Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

P70266

- F261_MOUSE

UniProt

P70266 - F261_MOUSE

Protein

6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1

Gene

Pfkfb1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 114 (01 Oct 2014)
      Sequence version 2 (09 Jan 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Synthesis and degradation of fructose 2,6-bisphosphate.

    Catalytic activityi

    Beta-D-fructose 2,6-bisphosphate + H2O = D-fructose 6-phosphate + phosphate.
    ATP + D-fructose 6-phosphate = ADP + beta-D-fructose 2,6-bisphosphate.

    Enzyme regulationi

    Phosphorylation at Ser-33 inhibits the kinase and activates the bisphosphatase.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei82 – 821Fructose 6-phosphateBy similarity
    Binding sitei105 – 1051Fructose 6-phosphateBy similarity
    Active sitei131 – 1311Sequence Analysis
    Binding sitei133 – 1331Fructose 6-phosphateBy similarity
    Binding sitei139 – 1391Fructose 6-phosphateBy similarity
    Active sitei161 – 1611Sequence Analysis
    Binding sitei175 – 1751Fructose 6-phosphateBy similarity
    Binding sitei196 – 1961Fructose 6-phosphateBy similarity
    Binding sitei200 – 2001Fructose 6-phosphateBy similarity
    Binding sitei258 – 2581Fructose 2,6-bisphosphateBy similarity
    Active sitei259 – 2591Tele-phosphohistidine intermediateBy similarity
    Binding sitei265 – 2651Fructose 2,6-bisphosphateBy similarity
    Binding sitei271 – 2711Fructose 2,6-bisphosphate; via amide nitrogenBy similarity
    Binding sitei308 – 3081Fructose 2,6-bisphosphateBy similarity
    Active sitei328 – 3281Proton donor/acceptorBy similarity
    Binding sitei339 – 3391Fructose 2,6-bisphosphateBy similarity
    Binding sitei353 – 3531Fructose 2,6-bisphosphateBy similarity
    Binding sitei357 – 3571Fructose 2,6-bisphosphateBy similarity
    Binding sitei368 – 3681Fructose 2,6-bisphosphateBy similarity
    Active sitei393 – 3931Proton donor/acceptorBy similarity
    Binding sitei394 – 3941Fructose 2,6-bisphosphateBy similarity
    Binding sitei398 – 3981Fructose 2,6-bisphosphateBy similarity
    Binding sitei430 – 4301ATPBy similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi49 – 579ATPBy similarity
    Nucleotide bindingi170 – 1756ATPBy similarity
    Nucleotide bindingi350 – 3534ATPBy similarity
    Nucleotide bindingi394 – 3985ATPBy similarity

    GO - Molecular functioni

    1. 6-phosphofructo-2-kinase activity Source: UniProtKB-EC
    2. ATP binding Source: UniProtKB-KW
    3. fructose-2,6-bisphosphate 2-phosphatase activity Source: UniProtKB
    4. fructose-6-phosphate binding Source: Ensembl

    GO - Biological processi

    1. dephosphorylation Source: GOC
    2. fructose 2,6-bisphosphate metabolic process Source: UniProtKB
    3. fructose metabolic process Source: InterPro
    4. organ regeneration Source: Ensembl
    5. positive regulation of glucokinase activity Source: Ensembl
    6. response to cAMP Source: Ensembl
    7. response to glucagon Source: Ensembl
    8. response to glucocorticoid Source: Ensembl
    9. response to insulin Source: Ensembl
    10. response to starvation Source: Ensembl

    Keywords - Molecular functioni

    Hydrolase, Kinase, Transferase

    Keywords - Ligandi

    ATP-binding, Nucleotide-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1
    Short name:
    6PF-2-K/Fru-2,6-P2ase 1
    Short name:
    PFK/FBPase 1
    Alternative name(s):
    6PF-2-K/Fru-2,6-P2ase liver isozyme
    Including the following 2 domains:
    Fructose-2,6-bisphosphatase (EC:3.1.3.46)
    Gene namesi
    Name:Pfkfb1
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome X

    Organism-specific databases

    MGIiMGI:107816. Pfkfb1.

