Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Caspase-4

Gene

Casp4

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Proinflammatory caspase (PubMed:8702803, PubMed:9038361, PubMed:25119034). Essential effector of NLRP3 inflammasome-dependent CASP1 activation and IL1B and IL18 secretion in response to non-canonical activators, such as UVB radiation, cholera enterotoxin subunit B and cytosolic LPS, as well as infection with Gram-negative bacteria (PubMed:22002608). Independently of NLRP3 inflammasome and CASP1, promotes pyroptosis, through GSDMD cleavage and activation, and IL1A, IL18 and HMGB1 release in response to non-canonical inflammasome activators (PubMed:22002608, PubMed:26320999, PubMed:26375003). Plays a crucial role in the restriction of Salmonella typhimurium replication in colonic epithelial cells during infection. In later stages of the infection (>3 days post infection), LPS from cytosolic Salmonella triggers CASP4 activation, which ultimately results in the pyroptosis of the infected cells and their extrusion into the gut lumen, as well as in IL18 secretion. Pyroptosis limits bacterial replication, while cytokine secretion promotes the recruitment and activation of immune cells and triggers mucosal inflammation (PubMed:25121752). Involved in LPS-induced IL6 secretion; this activity may not require caspase enzymatic activity (By similarity). Involved in cell death induced by endoplasmic reticulum stress (By similarity). Activated by direct binding to LPS without the need of an upstream sensor (PubMed:25119034). Does not directly process IL1B (PubMed:8702803, PubMed:9038361).By similarity7 Publications

Catalytic activityi

Strict requirement for Asp at the P1 position and has a preferred cleavage sequence of (Ile/Leu/Val/Phe)-Gly-His-Asp-|-.By similarity

Enzyme regulationi

Activated by homooligomerization induced by direct binding to cytosolic LPS, in a TLR4-independent manner.1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei206 – 2061By similarity
Active sitei254 – 2541By similarity

GO - Molecular functioni

GO - Biological processi

  • actin filament organization Source: UniProtKB
  • cellular response to beta-amyloid Source: MGI
  • cellular response to mechanical stimulus Source: Ensembl
  • ectopic germ cell programmed cell death Source: MGI
  • inflammatory response Source: UniProtKB-KW
  • innate immune response Source: UniProtKB-KW
  • intrinsic apoptotic signaling pathway Source: MGI
  • intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress Source: MGI
  • positive regulation of interleukin-1 beta secretion Source: MGI
  • pyroptosis Source: MGI
  • regulation of apoptotic process Source: InterPro
  • substantia nigra development Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protease, Thiol protease

Keywords - Biological processi

Immunity, Inflammatory response, Innate immunity, Necrosis

Enzyme and pathway databases

BRENDAi3.4.22.57. 3474.
3.4.22.64. 3474.

Protein family/group databases

MEROPSiC14.012.

Names & Taxonomyi

Protein namesi
Recommended name:
Caspase-4 (EC:3.4.22.64By similarity)
Short name:
CASP-4
Alternative name(s):
Caspase-11
Short name:
CASP-11
Protease ICH-31 Publication
Cleaved into the following 2 chains:
Gene namesi
Name:Casp4
Synonyms:Casp11, Caspl, Ich3
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 9

Organism-specific databases

MGIiMGI:107700. Casp4.

Subcellular locationi

  • Cytoplasmcytosol By similarity
  • Cytoplasm 1 Publication
  • Endoplasmic reticulum membrane By similarity; Peripheral membrane protein By similarity; Cytoplasmic side By similarity
  • Mitochondrion By similarity
  • Inflammasome 1 Publication
  • Secreted By similarity

  • Note: Predominantly localizes to the endoplasmic reticulum (ER). Association with the ER membrane requires TMEM214. Released in the extracellular milieu by keratinocytes following UVB irradiation.By similarity

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Endoplasmic reticulum, Inflammasome, Membrane, Mitochondrion, Secreted

Pathology & Biotechi

Disruption phenotypei

Mutant animals are largely resistant to LPS-induced lethal septic shock (PubMed:22002608, PubMed:26375259). However, they are susceptible to Burkholderia thailandensis infection, even at low bacterial doses (PubMed:26320999). During intestinal Salmonella Typhimurium infection, mutant animals display higher pathogen loads in their cecal tissues and lumen and lower levels of IL18 in cecal explants, associated with a significant reduction in cecal inflammation (PubMed:25121752). Bone-marrow-derived macrophages from knockout mice respond normally, in terms of IL1B secretion, to canonical inflammasome activators, such as ATP, monosodium urate, poly(dA:dT) double-stranded DNA, Francisella tularensis, flagellin or Pseudomonas aeruginosa, but fail to secrete IL1B in response to cholera enterotoxin subunit B. They also do not respond to live E. coli, C. rodentium and V. cholerae, with or without LPS priming (PubMed:22002608).4 Publications

