | |||||||||||||||||||||||||||
| Sequence conflict | 1164 | 1 | R → S in AAB06177. Ref.2 | |||||||||||||||||||||||||||
| Sequence conflict | 1166 | 1 | P → L in AAB01228. Ref.1 | |||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||
| Beta strand | 261 – 266 | 6 | ||||||||||||||||||||||||||||
| Beta strand | 272 – 276 | 5 | ||||||||||||||||||||||||||||
| Helix | 278 – 281 | 4 | ||||||||||||||||||||||||||||
| Helix | 288 – 299 | 12 | ||||||||||||||||||||||||||||
| Helix | 309 – 320 | 12 | ||||||||||||||||||||||||||||
| Beta strand | 321 – 324 | 4 | ||||||||||||||||||||||||||||
| Beta strand | 328 – 331 | 4 | ||||||||||||||||||||||||||||
| Beta strand | 337 – 347 | 11 | ||||||||||||||||||||||||||||
| Beta strand | 357 – 365 | 9 | ||||||||||||||||||||||||||||
| Turn | 687 – 690 | 4 | ||||||||||||||||||||||||||||
| Helix | 693 – 699 | 7 | ||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A CBP integrator complex mediates transcriptional activation and AP-1 inhibition by nuclear receptors." Kamei Y., Xu L., Heinzel T., Torchia J., Kurokawa R., Gloss B., Lin S.-C., Heyman R.A., Rose D.W., Glass C.K., Rosenfeld M.G. Cell 85:403-414(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, INTERACTION WITH EP300 AND CREBBP. |
| [2] | "Cloning and identification of mouse steroid receptor coactivator-1 (mSRC-1), as a coactivator of peroxisome proliferator-activated receptor gamma." Zhu Y., Qi C., Calandra C., Rao M.S., Reddy J.K. Gene Expr. 6:185-195(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "The nuclear hormone receptor coactivator SRC-1 is a specific target of p300." Yao T.-P., Ku G., Zhou N., Scully R., Livingston D.M. Proc. Natl. Acad. Sci. U.S.A. 93:10626-10631(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INTERACTION WITH EP300 AND RAR. |
| [4] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Strain: C57BL/6J. Tissue: Cerebellum. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4). Strain: C57BL/6. Tissue: Brain and Eye. |
| [6] | Lubec G., Sunyer B., Chen W.-Q. Submitted (JAN-2009) to UniProtKB Cited for: PROTEIN SEQUENCE OF 21-33, MASS SPECTROMETRY. Strain: OF1. Tissue: Hippocampus. |
| [7] | "The transcriptional co-activator p/CIP binds CBP and mediates nuclear-receptor function." Torchia J., Rose D.W., Inostroza J., Kamei Y., Westin S., Glass C.K., Rosenfeld M.G. Nature 387:677-684(1997) [PubMed] [Europe PMC] [Abstract] Cited for: ROLE OF LXXLL MOTIFS, TISSUE SPECIFICITY, MUTAGENESIS OF 695-HIS--LEU-698 AND 756-ARG--LEU-759. |
| [8] | "Partial hormone resistance in mice with disruption of the steroid receptor coactivator-1 (SRC-1) gene." Xu J., Qiu Y., DeMayo F.J., Tsai S.Y., Tsai M.-J., O'Malley B.W. Science 279:1922-1925(1998) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, DISRUPTION PHENOTYPE. |
| [9] | "Regulation of transcription by a protein methyltransferase." Chen D., Ma H., Hong H., Koh S.S., Huang S.-M., Schurter B.T., Aswad D.W., Stallcup M.R. Science 284:2174-2177(1999) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CARM1. |
| [10] | "SRC-1 and TIF2 control energy balance between white and brown adipose tissues." Picard F., Gehin M., Annicotte J.-S., Rocchi S., Champy M.-F., O'Malley B.W., Chambon P., Auwerx J. Cell 111:931-941(2002) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [11] | "The phagosomal proteome in interferon-gamma-activated macrophages." Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P. Immunity 30:143-154(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-22, MASS SPECTROMETRY. Tissue: Macrophage. |