    Subcellular locationi

    GO - Cellular componenti

    1. 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase complex Source: UniProtKB

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11RemovedBy similarity
    Chaini2 – 4714706-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1PRO_0000179961Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei2 – 21N-acetylserineBy similarity
    Modified residuei33 – 331Phosphoserine; by PKABy similarity

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    MaxQBiP70266.
    PaxDbiP70266.
    PRIDEiP70266.

    PTM databases

    PhosphoSiteiP70266.

    Expressioni

    Tissue specificityi

    Liver.

    Gene expression databases

    BgeeiP70266.
    GenevestigatoriP70266.

    Interactioni

    Subunit structurei

    Homodimer.By similarity

    Structurei

    3D structure databases

    ProteinModelPortaliP70266.
    SMRiP70266. Positions 7-471.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni2 – 2502496-phosphofructo-2-kinaseBy similarityAdd
    BLAST
    Regioni251 – 471221Fructose-2,6-bisphosphataseBy similarityAdd
    BLAST

    Sequence similaritiesi

    In the C-terminal section; belongs to the phosphoglycerate mutase family.Curated

    Phylogenomic databases

    eggNOGiCOG0406.
    GeneTreeiENSGT00390000018751.
    HOGENOMiHOG000181112.
    HOVERGENiHBG005628.
    InParanoidiP70266.
    KOiK01103.
    OMAiNIRGRIG.
    PhylomeDBiP70266.
    TreeFamiTF313541.

    Family and domain databases

    Gene3Di3.40.50.1240. 1 hit.
    3.40.50.300. 1 hit.
    InterProiIPR003094. 6Pfruct_kin.
    IPR013079. 6Phosfructo_kin.
    IPR016260. Bifunct_6PFK/fruc_bisP_Ptase.
    IPR013078. His_Pase_superF_clade-1.
    IPR029033. His_PPase_superfam.
    IPR027417. P-loop_NTPase.
    IPR001345. PG/BPGM_mutase_AS.
    [Graphical view]
    PANTHERiPTHR10606. PTHR10606. 1 hit.
    PfamiPF01591. 6PF2K. 1 hit.
    PF00300. His_Phos_1. 1 hit.
    [Graphical view]
    PIRSFiPIRSF000709. 6PFK_2-Ptase. 1 hit.
    PRINTSiPR00991. 6PFRUCTKNASE.
    SMARTiSM00855. PGAM. 1 hit.
    [Graphical view]
    SUPFAMiSSF52540. SSF52540. 1 hit.
    SSF53254. SSF53254. 1 hit.
    PROSITEiPS00175. PG_MUTASE. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: P70266-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSREMGELTQ TRLQKIWIPH SSSSSLLQRR RGSSIPQFTN SPTMVIMVGL    50
    PARGKTYIST KLTRYLNWIG TPTKVFNLGQ YRREAVSYRN YEFFRPDNME 100
    AQLIRKQCAL AALKDVHKYL SREEGHVAVF DATNTTRERR SLILQFAKEH 150
    GYKVFFIESI CNDPDIIAEN IKQVKLGSPD YIDCDQEKVL EDFLKRIECY 200
    EINYQPLDEE LDSHLSYIKI FDVGTRYMVN RVQDHVQSRT AYYLMNIHVT 250
    PRSIYLCRHG ESELNLRGRI GGDSGLSARG KQYAYALANF IRSQSISSLK 300
    VWTSHMKRTI QTAEALGVPY EQWKALNEID AGVCEEMTYE EIQEHYPEEF 350
    ALRDQDKYRY RYPKGESYED LVQRLEPVIM ELERQENVLV ICHQAVMRCL 400
    LAYFLDKSSD ELPYLKCPLH TVLKLTPVAY GCRVESIYLN VEAVNTHRDK 450
    PENVDITREP EEALDTVPAH Y 471
    Length:471
    Mass (Da):54,849
    Last modified:January 9, 2007 - v2
    Checksum:iA8EA464FB4B2DA42
    GO
    Isoform 2 (identifier: P70266-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         2-33: SREMGELTQTRLQKIWIPHSSSSSLLQRRRGS → MEEKASKRAA

    Note: No experimental confirmation available.

