P70345 (B2CL2_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 111.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Bcl-2-like protein 2 Short name=Bcl2-L-2 Alternative name(s): Apoptosis regulator Bcl-W c98 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 193 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Promotes cell survival. Blocks dexamethasone-induced apoptosis. Mediates survival of postmitotic Sertoli cells by suppressing death-promoting activity of BAX. Ref.1 Ref.3 Ref.7 |
| Subunit structure | Interacts with BOP By similarity. |
| Subcellular location | Mitochondrion membrane; Peripheral membrane protein By similarity. Note: Loosely associated with the mitochondrial membrane in healthy cells. During apoptosis, tightly bound to the membrane By similarity. |
| Tissue specificity | Expressed in almost all myeloid cell lines and in a wide range of tissues, with highest levels in brain, colon, and salivary gland. |
| Developmental stage | Expressed in both mitotic and postmitotic Sertoli cells. Ref.7 |
| Induction | By Igf1. Ref.3 |
| Domain | The BH4 motif seems to be involved in the anti-apoptotic function. The BH1 and BH2 motifs form a hydrophobic groove which acts as a docking site for the BH3 domain of some pro-apoptotic proteins. The C-terminal residues of BCL2L2 fold into the BH3-binding cleft and modulate pro-survival activity by regulating ligand access. When BH3 domain-containing proteins bind, they displace the C-terminus, allowing its insertion into the membrane and neutralizing the pro-survival activity of BCL2L2 By similarity. |
| Disruption phenotype | Mice are sterile due to arrest in spermatogenesis associated with a gradual loss of germ and Sertoli cells from the testis. Ref.2 |
| Sequence similarities | Belongs to the Bcl-2 family. |
| Sequence caution | The sequence BAD32203.1 differs from that shown. Reason: Frameshift at position 191. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Apoptosis |
| Cellular component | Membrane Mitochondrion |
| Coding sequence diversity | Alternative splicing |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | Sertoli cell proliferation Inferred from genetic interaction Ref.7. Source: MGI apoptotic processInferred from direct assay PubMed 12115603. Source: MGI negative regulation of apoptotic processInferred from electronic annotation. Source: Compara |
| Cellular_component | cytosol Inferred from direct assay PubMed 11980919. Source: MGI mitochondrial membraneInferred from direct assay PubMed 11980919. Source: MGI |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P70345-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P70345-2) The sequence of this isoform differs from the canonical sequence as follows: 145-193: AEFTALYGDG...VTVGAFFASK → VRSSQLLLSASLYKVGLHGKIGPLMGGWGCAGKG |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 193 | 193 | Bcl-2-like protein 2 | PRO_0000143067 | |||||
Regions | |||||||||
| Motif | 9 – 29 | 21 | BH4 | ||||||
| Motif | 85 – 104 | 20 | BH1 | ||||||
| Motif | 136 – 151 | 16 | BH2 | ||||||
Natural variations | |||||||||
| Alternative sequence | 145 – 193 | 49 | AEFTA…FFASK → VRSSQLLLSASLYKVGLHGK IGPLMGGWGCAGKG in isoform 2. | VSP_014780 | |||||
Experimental info | |||||||||
| Sequence conflict | 16 | 1 | D → Y in AAO13177. Ref.3 | ||||||
| Sequence conflict | 21 | 1 | K → Q in AAO13177. Ref.3 | ||||||
| Sequence conflict | 53 – 54 | 2 | FE → LQ in AAO13177. Ref.3 | ||||||
| Sequence conflict | 63 | 1 | D → H in AAO13177. Ref.3 | ||||||
| Sequence conflict | 114 | 1 | E → H in AAO13177. Ref.3 | ||||||
| Sequence conflict | 136 | 1 | D → Y in AAO13177. Ref.3 | ||||||
| Sequence conflict | 192 | 1 | S → Y in AAO13177. Ref.3 | ||||||
| Isoform 2: | |||||||||
| Sequence conflict | 177 | 1 | K → R in BAB28740. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Bcl-w, a novel member of the Bcl-2 family, promotes cell survival." Gibson L., Holmgreen S.P., Huang D.C., Bernard O., Copeland N.G., Jenkins N.A., Sutherland G.R., Baker E., Adams J.M., Cory S. Oncogene 13:665-675(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION. |