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi19 – 191K → E: Severely attenuated LPS-binding, LPS-induced oligomerization and activation, and LPS-induced pyroptosis. 1 Publication
Mutagenesisi38 – 381K → E: No effect on LPS-binding, LPS-induced oligomerization, and LPS-induced pyroptosis; when associated with M-40. 1 Publication
Mutagenesisi40 – 401E → M: No effect on LPS-binding, LPS-induced oligomerization, and LPS-induced pyroptosis; when associated with E-38. 1 Publication
Mutagenesisi53 – 531K → E: Complete loss of LPS-binding, LPS-induced oligomerization, and LPS-induced pyroptosis; when associated with E-54 and A-55. 1 Publication
Mutagenesisi54 – 541R → E: Complete loss of LPS-binding, LPS-induced oligomerization, and LPS-induced pyroptosis; when associated with E-53 and A-55. 1 Publication
Mutagenesisi55 – 551W → A: Complete loss of LPS-binding, LPS-induced oligomerization, and LPS-induced pyroptosis; when associated with E-54 and A-55. 1 Publication
Mutagenesisi62 – 621K → E: Severely attenuated LPS-binding, LPS-induced oligomerization and activation, and LPS-induced pyroptosis; when associated with E-63 and E-64. 1 Publication
Mutagenesisi63 – 631K → E: Severely attenuated LPS-binding, LPS-induced oligomerization and activation, and LPS-induced pyroptosis; when associated with E-62 and E-64. 1 Publication
Mutagenesisi64 – 641K → E: Severely attenuated LPS-binding, LPS-induced oligomerization and activation, and LPS-induced pyroptosis; when associated with E-62 and E-63. 1 Publication
Mutagenesisi254 – 2541C → A: Loss of catalytic activity and of autocatalytic processing. Loss of LPS-induced pyroptosis. No effect on the interaction with LPS. 2 Publications
Mutagenesisi254 – 2541C → G: No cell death.

Chemistry

ChEMBLiCHEMBL1075276.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Propeptidei1 – 8080Sequence analysisPRO_0000004600Add
BLAST
Chaini81 – 266186Caspase-4 subunit p20PRO_0000004601Add
BLAST
Propeptidei267 – 28519Sequence analysisPRO_0000004602Add
BLAST
Chaini286 – 37388Caspase-4 subunit p10PRO_0000004603Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei83 – 831PhosphoserineBy similarity

Post-translational modificationi

In response to activation signals, including cholera enterotoxin subunit B, infection by E. coli or S. typhimurium or endoplasmic reticulum stress, undergoes autoproteolytic cleavage.2 Publications

Keywords - PTMi

Phosphoprotein, Zymogen

Proteomic databases

MaxQBiP70343.
PaxDbiP70343.
PRIDEiP70343.

PTM databases

PhosphoSiteiP70343.

Miscellaneous databases

PMAP-CutDBQ3TAF3.

Expressioni

Tissue specificityi

Widely expressed, including in thymus, lung and spleen (at protein level). Very low levels, if any, in the brain.2 Publications

Inductioni

Up-regulated by LPS and E.coli (PubMed:8702803, PubMed:10986288, PubMed:22002608, PubMed:26375259). In LPS-induced lung inflammation, markedly up-regulated after 6 hours of treatment and decreases at 24 hours. The induction is dependent upon DDIT3/CHOP-mediated ER stress (at protein level) (PubMed:16670335). In the spleen and in bone marrow-derived macrophages, up-regulated by poly(I:C), a synthetic analog of double-stranded RNA (at protein level) (PubMed:26320999, PubMed:26375259). Also induced by IFNG and interferon-alpha. Up-regulated by R848, a TLR7 synthetic activator, and Pam3CysK4, a synthetic activator of TLR1/TLR2 (PubMed:26375259).6 Publications

Gene expression databases

BgeeiP70343.
CleanExiMM_CASP4.
ExpressionAtlasiP70343. baseline and differential.
GenevisibleiP70343. MM.