    Show »
    Length:449
    Mass (Da):52,244
    Checksum:iE1BCE0322914BC2F
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti460 – 4601P → A in CAA67353. (PubMed:8814283)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei2 – 3332SREMG…RRRGS → MEEKASKRAA in isoform 2. 1 PublicationVSP_022168Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK132629 mRNA. Translation: BAE21271.1.
    AL672150 Genomic DNA. Translation: CAM21428.1.
    X98848 mRNA. Translation: CAA67353.1.
    PIRiS74243.
    RefSeqiNP_032850.1. NM_008824.3.
    XP_006528818.1. XM_006528755.1. [P70266-1]
    UniGeneiMm.249131.

    Genome annotation databases

    EnsembliENSMUST00000112713; ENSMUSP00000108333; ENSMUSG00000025271. [P70266-1]
    GeneIDi18639.
    KEGGimmu:18639.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK132629 mRNA. Translation: BAE21271.1 .
    AL672150 Genomic DNA. Translation: CAM21428.1 .
    X98848 mRNA. Translation: CAA67353.1 .
    PIRi S74243.
    RefSeqi NP_032850.1. NM_008824.3.
    XP_006528818.1. XM_006528755.1. [P70266-1 ]
    UniGenei Mm.249131.

    3D structure databases

    ProteinModelPortali P70266.
    SMRi P70266. Positions 7-471.
    ModBasei Search...
    MobiDBi Search...

    PTM databases

    PhosphoSitei P70266.

    Proteomic databases

    MaxQBi P70266.
    PaxDbi P70266.
    PRIDEi P70266.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000112713 ; ENSMUSP00000108333 ; ENSMUSG00000025271 . [P70266-1 ]
    GeneIDi 18639.
    KEGGi mmu:18639.

    Organism-specific databases

    CTDi 5207.
    MGIi MGI:107816. Pfkfb1.

    Phylogenomic databases

    eggNOGi COG0406.
    GeneTreei ENSGT00390000018751.
    HOGENOMi HOG000181112.
    HOVERGENi HBG005628.
    InParanoidi P70266.
    KOi K01103.
    OMAi NIRGRIG.
    PhylomeDBi P70266.
    TreeFami TF313541.

    Miscellaneous databases

    NextBioi 294618.
    PROi P70266.
    SOURCEi Search...

    Gene expression databases

    Bgeei P70266.
    Genevestigatori P70266.

    Family and domain databases

    Gene3Di 3.40.50.1240. 1 hit.
    3.40.50.300. 1 hit.
    InterProi IPR003094. 6Pfruct_kin.
    IPR013079. 6Phosfructo_kin.
    IPR016260. Bifunct_6PFK/fruc_bisP_Ptase.
    IPR013078. His_Pase_superF_clade-1.
    IPR029033. His_PPase_superfam.
    IPR027417. P-loop_NTPase.
    IPR001345. PG/BPGM_mutase_AS.
    [Graphical view ]
    PANTHERi PTHR10606. PTHR10606. 1 hit.
    Pfami PF01591. 6PF2K. 1 hit.
    PF00300. His_Phos_1. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF000709. 6PFK_2-Ptase. 1 hit.
    PRINTSi PR00991. 6PFRUCTKNASE.
    SMARTi SM00855. PGAM. 1 hit.
    [Graphical view ]
    SUPFAMi SSF52540. SSF52540. 1 hit.
    SSF53254. SSF53254. 1 hit.
    PROSITEi PS00175. PG_MUTASE. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Strain: C57BL/6J.
      Tissue: Head.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    3. "Molecular cloning and tissue-specific expression of mouse kidney 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase."
      Batra R.S., Brown R.M., Brown G.K., Craig I.W.
      FEBS Lett. 393:167-173(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 402-471 (ISOFORM 1).
      Strain: BALB/c.
      Tissue: Liver.

    Entry informationi

    Entry nameiF261_MOUSE
    AccessioniPrimary (citable) accession number: P70266
    Secondary accession number(s): A2AFN0, Q3V180
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 15, 1998
    Last sequence update: January 9, 2007
    Last modified: October 1, 2014
    This is version 114 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Multifunctional enzyme, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3