Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Bcl-2-like protein 2

Gene

Bcl2l2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Promotes cell survival. Blocks dexamethasone-induced apoptosis. Mediates survival of postmitotic Sertoli cells by suppressing death-promoting activity of BAX.3 Publications

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Apoptosis

Names & Taxonomyi

Protein namesi
Recommended name:
Bcl-2-like protein 2
Short name:
Bcl2-L-2
Alternative name(s):
Apoptosis regulator Bcl-W
c98
Gene namesi
Name:Bcl2l2
Synonyms:Bclw, Kiaa0271
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 14

Organism-specific databases

MGIiMGI:108052. Bcl2l2.

Subcellular locationi

GO - Cellular componenti

  • cytosol Source: MGI
  • extracellular exosome Source: MGI
  • mitochondrial membrane Source: MGI
  • mitochondrial outer membrane Source: GO_Central
Complete GO annotation...

Keywords - Cellular componenti

Membrane, Mitochondrion

Pathology & Biotechi

Disruption phenotypei

Mice are sterile due to arrest in spermatogenesis associated with a gradual loss of germ and Sertoli cells from the testis.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00001430672 – 193Bcl-2-like protein 2Add BLAST192

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineBy similarity1

Keywords - PTMi

Acetylation

Proteomic databases

MaxQBiP70345.
PaxDbiP70345.
PeptideAtlasiP70345.
PRIDEiP70345.

PTM databases

PhosphoSitePlusiP70345.

Expressioni

Tissue specificityi

Expressed in almost all myeloid cell lines and in a wide range of tissues, with highest levels in brain, colon, and salivary gland.

Developmental stagei

Expressed in both mitotic and postmitotic Sertoli cells.1 Publication

Inductioni

By Igf1.1 Publication

Gene expression databases

BgeeiENSMUSG00000089682.
CleanExiMM_BCL2L2.
ExpressionAtlasiP70345. baseline and differential.
GenevisibleiP70345. MM.

Interactioni

Subunit structurei

Interacts with HIF3A isoform 2 (via C-terminus domain) (PubMed:21546903). Interacts with BOP (By similarity).By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

BioGridi198325. 2 interactors.
MINTiMINT-209688.
STRINGi10090.ENSMUSP00000022806.

Structurei

3D structure databases

ProteinModelPortaliP70345.
SMRiP70345.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi9 – 29BH4Add BLAST21
Motifi85 – 104BH1Add BLAST20
Motifi136 – 151BH2Add BLAST16

Domaini

The BH4 motif seems to be involved in the anti-apoptotic function.
The BH1 and BH2 motifs form a hydrophobic groove which acts as a docking site for the BH3 domain of some pro-apoptotic proteins. The C-terminal residues of BCL2L2 fold into the BH3-binding cleft and modulate pro-survival activity by regulating ligand access. When BH3 domain-containing proteins bind, they displace the C-terminus, allowing its insertion into the membrane and neutralizing the pro-survival activity of BCL2L2 (By similarity).By similarity

Sequence similaritiesi

Belongs to the Bcl-2 family.Curated

Phylogenomic databases

eggNOGiKOG4209. Eukaryota.
ENOG4111PFV. LUCA.
GeneTreeiENSGT00530000062935.
HOGENOMiHOG000056452.
InParanoidiP70345.
KOiK02163.
OMAiVQDWMVT.
OrthoDBiEOG091G0PAK.
PhylomeDBiP70345.
TreeFamiTF315834.

Family and domain databases

InterProiIPR013280. Apop_reg_BclW.
IPR002475. Bcl2-like.
IPR020717. Bcl2_BH1_motif_CS.
IPR020726. Bcl2_BH2_motif_CS.
IPR003093. Bcl2_BH4.
IPR020731. Bcl2_BH4_motif_CS.
IPR026298. Blc2_fam.
[Graphical view]
PANTHERiPTHR11256. PTHR11256. 1 hit.
PTHR11256:SF13. PTHR11256:SF13. 1 hit.
PfamiPF00452. Bcl-2. 1 hit.
PF02180. BH4. 1 hit.
[Graphical view]
PRINTSiPR01865. APOPREGBCLW.
PR01862. BCL2FAMILY.
SMARTiSM00265. BH4. 1 hit.
[Graphical view]
PROSITEiPS50062. BCL2_FAMILY. 1 hit.
PS01080. BH1. 1 hit.
PS01258. BH2. 1 hit.
PS01260. BH4_1. 1 hit.
PS50063. BH4_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P70345-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MATPASTPDT RALVADFVGY KLRQKGYVCG AGPGEGPAAD PLHQAMRAAG
60 70 80 90 100
DEFETRFRRT FSDLAAQLHV TPGSAQQRFT QVSDELFQGG PNWGRLVAFF
110 120 130 140 150
VFGAALCAES VNKEMEPLVG QVQDWMVAYL ETRLADWIHS SGGWAEFTAL
160 170 180 190
YGDGALEEAR RLREGNWASV RTVLTGAVAL GALVTVGAFF ASK
Length:193
Mass (Da):20,790
Last modified:February 1, 1997 - v1
Checksum:i36CA185F5945DFB4
GO
Isoform 2 (identifier: P70345-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     145-193: AEFTALYGDG...VTVGAFFASK → VRSSQLLLSASLYKVGLHGKIGPLMGGWGCAGKG

