SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

P70266

- F261_MOUSE

UniProt

P70266 - F261_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1
Gene
Pfkfb1
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at transcript leveli

Functioni

Synthesis and degradation of fructose 2,6-bisphosphate.

Catalytic activityi

Beta-D-fructose 2,6-bisphosphate + H2O = D-fructose 6-phosphate + phosphate.
ATP + D-fructose 6-phosphate = ADP + beta-D-fructose 2,6-bisphosphate.

Enzyme regulationi

Phosphorylation at Ser-33 inhibits the kinase and activates the bisphosphatase By similarity.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei82 – 821Fructose 6-phosphate By similarity
Binding sitei105 – 1051Fructose 6-phosphate By similarity
Active sitei131 – 1311 Reviewed prediction
Binding sitei133 – 1331Fructose 6-phosphate By similarity
Binding sitei139 – 1391Fructose 6-phosphate By similarity
Active sitei161 – 1611 Reviewed prediction
Binding sitei175 – 1751Fructose 6-phosphate By similarity
Binding sitei196 – 1961Fructose 6-phosphate By similarity
Binding sitei200 – 2001Fructose 6-phosphate By similarity
Binding sitei258 – 2581Fructose 2,6-bisphosphate By similarity
Active sitei259 – 2591Tele-phosphohistidine intermediate By similarity
Binding sitei265 – 2651Fructose 2,6-bisphosphate By similarity
Binding sitei271 – 2711Fructose 2,6-bisphosphate; via amide nitrogen By similarity
Binding sitei308 – 3081Fructose 2,6-bisphosphate By similarity
Active sitei328 – 3281Proton donor/acceptor By similarity
Binding sitei339 – 3391Fructose 2,6-bisphosphate By similarity
Binding sitei353 – 3531Fructose 2,6-bisphosphate By similarity
Binding sitei357 – 3571Fructose 2,6-bisphosphate By similarity
Binding sitei368 – 3681Fructose 2,6-bisphosphate By similarity
Active sitei393 – 3931Proton donor/acceptor By similarity
Binding sitei394 – 3941Fructose 2,6-bisphosphate By similarity
Binding sitei398 – 3981Fructose 2,6-bisphosphate By similarity
Binding sitei430 – 4301ATP By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi49 – 579ATP By similarity
Nucleotide bindingi170 – 1756ATP By similarity
Nucleotide bindingi350 – 3534ATP By similarity
Nucleotide bindingi394 – 3985ATP By similarity

GO - Molecular functioni

  1. 6-phosphofructo-2-kinase activity Source: UniProtKB-EC
  2. ATP binding Source: UniProtKB-KW
  3. fructose-2,6-bisphosphate 2-phosphatase activity Source: UniProtKB
  4. fructose-6-phosphate binding Source: Ensembl

GO - Biological processi

  1. dephosphorylation Source: GOC
  2. fructose 2,6-bisphosphate metabolic process Source: UniProtKB
  3. fructose metabolic process Source: InterPro
  4. organ regeneration Source: Ensembl
  5. positive regulation of glucokinase activity Source: Ensembl
  6. response to cAMP Source: Ensembl
  7. response to glucagon Source: Ensembl
  8. response to glucocorticoid Source: Ensembl
  9. response to insulin Source: Ensembl
  10. response to starvation Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Kinase, Transferase

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1
Short name:
6PF-2-K/Fru-2,6-P2ase 1
Short name:
PFK/FBPase 1
Alternative name(s):
6PF-2-K/Fru-2,6-P2ase liver isozyme
Including the following 2 domains:
Fructose-2,6-bisphosphatase (EC:3.1.3.46)
Gene namesi
Name:Pfkfb1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome X

Organism-specific databases

MGIiMGI:107816. Pfkfb1.

Subcellular locationi

GO - Cellular componenti

  1. 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1 complex Source: UniProtKB
Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed By similarity
Chaini2 – 4714706-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1
PRO_0000179961Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylserine By similarity
Modified residuei33 – 331Phosphoserine; by PKA By similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiP70266.
PaxDbiP70266.
PRIDEiP70266.

PTM databases

PhosphoSiteiP70266.

Expressioni

Tissue specificityi

Liver.

Gene expression databases

BgeeiP70266.
GenevestigatoriP70266.

Interactioni

Subunit structurei

Homodimer By similarity.

Structurei

3D structure databases

ProteinModelPortaliP70266.
SMRiP70266. Positions 7-471.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni2 – 2502496-phosphofructo-2-kinase By similarity
Add
BLAST
Regioni251 – 471221Fructose-2,6-bisphosphatase By similarity
Add
BLAST

Sequence similaritiesi

In the C-terminal section; belongs to the phosphoglycerate mutase family.

Phylogenomic databases

eggNOGiCOG0406.
GeneTreeiENSGT00390000018751.
HOGENOMiHOG000181112.
HOVERGENiHBG005628.
InParanoidiP70266.
KOiK01103.
OMAiNIRGRIG.
PhylomeDBiP70266.
TreeFamiTF313541.