| [2] | "Testicular degeneration in Bclw-deficient mice." Ross A.J., Waymire K.G., Moss J.E., Parlow A.F., Skinner M.K., Russell L.D., Macgregor G.R. Nat. Genet. 18:251-256(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), DISRUPTION PHENOTYPE. Strain: C57BL/10J. |
| [3] | "Mouse keratinocytes express c98, a novel gene homologous to bcl-2, that is stimulated by insulin-like growth factor 1 and prevents dexamethasone-induced apoptosis." Su H.-Y., Cheng W.T.K., Chen S.-C., Lin C.-T., Lien Y.-Y., Liu H.-J., Gilmour R.S. Biochim. Biophys. Acta 1676:127-137(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, INDUCTION. Strain: C57BL/6. Tissue: Skin. |
| [4] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Strain: C57BL/6J. Tissue: Lung and Testis. |
| [5] | "Prediction of the coding sequences of mouse homologues of KIAA gene: IV. The complete nucleotide sequences of 500 mouse KIAA-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries." Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Seino S., Nishimura M., Kaisho T., Hoshino K., Kitamura H., Nagase T., Ohara O., Koga H. DNA Res. 11:205-218(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Pancreatic islet. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: C57BL/6. Tissue: Retina. |
| [7] | "BCLW mediates survival of postmitotic Sertoli cells by regulating BAX activity." Ross A.J., Amy S.P., Mahar P.L., Lindsten T., Knudson C.M., Thompson C.B., Korsmeyer S.J., MacGregor G.R. Dev. Biol. 239:295-308(2001) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, DEVELOPMENTAL STAGE. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U59746 mRNA. Translation: AAB09056.1. AF030769 mRNA. Translation: AAB86430.1. AY170344 mRNA. Translation: AAO13177.2. AK004680 mRNA. Translation: BAB23468.1. AK013244 mRNA. Translation: BAB28740.1. AK015644 mRNA. Translation: BAB29912.1. AK172925 mRNA. Translation: BAD32203.1. Frameshift. BC040369 mRNA. Translation: AAH40369.1. |
| IPI | IPI00108184. IPI00229366. |
| RefSeq | NP_031563.1. NM_007537.1. |
| UniGene | Mm.397611. Mm.6967. |
3D structure databases | |
| ProteinModelPortal | P70345. |
| SMR | P70345. Positions 1-183. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | P70345. |
Proteomic databases | |
| PaxDb | P70345. |
| PRIDE | P70345. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000022806; ENSMUSP00000022806; ENSMUSG00000089682. ENSMUST00000133397; ENSMUSP00000116385; ENSMUSG00000089682. |
| GeneID | 12050. |
| KEGG | mmu:12050. |
| UCSC | uc007txe.1. mouse. uc007txf.1. mouse. |
Organism-specific databases | |
| CTD | 599. |
| MGI | MGI:108052. Bcl2l2. |
| Rouge | Search... |
Phylogenomic databases | |
| eggNOG | NOG238057. |
| GeneTree | ENSGT00530000062935. |
| HOGENOM | HOG000056452. |
| InParanoid | P70345. |
| KO | K02163. |
| OMA | VYLETRL. |
| OrthoDB | EOG4RBQKR. |
Gene expression databases | |
| ArrayExpress | P70345. |
| Bgee | P70345. |
| CleanEx | MM_BCL2L2. |
| Genevestigator | P70345. |
| GermOnline | ENSMUSG00000022194. Mus musculus. |
Family and domain databases | |
| InterPro | IPR013280. Apop_reg_BclW. IPR002475. Bcl2-like. IPR020717. Bcl2_BH1_motif_CS. IPR020726. Bcl2_BH2_motif_CS. IPR003093. Bcl2_BH4. IPR020731. Bcl2_BH4_motif_CS. IPR026298. Blc2_fam. [Graphical view] |
| PANTHER | PTHR11256. PTHR11256. 1 hit. PTHR11256:SF13. PTHR11256:SF13. 1 hit. |
| Pfam | PF00452. Bcl-2. 1 hit. PF02180. BH4. 1 hit. [Graphical view] |
| PRINTS | PR01865. APOPREGBCLW. PR01862. BCL2FAMILY. |
| SMART | SM00265. BH4. 1 hit. [Graphical view] |
| PROSITE | PS50062. BCL2_FAMILY. 1 hit. PS01080. BH1. 1 hit. PS01258. BH2. 1 hit. PS01260. BH4_1. 1 hit. PS50063. BH4_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | BCL2L2. mouse. |
| NextBio | 280343. |
| SOURCE | Search... |
Entry information
| Entry name | B2CL2_MOUSE | ||||||||
| Accession | Primary (citable) accession number: P70345 Secondary accession number(s): Q545Q4 Q9CYW5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
