Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

CTP synthase 2

Gene

Ctps2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Catalyzes the ATP-dependent amination of UTP to CTP with either L-glutamine or ammonia as the source of nitrogen. Constitutes the rate-limiting enzyme in the synthesis of cytosine nucleotides (By similarity).By similarity

Catalytic activityi

ATP + UTP + L-glutamine = ADP + phosphate + CTP + L-glutamate.

Pathwayi: CTP biosynthesis via de novo pathway

This protein is involved in step 2 of the subpathway that synthesizes CTP from UDP.
Proteins known to be involved in the 2 steps of the subpathway in this organism are:
  1. no protein annotated in this organism
  2. CTP synthase 2 (Ctps2), CTP synthase 1 (Ctps1)
This subpathway is part of the pathway CTP biosynthesis via de novo pathway, which is itself part of Pyrimidine metabolism.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes CTP from UDP, the pathway CTP biosynthesis via de novo pathway and in Pyrimidine metabolism.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei399 – 3991For GATase activityPROSITE-ProRule annotation
Active sitei526 – 5261For GATase activityPROSITE-ProRule annotation
Active sitei528 – 5281For GATase activityPROSITE-ProRule annotation

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Ligase

Keywords - Biological processi

Pyrimidine biosynthesis

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDAi6.3.4.2. 3474.
ReactomeiR-MMU-499943. Synthesis and interconversion of nucleotide di- and triphosphates.
UniPathwayiUPA00159; UER00277.

Names & Taxonomyi

Protein namesi
Recommended name:
CTP synthase 2 (EC:6.3.4.2)
Alternative name(s):
CTP synthetase 2
Short name:
CTPsH
UTP--ammonia ligase 2
Gene namesi
Name:Ctps2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome X

Organism-specific databases

MGIiMGI:1933185. Ctps2.

Subcellular locationi

GO - Cellular componenti

  • mitochondrion Source: MGI
Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 586586CTP synthase 2PRO_0000247034Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei568 – 5681PhosphoserineCombined sources
Modified residuei571 – 5711PhosphoserineCombined sources
Modified residuei574 – 5741PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiP70303.
MaxQBiP70303.
PaxDbiP70303.
PeptideAtlasiP70303.
PRIDEiP70303.

PTM databases

iPTMnetiP70303.
PhosphoSiteiP70303.

Expressioni

Gene expression databases

BgeeiP70303.
CleanExiMM_CTPS2.
ExpressionAtlasiP70303. baseline and differential.
GenevisibleiP70303. MM.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000033727.

Structurei

3D structure databases

ProteinModelPortaliP70303.
SMRiP70303. Positions 1-273, 297-554.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini300 – 554255Glutamine amidotransferase type-1PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the CTP synthase family.Curated
Contains 1 glutamine amidotransferase type-1 domain.PROSITE-ProRule annotation

Keywords - Domaini

Glutamine amidotransferase

Phylogenomic databases

eggNOGiKOG2387. Eukaryota.
COG0504. LUCA.
GeneTreeiENSGT00390000012473.
HOGENOMiHOG000077514.
HOVERGENiHBG002243.
InParanoidiP70303.
KOiK01937.
OMAiCASNIAR.
OrthoDBiEOG7M3HZZ.
PhylomeDBiP70303.
TreeFamiTF300379.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
3.40.50.880. 1 hit.
InterProiIPR029062. Class_I_gatase-like.
IPR004468. CTP_synthase.
IPR017456. CTP_synthase_N.
IPR017926. GATASE.
IPR027417. P-loop_NTPase.
[Graphical view]
PANTHERiPTHR11550. PTHR11550. 1 hit.
PfamiPF06418. CTP_synth_N. 1 hit.
PF00117. GATase. 1 hit.
[Graphical view]
SUPFAMiSSF52317. SSF52317. 1 hit.
SSF52540. SSF52540. 1 hit.
TIGRFAMsiTIGR00337. PyrG. 1 hit.
PROSITEiPS51273. GATASE_TYPE_1. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P70303-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKYILVTGGV ISGIGKGIIA SSIGTILKSC GLRVTAIKID PYINIDAGTF
60 70 80 90 100
SPYEHGEVFV LNDGGEVDLD LGNYERFLDI NLYKDNNITT GKIYQHVINK
110 120 130 140 150
ERRGDYLGKT VQVVPHITDA IQEWVMNQAK VSVDGNKEDP QICVIELGGT
160 170 180 190 200
IGDIEGMAFV EAFRQFQFKA KKENFYNIHV SLVPQPSATG EQKTKPTQNS
210 220 230 240 250
VRALRGLGLS PDLIVCRSST PIEMAVKEKI SMFCHVNPEQ VICIHDVSSI
260 270 280 290 300
YRVPLLLEEQ GVVKYFQERL GLPINDCSSN LLFKWKAMAD RYERLQKICS
310 320 330 340 350
IALVGKYTKL RDCYASVFKA LEHSALAINH KLNLMYIDSI DLEPVTKAED
360 370 380 390 400
PVKFHEAWQK LCLADGILVP GGFGIRGTLG KLQAISWART KKIPFLGICL
410 420 430 440 450
GMQLAVIEFA RNCLNLKDAN STEFEPNTPV PLVIDMPEHN PGDLGGTMRL
460 470 480 490 500
GLRRTVFTTE NSILKKLYGD VPYIEERHRH RYEVNPNLIN QFENKDLCFV
510 520 530 540 550
GEDVDGKRME IVELTSHPYF IGVQFHPEFS SRPMKPSPPY LGLLLAATGN
560 570 580
LNAHLQQMNK LPYSDGYSDA SDDSFPEAKL AELDLN
Length:586
Mass (Da):65,514
Last modified:February 1, 1997 - v1
Checksum:i52EC0237B84A05F9
GO
Isoform 2 (identifier: P70303-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     465-515: Missing.

Note: No experimental confirmation available.
Show »
Length:535
Mass (Da):59,382
Checksum:i8C3C5836241FA589
GO
Isoform 3 (identifier: P70303-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGSELLGKNSALFSSFPTFCGGGPLGCTVADGQTFMIASGYWQSPIRPPM
     465-472: KKLYGDVP → SLYLQCSG
     473-586: Missing.

Note: No experimental confirmation available.
Show »
Length:521
Mass (Da):57,466
Checksum:i03AB836A6AE17F58
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MGSELLGKNSALFSSFPTFC GGGPLGCTVADGQTFMIASG YWQSPIRPPM in isoform 3. 1 PublicationVSP_019893
Alternative sequencei465 – 51551Missing in isoform 2. 1 PublicationVSP_019894Add
BLAST
Alternative sequencei465 – 4728KKLYGDVP → SLYLQCSG in isoform 3. 1 PublicationVSP_019895
Alternative sequencei473 – 586114Missing in isoform 3. 1 PublicationVSP_019896Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U49385 mRNA. Translation: AAB17729.1.
AK032018 mRNA. Translation: BAC27651.1.
AK052854 mRNA. Translation: BAC35174.1.
AK084595 mRNA. Translation: BAC39223.1.
AK150966 mRNA. Translation: BAE29997.1.
AK151597 mRNA. Translation: BAE30537.1.
AK161564 mRNA. Translation: BAE36466.1.
AK164206 mRNA. Translation: BAE37683.1.
BC003257 mRNA. Translation: AAH03257.1.
CCDSiCCDS41202.1. [P70303-1]
CCDS53240.1. [P70303-2]
RefSeqiNP_001162040.1. NM_001168568.1. [P70303-1]
NP_001162041.1. NM_001168569.1. [P70303-1]
NP_001162043.1. NM_001168571.1. [P70303-2]
NP_061207.1. NM_018737.5. [P70303-1]
XP_006528975.1. XM_006528912.2. [P70303-1]
XP_006528976.1. XM_006528913.2. [P70303-1]
UniGeneiMm.2065.

Genome annotation databases

EnsembliENSMUST00000033727; ENSMUSP00000033727; ENSMUSG00000031360. [P70303-1]
ENSMUST00000101095; ENSMUSP00000098656; ENSMUSG00000031360. [P70303-3]
ENSMUST00000112301; ENSMUSP00000107920; ENSMUSG00000031360. [P70303-1]
ENSMUST00000112302; ENSMUSP00000107921; ENSMUSG00000031360. [P70303-2]
ENSMUST00000112303; ENSMUSP00000107922; ENSMUSG00000031360. [P70303-1]
GeneIDi55936.
KEGGimmu:55936.
UCSCiuc009uuo.2. mouse. [P70303-1]
uc012hrk.1. mouse. [P70303-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U49385 mRNA. Translation: AAB17729.1.
AK032018 mRNA. Translation: BAC27651.1.
AK052854 mRNA. Translation: BAC35174.1.
AK084595 mRNA. Translation: BAC39223.1.
AK150966 mRNA. Translation: BAE29997.1.
AK151597 mRNA. Translation: BAE30537.1.
AK161564 mRNA. Translation: BAE36466.1.
AK164206 mRNA. Translation: BAE37683.1.
BC003257 mRNA. Translation: AAH03257.1.
CCDSiCCDS41202.1. [P70303-1]
CCDS53240.1. [P70303-2]
RefSeqiNP_001162040.1. NM_001168568.1. [P70303-1]
NP_001162041.1. NM_001168569.1. [P70303-1]
NP_001162043.1. NM_001168571.1. [P70303-2]
NP_061207.1. NM_018737.5. [P70303-1]
XP_006528975.1. XM_006528912.2. [P70303-1]
XP_006528976.1. XM_006528913.2. [P70303-1]
UniGeneiMm.2065.