Family and domain databases

Gene3Di3.40.50.1240. 1 hit.
3.40.50.300. 1 hit.
InterProiIPR003094. 6Pfruct_kin.
IPR013079. 6Phosfructo_kin.
IPR016260. Bifunct_6PFK/fruc_bisP_Ptase.
IPR013078. His_Pase_superF_clade-1.
IPR029033. His_PPase_superfam.
IPR027417. P-loop_NTPase.
IPR001345. PG/BPGM_mutase_AS.
[Graphical view]
PANTHERiPTHR10606. PTHR10606. 1 hit.
PfamiPF01591. 6PF2K. 1 hit.
PF00300. His_Phos_1. 1 hit.
[Graphical view]
PIRSFiPIRSF000709. 6PFK_2-Ptase. 1 hit.
PRINTSiPR00991. 6PFRUCTKNASE.
SMARTiSM00855. PGAM. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
SSF53254. SSF53254. 1 hit.
PROSITEiPS00175. PG_MUTASE. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: P70266-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MSREMGELTQ TRLQKIWIPH SSSSSLLQRR RGSSIPQFTN SPTMVIMVGL    50
PARGKTYIST KLTRYLNWIG TPTKVFNLGQ YRREAVSYRN YEFFRPDNME 100
AQLIRKQCAL AALKDVHKYL SREEGHVAVF DATNTTRERR SLILQFAKEH 150
GYKVFFIESI CNDPDIIAEN IKQVKLGSPD YIDCDQEKVL EDFLKRIECY 200
EINYQPLDEE LDSHLSYIKI FDVGTRYMVN RVQDHVQSRT AYYLMNIHVT 250
PRSIYLCRHG ESELNLRGRI GGDSGLSARG KQYAYALANF IRSQSISSLK 300
VWTSHMKRTI QTAEALGVPY EQWKALNEID AGVCEEMTYE EIQEHYPEEF 350
ALRDQDKYRY RYPKGESYED LVQRLEPVIM ELERQENVLV ICHQAVMRCL 400
LAYFLDKSSD ELPYLKCPLH TVLKLTPVAY GCRVESIYLN VEAVNTHRDK 450
PENVDITREP EEALDTVPAH Y 471
Length:471
Mass (Da):54,849
Last modified:January 9, 2007 - v2
Checksum:iA8EA464FB4B2DA42
GO
Isoform 2 (identifier: P70266-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     2-33: SREMGELTQTRLQKIWIPHSSSSSLLQRRRGS → MEEKASKRAA

Note: No experimental confirmation available.

Show »
Length:449
Mass (Da):52,244
Checksum:iE1BCE0322914BC2F
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei2 – 3332SREMG…RRRGS → MEEKASKRAA in isoform 2.
VSP_022168Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti460 – 4601P → A in CAA67353. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK132629 mRNA. Translation: BAE21271.1.
AL672150 Genomic DNA. Translation: CAM21428.1.
X98848 mRNA. Translation: CAA67353.1.
PIRiS74243.
RefSeqiNP_032850.1. NM_008824.3.
XP_006528818.1. XM_006528755.1. [P70266-1]
UniGeneiMm.249131.

Genome annotation databases

EnsembliENSMUST00000112713; ENSMUSP00000108333; ENSMUSG00000025271. [P70266-1]
GeneIDi18639.
KEGGimmu:18639.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK132629 mRNA. Translation: BAE21271.1 .
AL672150 Genomic DNA. Translation: CAM21428.1 .
X98848 mRNA. Translation: CAA67353.1 .
PIRi S74243.
RefSeqi NP_032850.1. NM_008824.3.
XP_006528818.1. XM_006528755.1. [P70266-1 ]
UniGenei Mm.249131.

3D structure databases

ProteinModelPortali P70266.
SMRi P70266. Positions 7-471.
ModBasei Search...
MobiDBi Search...

PTM databases

PhosphoSitei P70266.

Proteomic databases

MaxQBi P70266.
PaxDbi P70266.
PRIDEi P70266.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000112713 ; ENSMUSP00000108333 ; ENSMUSG00000025271 . [P70266-1 ]
GeneIDi 18639.
KEGGi mmu:18639.

Organism-specific databases

CTDi 5207.
MGIi MGI:107816. Pfkfb1.

Phylogenomic databases

eggNOGi COG0406.
GeneTreei ENSGT00390000018751.
HOGENOMi HOG000181112.
HOVERGENi HBG005628.
InParanoidi P70266.
KOi K01103.
OMAi NIRGRIG.
PhylomeDBi P70266.
TreeFami TF313541.

Miscellaneous databases

NextBioi 294618.
PROi P70266.
SOURCEi Search...

Gene expression databases

Bgeei P70266.
Genevestigatori P70266.

Family and domain databases

Gene3Di 3.40.50.1240. 1 hit.
3.40.50.300. 1 hit.
InterProi IPR003094. 6Pfruct_kin.
IPR013079. 6Phosfructo_kin.
IPR016260. Bifunct_6PFK/fruc_bisP_Ptase.
IPR013078. His_Pase_superF_clade-1.
IPR029033. His_PPase_superfam.
IPR027417. P-loop_NTPase.
IPR001345. PG/BPGM_mutase_AS.
[Graphical view ]
PANTHERi PTHR10606. PTHR10606. 1 hit.
Pfami PF01591. 6PF2K. 1 hit.
PF00300. His_Phos_1. 1 hit.
[Graphical view ]
PIRSFi PIRSF000709. 6PFK_2-Ptase. 1 hit.
PRINTSi PR00991. 6PFRUCTKNASE.
SMARTi SM00855. PGAM. 1 hit.
[Graphical view ]
SUPFAMi SSF52540. SSF52540. 1 hit.
SSF53254. SSF53254. 1 hit.
PROSITEi PS00175. PG_MUTASE. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: C57BL/6J.
    Tissue: Head.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  3. "Molecular cloning and tissue-specific expression of mouse kidney 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase."
    Batra R.S., Brown R.M., Brown G.K., Craig I.W.
    FEBS Lett. 393:167-173(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 402-471 (ISOFORM 1).
    Strain: BALB/c.
    Tissue: Liver.

Entry informationi

Entry nameiF261_MOUSE
AccessioniPrimary (citable) accession number: P70266
Secondary accession number(s): A2AFN0, Q3V180
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 15, 1998
Last sequence update: January 9, 2007
Last modified: September 3, 2014
This is version 113 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Multifunctional enzyme, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi