P70336 (ROCK2_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 127.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Rho-associated protein kinase 2 EC=2.7.11.1 Alternative name(s): Rho-associated, coiled-coil-containing protein kinase 2 Rho-associated, coiled-coil-containing protein kinase II Short name=ROCK-II p164 ROCK-2 | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 1388 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Protein kinase which is a key regulator of actin cytoskeleton and cell polarity. Involved in regulation of smooth muscle contraction, actin cytoskeleton organization, stress fiber and focal adhesion formation, neurite retraction, cell adhesion and motility via phosphorylation of ADD1, BRCA2, CNN1, EZR, DPYSL2, EP300, MSN, MYL9/MLC2, NPM1, RDX, PPP1R12A and VIM. Phosphorylates SORL1 and IRF4. Acts as a negative regulator of VEGF-induced angiogenic endothelial cell activation. Positively regulates the activation of p42/MAPK1-p44/MAPK3 and of p90RSK/RPS6KA1 during myogenic differentiation. Plays an important role in the timely initiation of centrosome duplication. Inhibits keratinocyte terminal differentiation. May regulate closure of the eyelids and ventral body wall through organization of actomyosin bundles. Plays a critical role in the regulation of spine and synaptic properties in the hippocampus. Plays a role in placental homeostasis during the perinatal period. Ref.4 Ref.7 Ref.8 Ref.9 |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Cofactor | Magnesium By similarity. |
| Enzyme regulation | Activated by RHOA binding. Inhibited by Y-27632 By similarity. |
| Subunit structure | Homodimer By similarity. Interacts with RHOA (activated by GTP), CHORDC1, IRS1, RHOB, RHOC, PPP1R12A, SORL1, EP300 and BRCA2 By similarity. Interacts with NPM1 and this interaction enhances its activity By similarity. Interacts with RAF1 By similarity. |
| Subcellular location | Isoform 1: Cytoplasm. Cell membrane; Peripheral membrane protein Ref.2. Nucleus By similarity. Cytoplasm › cytoskeleton › centrosome By similarity. Note: Cytoplasmic, and associated with actin microfilaments and the plasma membrane By similarity. Ref.2 Isoform 2: Cytoplasm. Cell membrane; Peripheral membrane protein Ref.2. |
| Tissue specificity | Highly expressed in brain, heart, lung, liver, stomach, spleen, kidney, testis, muscle, embryo and placenta. Isoform 2 is expressed predominantly in the skeletal muscle. Ref.1 Ref.2 |
| Domain | An interaction between Thr-414 and Asp-48 is essential for kinase activity and dimerization By similarity. |
| Post-translational modification | Autophosphorylated. Phosphorylation at Tyr-722 reduces its binding to RHOA and is crucial for focal adhesion dynamics. Dephosphorylation by PTPN11 stimulates its RHOA binding activity By similarity. Ref.2 Cleaved by granzyme B during apoptosis. This leads to constitutive activation of the kinase and membrane blebbing. |
| Disruption phenotype | Mice exhibit both EOB (eyes open at birth) and omphalocele phenotypes as a result of disorganization of actomyosin cables in the eyelid epithelium and defective actin assembly in the umbilical ring. Mice are impaired in both basal synaptic transmission and hippocampal long-term potentiation (LTP). Embryos manifest extensive thrombus formation in the placenta, resulting in placental dysfunction, intrauterine growth retardation, and fetal death. Ref.4 Ref.5 Ref.8 |
