Reviewed,
UniProtKB/Swiss-Prot P70266 (F261_MOUSE)
Last modified
June 16, 2009.
Version 67.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1 Alternative name(s): 6PF-2-K/Fru-2,6-P2ASE liver isozyme Including the following 2 domains: 1- Recommended name: 6-phosphofructo-2-kinase EC=2.7.1.105 2- Recommended name: Fructose-2,6-bisphosphatase EC=3.1.3.46 | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 471 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | Synthesis and degradation of fructose 2,6-bisphosphate. |
| Catalytic activity | Beta-D-fructose 2,6-bisphosphate + H2O = D-fructose 6-phosphate + phosphate. ATP + D-fructose 6-phosphate = ADP + beta-D-fructose 2,6-bisphosphate. |
| Enzyme regulation | Phosphorylation results in inhibition of the kinase activity By similarity. |
| Subunit structure | Homodimer By similarity. |
| Tissue specificity | Liver. |
| Sequence similarities | In the C-terminal section; belongs to the phosphoglycerate mutase family. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Ligand | ATP-binding Nucleotide-binding |
| Molecular function | Hydrolase Kinase Transferase |
| PTM | Phosphoprotein |
| Technical term | Multifunctional enzyme |
| Gene Ontology (GO) | |
| Biological process | fructose 2,6-bisphosphate metabolic process Inferred from sequence or structural similarity. Source: UniProtKB |
| Cellular component | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1 complex Inferred from sequence or structural similarity. Source: UniProtKB |
| Molecular function | 6-phosphofructo-2-kinase activity Inferred from electronic annotation. Source: EC ATP bindingInferred from electronic annotation. Source: UniProtKB-KW fructose-2,6-bisphosphate 2-phosphatase activityInferred from sequence or structural similarity. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P70266-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P70266-2) The sequence of this isoform differs from the canonical sequence as follows: 1-33: MSREMGELTQTRLQKIWIPHSSSSSLLQRRRGS → MEEKASKRAA | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 471 | 471 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1 | PRO_0000179961 | |||||
Regions | |||||||||
| Nucleotide binding | 49 – 56 | 8 | ATP Potential | ||||||
| Region | 1 – 250 | 250 | 6-phosphofructo-2-kinase By similarity | ||||||
| Region | 251 – 471 | 221 | Fructose-2,6-bisphosphatase By similarity | ||||||
Sites | |||||||||
| Active site | 131 | 1 | Potential | ||||||
| Active site | 161 | 1 | Potential | ||||||
| Active site | 259 | 1 | Tele-phosphohistidine intermediate By similarity | ||||||
| Active site | 328 | 1 | Potential | ||||||
| Active site | 393 | 1 | Proton donor By similarity | ||||||
| Binding site | 105 | 1 | Fructose-6-phosphate By similarity | ||||||
| Binding site | 196 | 1 | Fructose-6-phosphate By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 33 | 1 | Phosphoserine; by PKA By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 33 | 33 | MSREM…RRRGS → MEEKASKRAA in isoform 2. | VSP_022168 | |||||
Experimental info | |||||||||
| Sequence conflict | 460 | 1 | P → A in CAA67353. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: C57BL/6J. Tissue: Head. |
| [2] | The mouse genome sequencing consortium Submitted (SEP-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [3] | "Molecular cloning and tissue-specific expression of mouse kidney 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase." Batra R.S., Brown R.M., Brown G.K., Craig I.W. FEBS Lett. 393:167-173(1996) [PubMed: 8814283] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 402-471 (ISOFORM 1). Strain: BALB/c. Tissue: Liver. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AK132629 mRNA. Translation: BAE21271.1. AL672150 Genomic DNA. Translation: CAM21428.1. X98848 mRNA. Translation: CAA67353.1. | |
| IPI | IPI00653772. IPI00816928. |
| PIR | S74243. |
| RefSeq | NP_032850.1. |
| UniGene | Mm.249131 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1FBT based on UniProtKB P07953. |
| SMR | P70266. Positions 42-470. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | P70266. 1 interaction. |
PTM databases | |
| PhosphoSite | P70266. |
Proteomic databases | |
| PRIDE | P70266. |
Genome annotation databases | |
| Ensembl | ENSMUSG00000025271. Mus musculus. [Contig view] |
| GeneID | 18639. |
| KEGG | mmu:18639. |
Organism-specific databases | |
| MGI | MGI:107816. Pfkfb1. |
Phylogenomic databases | |
| HOGENOM | P70266. |
| HOVERGEN | P70266. |
| OMA | P70266. TTHARRQ. |
Enzyme and pathway databases | |
| BRENDA | 2.7.1.105. 244. 3.1.3.46. 244. |
Gene expression databases | |
| ArrayExpress | P70266. |
| Bgee | P70266. |
| GermOnline | ENSMUSG00000025271. Mus musculus. |
Family and domain databases | |
| InterPro | IPR003094. 6Pfruct_kin. IPR013079. 6Phosfructo_kin. IPR016260. Bifunct_6PFK/fruc_bisP_Ptase. IPR001345. PG/BPGM_mutase. IPR013078. PG_mutase. [Graphical view] |
| PANTHER | PTHR10606. 6Pfruct_kin. 1 hit. |
| Pfam | PF01591. 6PF2K. 1 hit. PF00300. PGAM. 1 hit. [Graphical view] |
| PIRSF | PIRSF000709. 6PFK_2-Ptase. 1 hit. |
| PRINTS | PR00991. 6PFRUCTKNASE. |
| PROSITE | PS00175. PG_MUTASE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 294618. |
| SOURCE | Search... |
Entry information
| Entry name | F261_MOUSE | ||||||||
| Accession | Primary (citable) accession number: P70266 Secondary accession number(s): A2AFN0, Q3V180 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