Interactioni

Subunit structurei

Upon direct LPS-binding, forms large homooligomers, resulting in its activation. These oligomers are often referred to as 'non-canonical inflammasomes' (PubMed:25119034). Active as a heterotetramer consisting of two anti-parallel arranged heterodimers, each one formed by a small and a large subunit (By similarity). In its precursor form, interacts with TMEM214; this interaction is required for association with the endoplasmic reticulum membrane. Interacts with CASP1. Interacts with NOD2.By similarity1 Publication

Protein-protein interaction databases

DIPiDIP-61776N.
STRINGi10090.ENSMUSP00000027012.

Chemistry

BindingDBiP70343.

Structurei

3D structure databases

ProteinModelPortaliP70343.
SMRiP70343. Positions 98-373.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1 – 9191CARDPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 5959Required for LPS-binding1 PublicationAdd
BLAST

Domaini

The CARD domain mediates LPS recognition and homooligomerization.1 Publication

Sequence similaritiesi

Belongs to the peptidase C14A family.Curated
Contains 1 CARD domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG3573. Eukaryota.
ENOG410ZQIE. LUCA.
GeneTreeiENSGT00760000118912.
HOGENOMiHOG000234399.
HOVERGENiHBG076981.
InParanoidiP70343.
KOiK12808.
OMAiDTIYQIF.
TreeFamiTF102023.

Family and domain databases

Gene3Di1.10.533.10. 1 hit.
3.40.50.1460. 1 hit.
InterProiIPR001315. CARD.
IPR029030. Caspase-like_dom.
IPR033139. Caspase_cys_AS.
IPR016129. Caspase_his_AS.
IPR011029. DEATH-like_dom.
IPR002138. Pept_C14_p10.
IPR001309. Pept_C14_p20.
IPR015917. Pept_C14A.
IPR017350. Pept_C14A_CASP1-typ.
[Graphical view]
PfamiPF00619. CARD. 1 hit.
[Graphical view]
PIRSFiPIRSF038001. Caspase_ICE. 1 hit.
PRINTSiPR00376. IL1BCENZYME.
SMARTiSM00114. CARD. 1 hit.
SM00115. CASc. 1 hit.
[Graphical view]
SUPFAMiSSF47986. SSF47986. 1 hit.
SSF52129. SSF52129. 1 hit.
PROSITEiPS50209. CARD. 1 hit.
PS01122. CASPASE_CYS. 1 hit.
PS01121. CASPASE_HIS. 1 hit.
PS50207. CASPASE_P10. 1 hit.
PS50208. CASPASE_P20. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P70343-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAENKHPDKP LKVLEQLGKE VLTEYLEKLV QSNVLKLKEE DKQKFNNAER
60 70 80 90 100
SDKRWVFVDA MKKKHSKVGE MLLQTFFSVD PGSHHGEANL EMEEPEESLN
110 120 130 140 150
TLKLCSPEEF TRLCREKTQE IYPIKEANGR TRKALIICNT EFKHLSLRYG
160 170 180 190 200
ANFDIIGMKG LLEDLGYDVV VKEELTAEGM ESEMKDFAAL SEHQTSDSTF
210 220 230 240 250
LVLMSHGTLH GICGTMHSEK TPDVLQYDTI YQIFNNCHCP GLRDKPKVII
260 270 280 290 300
VQACRGGNSG EMWIRESSKP QLCRGVDLPR NMEADAVKLS HVEKDFIAFY
310 320 330 340 350
STTPHHLSYR DKTGGSYFIT RLISCFRKHA CSCHLFDIFL KVQQSFEKAS
360 370
IHSQMPTIDR ATLTRYFYLF PGN
Length:373
Mass (Da):42,742
Last modified:July 27, 2011 - v2
Checksum:i110D7AA75E71C2B3
GO
Isoform 2 (identifier: P70343-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     88-118: ANLEMEEPEESLNTLKLCSPEEFTRLCREKT → DLPNKGGQWPYTKGSYHMQYRVQTSLTEVWG
     119-373: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available.Curated
Show »
Length:118
Mass (Da):13,746
Checksum:i10393D4DF7045252
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti126 – 1261E → K in AAH61255 (PubMed:15489334).Curated
Sequence conflicti152 – 1521N → K in AAB09469 (PubMed:8702803).Curated

Polymorphismi

A variant of this gene has been observed in several 129 substrains, including 129/SvJ, 129S1/Sv, 129P3/J and 129S6/SvEvTac. This variant displays a 5-bp deletion encompassing the exon 7 splice acceptor junction. As a result, exon 7 is spliced out. Joining of exon 6 to exon 8 creates a frameshift after Pro-304 and a stop codon occurs after 5 aberrant amino acids. The mRNA may be the target of nonsense-mediated mRNA decay. It is detected only at low levels, while the corresponding protein is not detected at all in any of the 129 substrains tested.1 Publication