| Sequence similarities | Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. Contains 1 AGC-kinase C-terminal domain. Contains 1 PH domain. Contains 1 phorbol-ester/DAG-type zinc finger. Contains 1 protein kinase domain. Contains 1 REM (Hr1) repeat. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P70336-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P70336-2) Also known as: ROCK2m; The sequence of this isoform differs from the canonical sequence as follows: 1149-1149: P → PVHITQSHTMESMSFTYQRSSTSLSIATKPSSSHTLLDFDSEEDSLPYLPSSSEPIST 1388-1388: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1388 | 1388 | Rho-associated protein kinase 2 | PRO_0000086626 | |||||
Regions | |||||||||
| Domain | 92 – 354 | 263 | Protein kinase | ||||||
| Domain | 357 – 425 | 69 | AGC-kinase C-terminal | ||||||
| Repeat | 475 – 559 | 85 | REM | ||||||
| Domain | 1150 – 1349 | 200 | PH | ||||||
| Nucleotide binding | 98 – 106 | 9 | ATP By similarity | ||||||
| Zinc finger | 1260 – 1315 | 56 | Phorbol-ester/DAG-type | ||||||
| Region | 363 – 784 | 422 | Interaction with PPP1R12A By similarity | ||||||
| Region | 373 – 420 | 48 | Interaction with NPM1 By similarity | ||||||
| Region | 979 – 1047 | 69 | RHOA binding By similarity | ||||||
| Coiled coil | 439 – 1131 | 693 | Potential | ||||||
Sites | |||||||||
| Active site | 214 | 1 | Proton acceptor By similarity | ||||||
| Binding site | 121 | 1 | ATP By similarity | ||||||
| Site | 1131 – 1132 | 2 | Cleavage; by granzyme B | ||||||
Amino acid modifications | |||||||||
| Modified residue | 414 | 1 | Phosphothreonine; by ROCK2 By similarity | ||||||
| Modified residue | 722 | 1 | Phosphotyrosine; by SRC By similarity | ||||||
| Modified residue | 1137 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1149 | 1 | P → PVHITQSHTMESMSFTYQRS STSLSIATKPSSSHTLLDFD SEEDSLPYLPSSSEPIST in isoform 2. | VSP_041818 | |||||
| Alternative sequence | 1388 | 1 | Missing in isoform 2. | VSP_041819 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "ROCK-I and ROCK-II, two isoforms of Rho-associated coiled-coil forming protein serine/threonine kinase in mice." Nakagawa O., Fujisawa K., Ishizaki T., Saito Y., Nakao K., Narumiya S. FEBS Lett. 392:189-193(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. |
| [2] | "ROCK2 and its alternatively spliced isoform ROCK2m positively control the maturation of the myogenic program." Pelosi M., Marampon F., Zani B.M., Prudente S., Perlas E., Caputo V., Cianetti L., Berno V., Narumiya S., Kang S.W., Musaro A., Rosenthal N. Mol. Cell. Biol. 27:6163-6176(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-1144 (ISOFORM 2), PHOSPHORYLATION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Strain: C57BL/6J. |
| [3] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 633-1388 AND 677-1388. Strain: C57BL/6J. Tissue: Brain and Urinary bladder. |
| [4] | "Targeted disruption of the mouse rho-associated kinase 2 gene results in intrauterine growth retardation and fetal death." Thumkeo D., Keel J., Ishizaki T., Hirose M., Nonomura K., Oshima H., Oshima M., Taketo M.M., Narumiya S. Mol. Cell. Biol. 23:5043-5055(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, DISRUPTION PHENOTYPE. |
| [5] | "ROCK-I regulates closure of the eyelids and ventral body wall by inducing assembly of actomyosin bundles." Shimizu Y., Thumkeo D., Keel J., Ishizaki T., Oshima H., Oshima M., Noda Y., Matsumura F., Taketo M.M., Narumiya S. J. Cell Biol. 168:941-953(2005) [PubMed] [Europe PMC] [Abstract] Cited for: DISRUPTION PHENOTYPE. |
