P70266 (F261_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 100.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 Short name=6PF-2-K/Fru-2,6-P2ase 1 Short name=PFK/FBPase 1 Alternative name(s): 6PF-2-K/Fru-2,6-P2ase liver isozyme Including the following 2 domains:
| ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 471 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Synthesis and degradation of fructose 2,6-bisphosphate. |
| Catalytic activity | Beta-D-fructose 2,6-bisphosphate + H2O = D-fructose 6-phosphate + phosphate. ATP + D-fructose 6-phosphate = ADP + beta-D-fructose 2,6-bisphosphate. |
| Enzyme regulation | Phosphorylation results in inhibition of the kinase activity By similarity. |
| Subunit structure | Homodimer By similarity. |
| Tissue specificity | Liver. |
| Sequence similarities | In the C-terminal section; belongs to the phosphoglycerate mutase family. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: P70266-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: P70266-2) The sequence of this isoform differs from the canonical sequence as follows: 1-33: MSREMGELTQTRLQKIWIPHSSSSSLLQRRRGS → MEEKASKRAA | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed By similarity | ||||||
| Chain | 2 – 471 | 470 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 | PRO_0000179961 | |||||
Regions | |||||||||
| Nucleotide binding | 49 – 56 | 8 | ATP Potential | ||||||
| Region | 2 – 250 | 249 | 6-phosphofructo-2-kinase By similarity | ||||||
| Region | 251 – 471 | 221 | Fructose-2,6-bisphosphatase By similarity | ||||||
Sites | |||||||||
| Active site | 131 | 1 | Potential | ||||||
| Active site | 161 | 1 | Potential | ||||||
| Active site | 259 | 1 | Tele-phosphohistidine intermediate By similarity | ||||||
| Active site | 328 | 1 | Potential | ||||||
| Active site | 393 | 1 | Proton donor By similarity | ||||||
| Binding site | 105 | 1 | Fructose-6-phosphate By similarity | ||||||
| Binding site | 196 | 1 | Fructose-6-phosphate By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 2 | 1 | N-acetylserine By similarity | ||||||
| Modified residue | 33 | 1 | Phosphoserine; by PKA By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 33 | 33 | MSREM…RRRGS → MEEKASKRAA in isoform 2. | VSP_022168 | |||||
Experimental info | |||||||||
| Sequence conflict | 460 | 1 | P → A in CAA67353. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK132629 mRNA. Translation: BAE21271.1. AL672150 Genomic DNA. Translation: CAM21428.1. X98848 mRNA. Translation: CAA67353.1. |
| IPI | IPI00653772. IPI00816928. |
| PIR | S74243. |
| RefSeq | NP_032850.1. NM_008824.2. |
| UniGene | Mm.249131. |
3D structure databases | |
| ProteinModelPortal | P70266. |
| SMR | P70266. Positions 7-471. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | P70266. |
Proteomic databases | |
| PaxDb | P70266. |
| PRIDE | P70266. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000080884; ENSMUSP00000079692; ENSMUSG00000025271. ENSMUST00000112713; ENSMUSP00000108333; ENSMUSG00000025271. |
| GeneID | 18639. |
| KEGG | mmu:18639. |
Organism-specific databases | |
| CTD | 5207. |
| MGI | MGI:107816. Pfkfb1. |
Phylogenomic databases | |
| eggNOG | COG0406. |
| GeneTree | ENSGT00390000018751. |
| HOGENOM | HOG000181112. |
| HOVERGEN | HBG005628. |
| InParanoid | P70266. |
| KO | K01103. |
| OrthoDB | EOG4HX50X. |
Gene expression databases | |
| ArrayExpress | P70266. |
| Bgee | P70266. |
| Genevestigator | P70266. |
| GermOnline | ENSMUSG00000025271. Mus musculus. |
Family and domain databases | |
| InterPro | IPR003094. 6Pfruct_kin. IPR013079. 6Phosfructo_kin. IPR016260. Bifunct_6PFK/fruc_bisP_Ptase. IPR013078. His_Pase_superF_clade-1. IPR001345. PG/BPGM_mutase_AS. [Graphical view] |
| PANTHER | PTHR10606. PTHR10606. 1 hit. |
| Pfam | PF01591. 6PF2K. 1 hit. PF00300. His_Phos_1. 1 hit. [Graphical view] |
| PIRSF | PIRSF000709. 6PFK_2-Ptase. 1 hit. |
| PRINTS | PR00991. 6PFRUCTKNASE. |
| SMART | SM00855. PGAM. 1 hit. [Graphical view] |
| PROSITE | PS00175. PG_MUTASE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 294618. |
| SOURCE | Search... |
Entry information
| Entry name | F261_MOUSE | ||||||||
| Accession | Primary (citable) accession number: P70266 Secondary accession number(s): A2AFN0, Q3V180 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