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei88 – 11831ANLEM…CREKT → DLPNKGGQWPYTKGSYHMQY RVQTSLTEVWG in isoform 2. 1 PublicationVSP_058183Add
BLAST
Alternative sequencei119 – 373255Missing in isoform 2. 1 PublicationVSP_058184Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U59463 mRNA. Translation: AAB09469.1.
Y13089 mRNA. Translation: CAA73531.1.
AB480706 mRNA. Translation: BAH96541.1.
AK151547 mRNA. Translation: BAE30493.1.
AK171877 mRNA. Translation: BAE42715.1.
AC141637 Genomic DNA. No translation available.
CH466636 Genomic DNA. Translation: EDL09318.1.
BC061255 mRNA. Translation: AAH61255.1.
CCDSiCCDS22799.1. [P70343-1]
RefSeqiNP_031635.2. NM_007609.3. [P70343-1]
UniGeneiMm.1569.

Genome annotation databases

EnsembliENSMUST00000027012; ENSMUSP00000027012; ENSMUSG00000033538. [P70343-1]
ENSMUST00000160064; ENSMUSP00000124249; ENSMUSG00000033538. [P70343-2]
GeneIDi12363.
KEGGimmu:12363.
UCSCiuc009obt.3. mouse. [P70343-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U59463 mRNA. Translation: AAB09469.1.
Y13089 mRNA. Translation: CAA73531.1.
AB480706 mRNA. Translation: BAH96541.1.
AK151547 mRNA. Translation: BAE30493.1.
AK171877 mRNA. Translation: BAE42715.1.
AC141637 Genomic DNA. No translation available.
CH466636 Genomic DNA. Translation: EDL09318.1.
BC061255 mRNA. Translation: AAH61255.1.
CCDSiCCDS22799.1. [P70343-1]
RefSeqiNP_031635.2. NM_007609.3. [P70343-1]
UniGeneiMm.1569.

3D structure databases

ProteinModelPortaliP70343.
SMRiP70343. Positions 98-373.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

DIPiDIP-61776N.
STRINGi10090.ENSMUSP00000027012.

Chemistry

BindingDBiP70343.
ChEMBLiCHEMBL1075276.

Protein family/group databases

MEROPSiC14.012.

PTM databases

PhosphoSiteiP70343.

Proteomic databases

MaxQBiP70343.
PaxDbiP70343.
PRIDEiP70343.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000027012; ENSMUSP00000027012; ENSMUSG00000033538. [P70343-1]
ENSMUST00000160064; ENSMUSP00000124249; ENSMUSG00000033538. [P70343-2]
GeneIDi12363.
KEGGimmu:12363.
UCSCiuc009obt.3. mouse. [P70343-1]

Organism-specific databases

CTDi837.
MGIiMGI:107700. Casp4.

Phylogenomic databases

eggNOGiKOG3573. Eukaryota.
ENOG410ZQIE. LUCA.
GeneTreeiENSGT00760000118912.
HOGENOMiHOG000234399.
HOVERGENiHBG076981.
InParanoidiP70343.
KOiK12808.
OMAiDTIYQIF.
TreeFamiTF102023.

Enzyme and pathway databases

BRENDAi3.4.22.57. 3474.
3.4.22.64. 3474.

Miscellaneous databases

PMAP-CutDBQ3TAF3.
PROiP70343.
SOURCEiSearch...

Gene expression databases

BgeeiP70343.
CleanExiMM_CASP4.
ExpressionAtlasiP70343. baseline and differential.
GenevisibleiP70343. MM.