| [6] | "Direct cleavage of ROCK II by granzyme B induces target cell membrane blebbing in a caspase-independent manner." Sebbagh M., Hamelin J., Bertoglio J., Solary E., Breard J. J. Exp. Med. 201:465-471(2005) [PubMed] [Europe PMC] [Abstract] Cited for: CLEAVAGE BY GRANZYME B. |
| [7] | "Inhibition of Rho-dependent kinases ROCK I/II activates VEGF-driven retinal neovascularization and sprouting angiogenesis." Kroll J., Epting D., Kern K., Dietz C.T., Feng Y., Hammes H.P., Wieland T., Augustin H.G. Am. J. Physiol. 296:H893-H899(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [8] | "A critical role of Rho-kinase ROCK2 in the regulation of spine and synaptic function." Zhou Z., Meng Y., Asrar S., Todorovski Z., Jia Z. Neuropharmacology 56:81-89(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, DISRUPTION PHENOTYPE. |
| [9] | "Phosphorylation of IRF4 by ROCK2 regulates IL-17 and IL-21 production and the development of autoimmunity in mice." Biswas P.S., Gupta S., Chang E., Song L., Stirzaker R.A., Liao J.K., Bhagat G., Pernis A.B. J. Clin. Invest. 120:3280-3295(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U58513 mRNA. Translation: AAC53133.1. DQ864977 mRNA. Translation: ABI75318.1. AK045517 mRNA. Translation: BAC32403.1. AK035509 mRNA. Translation: BAC29084.1. |
| IPI | IPI00853802. IPI01027776. |
| PIR | S74245. |
| RefSeq | NP_033098.2. NM_009072.2. |
| UniGene | Mm.276024. |
3D structure databases | |
| ProteinModelPortal | P70336. |
| SMR | P70336. Positions 27-417, 559-709, 979-1045, 1151-1351. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P70336. 3 interactions. |
| MINT | MINT-4132887. |
PTM databases | |
| PhosphoSite | P70336. |
Proteomic databases | |
| PaxDb | P70336. |
| PRIDE | P70336. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| GeneID | 19878. |
| KEGG | mmu:19878. |
Organism-specific databases | |
| CTD | 9475. |
| MGI | MGI:107926. Rock2. |
Phylogenomic databases | |
| eggNOG | COG0515. |
| HOGENOM | HOG000017259. |
| HOVERGEN | HBG053111. |
| InParanoid | P70336. |
| KO | K04514. |
| OrthoDB | EOG4PZJ5T. |
Gene expression databases | |
| Genevestigator | P70336. |
Family and domain databases | |
| Gene3D | 2.30.29.30. 2 hits. |
| InterPro | IPR000961. AGC-kinase_C. IPR011072. HR1_rho-bd. IPR011009. Kinase-like_dom. IPR011993. PH_like_dom. IPR017892. Pkinase_C. IPR001849. Pleckstrin_homology. IPR002219. Prot_Kinase_C-like_PE/DAG-bd. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR020684. Rho-assoc_coiled-coil_kin. IPR015008. Rho-bd_dom. IPR002290. Ser/Thr_dual-sp_kinase_dom. IPR008271. Ser/Thr_kinase_AS. [Graphical view] |
| PANTHER | PTHR22988:SF3. PTHR22988:SF3. 1 hit. |
| Pfam | PF02185. HR1. 1 hit. PF00169. PH. 1 hit. PF00069. Pkinase. 1 hit. PF00433. Pkinase_C. 1 hit. PF08912. Rho_Binding. 1 hit. [Graphical view] |
| PIRSF | PIRSF037568. Rho_kinase. 1 hit. |
| SMART | SM00109. C1. 1 hit. SM00233. PH. 1 hit. SM00133. S_TK_X. 1 hit. SM00220. S_TKc. 1 hit. [Graphical view] |
| SUPFAM | SSF56112. Kinase_like. 1 hit. |
| PROSITE | PS51285. AGC_KINASE_CTER. 1 hit. PS50003. PH_DOMAIN. 1 hit. PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. PS00479. ZF_DAG_PE_1. False negative. PS50081. ZF_DAG_PE_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 297370. |
| SOURCE | Search... |
Entry information
| Entry name | ROCK2_MOUSE | ||||||||
| Accession | Primary (citable) accession number: P70336 Secondary accession number(s): A5XDA7, Q8BR64, Q8CBR0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