3D structure databases

ProteinModelPortaliP70303.
SMRiP70303. Positions 1-273, 297-554.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000033727.

PTM databases

iPTMnetiP70303.
PhosphoSiteiP70303.

Proteomic databases

EPDiP70303.
MaxQBiP70303.
PaxDbiP70303.
PeptideAtlasiP70303.
PRIDEiP70303.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000033727; ENSMUSP00000033727; ENSMUSG00000031360. [P70303-1]
ENSMUST00000101095; ENSMUSP00000098656; ENSMUSG00000031360. [P70303-3]
ENSMUST00000112301; ENSMUSP00000107920; ENSMUSG00000031360. [P70303-1]
ENSMUST00000112302; ENSMUSP00000107921; ENSMUSG00000031360. [P70303-2]
ENSMUST00000112303; ENSMUSP00000107922; ENSMUSG00000031360. [P70303-1]
GeneIDi55936.
KEGGimmu:55936.
UCSCiuc009uuo.2. mouse. [P70303-1]
uc012hrk.1. mouse. [P70303-2]

Organism-specific databases

CTDi56474.
MGIiMGI:1933185. Ctps2.

Phylogenomic databases

eggNOGiKOG2387. Eukaryota.
COG0504. LUCA.
GeneTreeiENSGT00390000012473.
HOGENOMiHOG000077514.
HOVERGENiHBG002243.
InParanoidiP70303.
KOiK01937.
OMAiCASNIAR.
OrthoDBiEOG7M3HZZ.
PhylomeDBiP70303.
TreeFamiTF300379.

Enzyme and pathway databases

UniPathwayiUPA00159; UER00277.
BRENDAi6.3.4.2. 3474.
ReactomeiR-MMU-499943. Synthesis and interconversion of nucleotide di- and triphosphates.

Miscellaneous databases

PROiP70303.
SOURCEiSearch...

Gene expression databases

BgeeiP70303.
CleanExiMM_CTPS2.
ExpressionAtlasiP70303. baseline and differential.
GenevisibleiP70303. MM.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
3.40.50.880. 1 hit.
InterProiIPR029062. Class_I_gatase-like.
IPR004468. CTP_synthase.
IPR017456. CTP_synthase_N.
IPR017926. GATASE.
IPR027417. P-loop_NTPase.
[Graphical view]
PANTHERiPTHR11550. PTHR11550. 1 hit.
PfamiPF06418. CTP_synth_N. 1 hit.
PF00117. GATase. 1 hit.
[Graphical view]
SUPFAMiSSF52317. SSF52317. 1 hit.
SSF52540. SSF52540. 1 hit.
TIGRFAMsiTIGR00337. PyrG. 1 hit.
PROSITEiPS51273. GATASE_TYPE_1. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Identification and characterization of a novel gene (CTPsH) homologous to murine CTP synthetase gene."
    Yang B.Z., Ding J.H., Roe C.R., Zhang H., Cooney D.A., Roller P.P., Johns D.G.
    Submitted (FEB-1996) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Strain: C57BL/6J X CBA/J.
    Tissue: Liver.
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3).
    Strain: C57BL/6J.
    Tissue: Bone marrow, Heart, Hippocampus and Medulla oblongata.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: FVB/N.
    Tissue: Mammary tumor.
  4. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-568; SER-571 AND SER-574, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain, Brown adipose tissue, Kidney, Liver, Lung, Pancreas and Spleen.

Entry informationi

Entry nameiPYRG2_MOUSE
AccessioniPrimary (citable) accession number: P70303
Secondary accession number(s): Q3TPQ2, Q3TT59
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 25, 2006
Last sequence update: February 1, 1997
Last modified: July 6, 2016
This is version 132 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.