Family and domain databases

Gene3Di1.10.533.10. 1 hit.
3.40.50.1460. 1 hit.
InterProiIPR001315. CARD.
IPR029030. Caspase-like_dom.
IPR033139. Caspase_cys_AS.
IPR016129. Caspase_his_AS.
IPR011029. DEATH-like_dom.
IPR002138. Pept_C14_p10.
IPR001309. Pept_C14_p20.
IPR015917. Pept_C14A.
IPR017350. Pept_C14A_CASP1-typ.
[Graphical view]
PfamiPF00619. CARD. 1 hit.
[Graphical view]
PIRSFiPIRSF038001. Caspase_ICE. 1 hit.
PRINTSiPR00376. IL1BCENZYME.
SMARTiSM00114. CARD. 1 hit.
SM00115. CASc. 1 hit.
[Graphical view]
SUPFAMiSSF47986. SSF47986. 1 hit.
SSF52129. SSF52129. 1 hit.
PROSITEiPS50209. CARD. 1 hit.
PS01122. CASPASE_CYS. 1 hit.
PS01121. CASPASE_HIS. 1 hit.
PS50207. CASPASE_P10. 1 hit.
PS50208. CASPASE_P20. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Identification and characterization of Ich-3, a member of the interleukin-1beta converting enzyme (ICE)/Ced-3 family and an upstream regulator of ICE."
    Wang S., Miura M., Jung Y.-K., Zhu H., Gagliardini V., Shi L., Greenberg A.H., Yuan J.
    J. Biol. Chem. 271:20580-20587(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, INDUCTION BY LPS, TISSUE SPECIFICITY.
    Strain: C57BL/6 X CBA.
    Tissue: Thymus.
  2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY.
    Strain: C3H/An.
    Tissue: Fibrosarcoma.
  3. "ER stress-mediated caspase-11 induction is regulated with alternative splicing."
    Endo M., Nakayama Y., Mori M., Oike Y., Gotoh T.
    Submitted (FEB-2009) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Strain: C57BL/6J.
  4. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: C57BL/6J and NOD.
    Tissue: Bone marrow and Spleen.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  6. Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
    Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Pituitary.
  8. "Expression analysis of the human caspase-1 subfamily reveals specific regulation of the CASP5 gene by lipopolysaccharide and interferon-gamma."
    Lin X.Y., Choi M.S., Porter A.G.
    J. Biol. Chem. 275:39920-39926(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: INDUCTION BY LPS.
  9. "C/EBP homologous protein (CHOP) is crucial for the induction of caspase-11 and the pathogenesis of lipopolysaccharide-induced inflammation."
    Endo M., Mori M., Akira S., Gotoh T.
    J. Immunol. 176:6245-6253(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: INDUCTION BY LPS AND ER STRESS, SUBCELLULAR LOCATION.
  10. Cited for: FUNCTION, DISRUPTION PHENOTYPE, INDUCTION BY LPS AND LIVE E.COLI, STRAIN-SPECIFIC VARIANT, PROTEOLYTIC CLEAVAGE, MUTAGENESIS OF CYS-254.
  11. "Noncanonical inflammasome activation of caspase-4/caspase-11 mediates epithelial defenses against enteric bacterial pathogens."
    Knodler L.A., Crowley S.M., Sham H.P., Yang H., Wrande M., Ma C., Ernst R.K., Steele-Mortimer O., Celli J., Vallance B.A.
    Cell Host Microbe 16:249-256(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, DISRUPTION PHENOTYPE, PROTEOLYTIC CLEAVAGE.
  12. "Inflammatory caspases are innate immune receptors for intracellular LPS."
    Shi J., Zhao Y., Wang Y., Gao W., Ding J., Li P., Hu L., Shao F.
    Nature 514:187-192(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, ENZYME REGULATION, OLIGOMERIZATION, INTERACTION WITH LPS, DOMAIN, MUTAGENESIS OF LYS-19; LYS-38; GLU-40; LYS-53; ARG-54; TRP-55; LYS-62; LYS-63; LYS-64 AND CYS-254.
  13. "Canonical inflammasomes drive IFN-gamma to prime caspase-11 in defense against a cytosol-invasive bacterium."
    Aachoui Y., Kajiwara Y., Leaf I.A., Mao D., Ting J.P., Coers J., Aderem A., Buxbaum J.D., Miao E.A.
    Cell Host Microbe 18:320-332(2015) [PubMed] [Europe PMC] [Abstract]
    Cited for: DISRUPTION PHENOTYPE, INDUCTION BY POLY(I:C).
  14. "Cleavage of GSDMD by inflammatory caspases determines pyroptotic cell death."
    Shi J., Zhao Y., Wang K., Shi X., Wang Y., Huang H., Zhuang Y., Cai T., Wang F., Shao F.
    Nature 526:660-665(2015) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, GSDMD CLEAVAGE.
  15. Cited for: INDUCTION, DISRUPTION PHENOTYPE.

Entry informationi

Entry nameiCASP4_MOUSE
AccessioniPrimary (citable) accession number: P70343
Secondary accession number(s): C6L648
, O08735, Q3TAF3, Q6P8H1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: July 27, 2011
Last modified: June 8, 2016
This is version 140 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. Peptidase families
    Classification of peptidase families and list of entries
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.