Show »
Length:178
Mass (Da):19,119
Checksum:iE2C3F3F79528E9D7
GO

Sequence cautioni

The sequence BAD32203 differs from that shown. Reason: Frameshift at position 191.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti16D → Y in AAO13177 (PubMed:14746907).Curated1
Sequence conflicti21K → Q in AAO13177 (PubMed:14746907).Curated1
Sequence conflicti53 – 54FE → LQ in AAO13177 (PubMed:14746907).Curated2
Sequence conflicti63D → H in AAO13177 (PubMed:14746907).Curated1
Sequence conflicti114E → H in AAO13177 (PubMed:14746907).Curated1
Sequence conflicti136D → Y in AAO13177 (PubMed:14746907).Curated1
Sequence conflicti192S → Y in AAO13177 (PubMed:14746907).Curated1
Isoform 2 (identifier: P70345-2)
Sequence conflicti177K → R in BAB28740 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_014780145 – 193AEFTA…FFASK → VRSSQLLLSASLYKVGLHGK IGPLMGGWGCAGKG in isoform 2. 2 PublicationsAdd BLAST49

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U59746 mRNA. Translation: AAB09056.1.
AF030769 mRNA. Translation: AAB86430.1.
AY170344 mRNA. Translation: AAO13177.2.
AK004680 mRNA. Translation: BAB23468.1.
AK013244 mRNA. Translation: BAB28740.1.
AK015644 mRNA. Translation: BAB29912.1.
AK172925 mRNA. Translation: BAD32203.1. Frameshift.
BC040369 mRNA. Translation: AAH40369.1.
CCDSiCCDS27103.1. [P70345-1]
RefSeqiNP_031563.1. NM_007537.1. [P70345-1]
XP_006518520.1. XM_006518457.3. [P70345-1]
XP_006518521.1. XM_006518458.2. [P70345-1]
UniGeneiMm.397611.
Mm.6967.

Genome annotation databases

EnsembliENSMUST00000022806; ENSMUSP00000022806; ENSMUSG00000089682. [P70345-1]
ENSMUST00000133397; ENSMUSP00000116385; ENSMUSG00000089682. [P70345-2]
GeneIDi12050.
KEGGimmu:12050.
UCSCiuc007txe.1. mouse. [P70345-1]
uc007txf.1. mouse. [P70345-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U59746 mRNA. Translation: AAB09056.1.
AF030769 mRNA. Translation: AAB86430.1.
AY170344 mRNA. Translation: AAO13177.2.
AK004680 mRNA. Translation: BAB23468.1.
AK013244 mRNA. Translation: BAB28740.1.
AK015644 mRNA. Translation: BAB29912.1.
AK172925 mRNA. Translation: BAD32203.1. Frameshift.
BC040369 mRNA. Translation: AAH40369.1.
CCDSiCCDS27103.1. [P70345-1]
RefSeqiNP_031563.1. NM_007537.1. [P70345-1]
XP_006518520.1. XM_006518457.3. [P70345-1]
XP_006518521.1. XM_006518458.2. [P70345-1]
UniGeneiMm.397611.
Mm.6967.

3D structure databases

ProteinModelPortaliP70345.
SMRiP70345.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi198325. 2 interactors.
MINTiMINT-209688.
STRINGi10090.ENSMUSP00000022806.

PTM databases

PhosphoSitePlusiP70345.

Proteomic databases

MaxQBiP70345.
PaxDbiP70345.
PeptideAtlasiP70345.
PRIDEiP70345.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000022806; ENSMUSP00000022806; ENSMUSG00000089682. [P70345-1]
ENSMUST00000133397; ENSMUSP00000116385; ENSMUSG00000089682. [P70345-2]
GeneIDi12050.
KEGGimmu:12050.
UCSCiuc007txe.1. mouse. [P70345-1]
uc007txf.1. mouse. [P70345-2]

Organism-specific databases

CTDi599.
MGIiMGI:108052. Bcl2l2.
RougeiSearch...

Phylogenomic databases

eggNOGiKOG4209. Eukaryota.
ENOG4111PFV. LUCA.
GeneTreeiENSGT00530000062935.
HOGENOMiHOG000056452.
InParanoidiP70345.
KOiK02163.
OMAiVQDWMVT.
OrthoDBiEOG091G0PAK.
PhylomeDBiP70345.
TreeFamiTF315834.

Miscellaneous databases

ChiTaRSiBcl2l2. mouse.
PROiP70345.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000089682.
CleanExiMM_BCL2L2.
ExpressionAtlasiP70345. baseline and differential.
GenevisibleiP70345. MM.

Family and domain databases

InterProiIPR013280. Apop_reg_BclW.
IPR002475. Bcl2-like.
IPR020717. Bcl2_BH1_motif_CS.
IPR020726. Bcl2_BH2_motif_CS.
IPR003093. Bcl2_BH4.
IPR020731. Bcl2_BH4_motif_CS.
IPR026298. Blc2_fam.
[Graphical view]
PANTHERiPTHR11256. PTHR11256. 1 hit.
PTHR11256:SF13. PTHR11256:SF13. 1 hit.
PfamiPF00452. Bcl-2. 1 hit.
PF02180. BH4. 1 hit.
[Graphical view]
PRINTSiPR01865. APOPREGBCLW.
PR01862. BCL2FAMILY.
SMARTiSM00265. BH4. 1 hit.
[Graphical view]
PROSITEiPS50062. BCL2_FAMILY. 1 hit.
PS01080. BH1. 1 hit.
PS01258. BH2. 1 hit.
PS01260. BH4_1. 1 hit.
PS50063. BH4_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiB2CL2_MOUSE
AccessioniPrimary (citable) accession number: P70345
Secondary accession number(s): Q545Q4
, Q6A093, Q8CFR2, Q8CGL4, Q9CYW5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: February 1, 1997
Last modified: November 2, 2016
This is version 141 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.