| [12] | "Structure of the NCoA-1/SRC-1 PAS-B domain bound to the LXXLL motif of the STAT6 transactivation domain." Razeto A., Ramakrishnan V., Litterst C.M., Giller K., Griesinger C., Carlomagno T., Lakomek N., Heimburg T., Lodrini M., Pfitzner E., Becker S. J. Mol. Biol. 336:319-329(2004) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS) OF 257-385 IN COMPLEX WITH STAT6. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U56920 mRNA. Translation: AAB01228.1. U64606 mRNA. Translation: AAB06177.1. U64828 mRNA. Translation: AAB38841.1. AK035922 mRNA. Translation: BAC29244.1. BC068177 mRNA. Translation: AAH68177.1. BC080866 mRNA. Translation: AAH80866.1. | ||||||||||||||||||||||||
| IPI | IPI00117839. IPI00471393. IPI00471395. IPI00857158. | ||||||||||||||||||||||||
| RefSeq | NP_035011.1. NM_010881.2. | ||||||||||||||||||||||||
| UniGene | Mm.301039. | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| ProteinModelPortal | P70365. | ||||||||||||||||||||||||
| SMR | P70365. Positions 29-367, 926-980. | ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||
| PhosphoSite | P70365. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PaxDb | P70365. | ||||||||||||||||||||||||
| PRIDE | P70365. | ||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENSMUST00000085814; ENSMUSP00000082971; ENSMUSG00000020647. | ||||||||||||||||||||||||
| GeneID | 17977. | ||||||||||||||||||||||||
| KEGG | mmu:17977. | ||||||||||||||||||||||||
| UCSC | uc007mxr.2. mouse. uc007mxs.2. mouse. uc007mxu.1. mouse. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 8648. | ||||||||||||||||||||||||
| MGI | MGI:1276523. Ncoa1. | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| eggNOG | NOG315556. | ||||||||||||||||||||||||
| GeneTree | ENSGT00530000063109. | ||||||||||||||||||||||||
| HOGENOM | HOG000230947. | ||||||||||||||||||||||||
| HOVERGEN | HBG052583. | ||||||||||||||||||||||||
| InParanoid | P70365. | ||||||||||||||||||||||||
| KO | K09101. | ||||||||||||||||||||||||
| OMA | QITPQPP. | ||||||||||||||||||||||||
| OrthoDB | EOG40K7Z6. | ||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||
| Reactome | REACT_127416. Developmental Biology. REACT_27166. Transcriptional Regulation of Adipocyte Differentiation in 3T3-L1 Pre-adipocytes. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| Bgee | P70365. | ||||||||||||||||||||||||
| CleanEx | MM_NCOA1. | ||||||||||||||||||||||||
| Genevestigator | P70365. | ||||||||||||||||||||||||
| GermOnline | ENSMUSG00000020647. Mus musculus. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| Gene3D | 4.10.280.10. 1 hit. 4.10.630.10. 2 hits. | ||||||||||||||||||||||||
| InterPro | IPR011598. bHLH_dom. IPR010011. DUF1518. IPR009110. Nuc_rcpt_coact. IPR014920. Nuc_rcpt_coact_Ncoa-typ. IPR017426. Nuclear_rcpt_coactivator. IPR000014. PAS. IPR013767. PAS_fold. IPR014935. SRC-1. IPR008955. Src1_rcpt_coact. [Graphical view] | ||||||||||||||||||||||||
| Pfam | PF07469. DUF1518. 2 hits. PF08815. Nuc_rec_co-act. 1 hit. PF00989. PAS. 1 hit. PF08832. SRC-1. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| PIRSF | PIRSF038181. Nuclear_receptor_coactivator. 1 hit. | ||||||||||||||||||||||||
| SMART | SM00353. HLH. 1 hit. SM00091. PAS. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| SUPFAM | SSF47459. HLH_basic. 1 hit. SSF69125. Nuc_recept_coact. 1 hit. | ||||||||||||||||||||||||
| PROSITE | PS50888. BHLH. 1 hit. PS50112. PAS. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other | |||||||||||||||||||||||||
| ChiTaRS | NCOA1. mouse. | ||||||||||||||||||||||||
| EvolutionaryTrace | P70365. | ||||||||||||||||||||||||
| NextBio | 292937. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | NCOA1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: P70365 Secondary accession number(s): P70366 Q8CBI9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
